F438311

General Info

Members Datasets Scaffolds Average Seq Length
414 187 828 195

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10038202|Ga0105241_100382023
Length 213
Sequence MDVSQRNRRFLTRALLVCCSMFLFGFACVPIYRIACDHGYLGGRVRNTPDGAAKVAAFKPDESRWVTVQFVANVNSALKWQFAPEAVTLRVHPGVLTEAWFDATNNAPYAIVGNAVPSVAPNTASLYFNKTECFCFTEQTLNAGESRRMPVKFFVDPKLPSDIGTLTLSYTFYNNELATKKLAGKAEIGDQGPEIGDKRLSPISDLRSPAPSS

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
128 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
129 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
184 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
185 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 2.66
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10038202 3300009174 Bacteria 3619
2 JGI24736J21556_1003621 3300001904 Bacteria 2672
3 Ga0070676_10127106 3300005328 Bacteria 1607
4 Ga0070676_10200442 3300005328 Bacteria 1308
5 Ga0070670_100065422 3300005331 Bacteria 3120
6 Ga0068869_100065110 3300005334 Bacteria 2682
7 Ga0068869_100921993 3300005334 Bacteria 757
8 Ga0070666_10000563 3300005335 Bacteria 22442
9 Ga0070666_10104626 3300005335 Bacteria 1954
10 Ga0070666_10233303 3300005335 Bacteria 1300
11 Ga0068868_100086312 3300005338 Bacteria 2522
12 Ga0070689_100238857 3300005340 Bacteria 1496
13 Ga0070661_100023472 3300005344 Bacteria 4421
14 Ga0070661_100299300 3300005344 Bacteria 1252
15 Ga0070668_100091262 3300005347 Bacteria 2401
16 Ga0070668_100343560 3300005347 Bacteria 1261
17 Ga0070669_100023263 3300005353 Bacteria 4438
18 Ga0070669_100064547 3300005353 Bacteria 2696
19 Ga0070675_100113827 3300005354 Bacteria 2292
20 Ga0070671_100189178 3300005355 Bacteria 1745
21 Ga0070674_100323039 3300005356 Bacteria 1238
22 Ga0070673_100104403 3300005364 Bacteria 2340
23 Ga0070659_100353008 3300005366 Bacteria 1234
24 Ga0070667_100000310 3300005367 Bacteria 54608
25 Ga0070667_100026425 3300005367 Bacteria 4829
26 Ga0070667_100087870 3300005367 Bacteria 2668
27 Ga0070667_100137297 3300005367 Bacteria 2138
28 Ga0070667_100252022 3300005367 Bacteria 1578
29 Ga0070667_100275205 3300005367 Bacteria 1510
30 Ga0070667_100471731 3300005367 Bacteria 1148
31 Ga0070709_10230956 3300005434 Bacteria 1324
32 Ga0070711_100034492 3300005439 Bacteria 3375
33 Ga0070711_100302226 3300005439 Bacteria 1273
34 Ga0070663_100000474 3300005455 Bacteria 21134
35 Ga0070663_100011548 3300005455 Bacteria 5550
36 Ga0070663_100059735 3300005455 Bacteria 2741
37 Ga0070663_100172522 3300005455 Bacteria 1673
38 Ga0070663_100316486 3300005455 Bacteria 1254
39 Ga0070662_100070658 3300005457 Bacteria 2572
40 Ga0070681_10069399 3300005458 Bacteria 3490
41 Ga0070685_10000267 3300005466 Bacteria 33632
42 Ga0070685_10276351 3300005466 Bacteria 1123
43 Ga0070679_100502085 3300005530 Bacteria 1157
44 Ga0068853_100001600 3300005539 Bacteria 16494
45 Ga0068853_100002817 3300005539 Bacteria 13167
46 Ga0068853_100006089 3300005539 Bacteria 9551
47 Ga0068853_100019203 3300005539 Bacteria 5664
48 Ga0068853_100103801 3300005539 Bacteria 2516
49 Ga0068853_100279316 3300005539 Bacteria 1539
50 Ga0070665_100000126 3300005548 Bacteria 146495
51 Ga0070665_100000457 3300005548 Bacteria 59529
52 Ga0070665_100077038 3300005548 Bacteria 3341
53 Ga0070665_100119933 3300005548 Bacteria 2632
54 Ga0070665_100189850 3300005548 Bacteria 2056
55 Ga0070665_100198350 3300005548 Bacteria 2008
56 Ga0068855_100052168 3300005563 Bacteria 4815
57 Ga0068855_100173653 3300005563 Bacteria 2440
58 Ga0068855_100285937 3300005563 Bacteria 1829
59 Ga0068855_100523151 3300005563 Bacteria 1287
60 Ga0068855_100882291 3300005563 Bacteria 946
61 Ga0070664_100506918 3300005564 Bacteria 1113
62 Ga0068857_100055516 3300005577 Bacteria 3515
63 Ga0068857_100120134 3300005577 Bacteria 2365
64 Ga0068857_100198249 3300005577 Bacteria 1830
65 Ga0068857_100264110 3300005577 Bacteria 1581
66 Ga0068857_100475368 3300005577 Bacteria 1171
67 Ga0068854_100027644 3300005578 Bacteria 3912
68 Ga0068854_100469296 3300005578 Bacteria 1055
69 Ga0068856_100149203 3300005614 Bacteria 2346
70 Ga0068852_100028406 3300005616 Bacteria 4578
71 Ga0068852_100038809 3300005616 Bacteria 4005
72 Ga0068852_100152905 3300005616 Bacteria 2147
73 Ga0068852_100160511 3300005616 Bacteria 2099
74 Ga0068852_100257998 3300005616 Bacteria 1673
75 Ga0068852_100752417 3300005616 Bacteria 987
76 Ga0068859_100008015 3300005617 Bacteria 10708
77 Ga0068864_100002081 3300005618 Bacteria 16538
78 Ga0068861_100150360 3300005719 Bacteria 1910
79 Ga0068851_10034161 3300005834 Bacteria 2537
80 Ga0068851_10062009 3300005834 Bacteria 1917
81 Ga0068863_100006704 3300005841 Bacteria 11297
82 Ga0068863_100025855 3300005841 Bacteria 5601
83 Ga0068863_100178607 3300005841 Bacteria 2038
84 Ga0068863_100211297 3300005841 Bacteria 1869
85 Ga0068863_100225974 3300005841 Bacteria 1804
86 Ga0068863_100851595 3300005841 Bacteria 911
87 Ga0068858_100000546 3300005842 Bacteria 39189
88 Ga0068858_100354957 3300005842 Bacteria 1405
89 Ga0068860_100002226 3300005843 Bacteria 20412
90 Ga0068860_100021545 3300005843 Bacteria 6240
91 Ga0068860_100307399 3300005843 Bacteria 1554
92 Ga0068862_100000076 3300005844 Bacteria 117053
93 Ga0097621_100256480 3300006237 Bacteria 1533
94 Ga0068865_100028187 3300006881 Bacteria 3716
95 Ga0068865_100044532 3300006881 Bacteria 3038
96 Ga0068865_100163796 3300006881 Bacteria 1699
97 Ga0068865_100204803 3300006881 Bacteria 1534
98 Ga0068865_100813864 3300006881 Bacteria 807
99 Ga0097620_100008016 3300006931 Bacteria 10708
100 Ga0097620_100029254 3300006931 Bacteria 5527
101 Ga0105240_10017406 3300009093 Bacteria 9687
102 Ga0105240_10280368 3300009093 Bacteria 1915
103 Ga0105240_10601223 3300009093 Bacteria 1211
104 Ga0105245_10180249 3300009098 Bacteria 2018
105 Ga0105245_10748372 3300009098 Bacteria 1013
106 Ga0105247_10024640 3300009101 Bacteria 3627
107 Ga0105247_10593751 3300009101 Bacteria 820
108 Ga0105241_10071671 3300009174 Bacteria 2690
109 Ga0105241_10416173 3300009174 Bacteria 1182
110 Ga0105241_11158514 3300009174 Bacteria 730
111 Ga0105242_10004611 3300009176 Bacteria 10684
112 Ga0105242_10408337 3300009176 Bacteria 1269
113 Ga0105242_11055625 3300009176 Bacteria 824
114 Ga0105248_10000234 3300009177 Bacteria 63799
115 Ga0105248_10723313 3300009177 Bacteria 1123
116 Ga0105248_10789299 3300009177 Bacteria 1072
117 Ga0105248_10844887 3300009177 Bacteria 1033
118 Ga0105237_10008582 3300009545 Bacteria 11048
119 Ga0105237_10046393 3300009545 Bacteria 4371
120 Ga0105237_10117360 3300009545 Bacteria 2655
121 Ga0105237_10735233 3300009545 Bacteria 993
122 Ga0105238_10000775 3300009551 Bacteria 33222
123 Ga0105238_10012856 3300009551 Bacteria 8447
124 Ga0105238_10071957 3300009551 Bacteria 3455
125 Ga0105249_10005320 3300009553 Bacteria 11110
126 Ga0105249_10013647 3300009553 Bacteria 7174
127 Ga0105249_10042362 3300009553 Bacteria 4140
128 Ga0105249_10339071 3300009553 Bacteria 1519
129 Ga0105239_10001838 3300010375 Bacteria 27784
130 Ga0105239_10022690 3300010375 Bacteria 6918
131 Ga0105239_10052174 3300010375 Bacteria 4485
132 Ga0105239_10077317 3300010375 Bacteria 3662
133 Ga0105239_10410674 3300010375 Bacteria 1533
134 Ga0105239_10637151 3300010375 Bacteria 1217
135 Ga0105239_10937352 3300010375 Bacteria 994
136 Ga0157371_10093808 3300013102 Bacteria 2127
137 Ga0157370_11250914 3300013104 Bacteria 669
138 Ga0157369_10000021 3300013105 Bacteria 239073
139 Ga0157374_10142986 3300013296 Bacteria 2323
140 Ga0157374_10203043 3300013296 Bacteria 1941
141 Ga0157378_10000010 3300013297 Bacteria 161268
142 Ga0163162_10000014 3300013306 Bacteria 268371
143 Ga0163162_10751852 3300013306 Bacteria 1094
144 Ga0163162_11181039 3300013306 Bacteria 868
145 Ga0157372_10009673 3300013307 Bacteria 10248
146 Ga0157372_10097564 3300013307 Bacteria 3352
147 Ga0157372_10349146 3300013307 Bacteria 1723
148 Ga0157372_10933671 3300013307 Bacteria 1006
149 Ga0157375_10000281 3300013308 Bacteria 46431
150 Ga0163163_10540394 3300014325 Bacteria 1228
151 Ga0163163_11045296 3300014325 Bacteria 880
152 Ga0182008_10101200 3300014497 Bacteria 1424
153 Ga0182008_10456413 3300014497 Bacteria 696
154 Ga0157379_10005182 3300014968 Bacteria 11194
155 Ga0157379_10204821 3300014968 Bacteria 1785
156 Ga0157376_10016469 3300014969 Bacteria 5614
157 Ga0157376_10031966 3300014969 Bacteria 4221
158 Ga0157376_10467100 3300014969 Bacteria 1234
159 Ga0213876_10101721 3300021384 Bacteria 1524
160 Ga0209233_1035352 3300025261 Bacteria 1130
161 Ga0209673_1065364 3300025273 Bacteria 888
162 Ga0209673_1083356 3300025273 Bacteria 727
163 Ga0209051_1010231 3300025303 Bacteria 4763
164 Ga0207656_10006405 3300025321 Bacteria 4229
165 Ga0207656_10006499 3300025321 Bacteria 4208
166 Ga0207692_10058068 3300025898 Bacteria 1992
167 Ga0207710_10194828 3300025900 Bacteria 999
168 Ga0207680_10004553 3300025903 Bacteria 6582
169 Ga0207680_10230111 3300025903 Bacteria 1274
170 Ga0207680_10307756 3300025903 Bacteria 1105
171 Ga0207647_10000823 3300025904 Bacteria 24101
172 Ga0207647_10105710 3300025904 Bacteria 1667
173 Ga0207699_10509754 3300025906 Bacteria 869
174 Ga0207645_10037945 3300025907 Bacteria 3091
175 Ga0207643_10065556 3300025908 Bacteria 2080
176 Ga0207705_10094151 3300025909 Bacteria 2196
177 Ga0207654_10006180 3300025911 Bacteria 6022
178 Ga0207654_10069891 3300025911 Bacteria 2083
179 Ga0207654_10297692 3300025911 Bacteria 1096
180 Ga0207707_10141860 3300025912 Bacteria 2100
181 Ga0207695_10000219 3300025913 Bacteria 153492
182 Ga0207695_10008552 3300025913 Bacteria 12794
183 Ga0207695_10018571 3300025913 Bacteria 8034
184 Ga0207695_10442087 3300025913 Bacteria 1184
185 Ga0207695_10451045 3300025913 Bacteria 1169
186 Ga0207671_10003768 3300025914 Bacteria 14910
187 Ga0207671_10007167 3300025914 Bacteria 9720
188 Ga0207671_10007375 3300025914 Bacteria 9551
189 Ga0207671_10406384 3300025914 Bacteria 1083
190 Ga0207663_10083706 3300025916 Bacteria 2096
191 Ga0207649_10023143 3300025920 Bacteria 3595
192 Ga0207649_10470018 3300025920 Bacteria 952
193 Ga0207652_10334779 3300025921 Bacteria 1367
194 Ga0207681_10015224 3300025923 Bacteria 4795
195 Ga0207681_10136632 3300025923 Bacteria 1820
196 Ga0207694_10001049 3300025924 Bacteria 24058
197 Ga0207694_10001086 3300025924 Bacteria 23562
198 Ga0207694_10005872 3300025924 Bacteria 9410
199 Ga0207694_10206765 3300025924 Bacteria 1598
200 Ga0207650_10003320 3300025925 Bacteria 11079
201 Ga0207650_10145431 3300025925 Bacteria 1867
202 Ga0207650_10639450 3300025925 Bacteria 896
203 Ga0207687_10111825 3300025927 Bacteria 2028
204 Ga0207644_10254976 3300025931 Bacteria 1401
205 Ga0207644_10346727 3300025931 Bacteria 1205
206 Ga0207706_10067047 3300025933 Bacteria 3158
207 Ga0207686_10706913 3300025934 Bacteria 802
208 Ga0207704_10018063 3300025938 Bacteria 3672
209 Ga0207704_10036227 3300025938 Bacteria 2837
210 Ga0207704_10131415 3300025938 Bacteria 1734
211 Ga0207704_10429502 3300025938 Bacteria 1049
212 Ga0207711_10000968 3300025941 Bacteria 27479
213 Ga0207711_10115224 3300025941 Bacteria 2395
214 Ga0207689_10027861 3300025942 Bacteria 4727
215 Ga0207689_10496884 3300025942 Bacteria 1022
216 Ga0207689_10840627 3300025942 Bacteria 775
217 Ga0207661_10347363 3300025944 Bacteria 1338
218 Ga0207679_11211973 3300025945 Bacteria 693
219 Ga0207667_10007168 3300025949 Bacteria 13458
220 Ga0207667_10064752 3300025949 Bacteria 3815
221 Ga0207667_10353640 3300025949 Bacteria 1498
222 Ga0207667_10838500 3300025949 Unclassified 914
223 Ga0207651_10118162 3300025960 Bacteria 2005
224 Ga0207712_10000198 3300025961 Bacteria 60986
225 Ga0207712_10000743 3300025961 Bacteria 24676
226 Ga0207712_10366903 3300025961 Bacteria 1201
227 Ga0207668_10045664 3300025972 Bacteria 2989
228 Ga0207668_10329655 3300025972 Bacteria 1269
229 Ga0207640_10016234 3300025981 Bacteria 4328
230 Ga0207640_10276809 3300025981 Bacteria 1316
231 Ga0207658_10000156 3300025986 Bacteria 71648
232 Ga0207658_10025831 3300025986 Bacteria 4114
233 Ga0207658_10091461 3300025986 Bacteria 2360
234 Ga0207658_10221064 3300025986 Bacteria 1593
235 Ga0207658_10284288 3300025986 Bacteria 1419
236 Ga0207677_10110584 3300026023 Bacteria 2045
237 Ga0207677_10277100 3300026023 Bacteria 1375
238 Ga0207703_10000344 3300026035 Bacteria 50393
239 Ga0207639_10000397 3300026041 Bacteria 29988
240 Ga0207639_10000606 3300026041 Bacteria 24698
241 Ga0207639_10002439 3300026041 Bacteria 12495
242 Ga0207639_10005980 3300026041 Bacteria 8255
243 Ga0207639_10423962 3300026041 Bacteria 1203
244 Ga0207678_10000962 3300026067 Bacteria 26339
245 Ga0207678_10064669 3300026067 Bacteria 3143
246 Ga0207678_10084651 3300026067 Bacteria 2711
247 Ga0207678_10088988 3300026067 Bacteria 2639
248 Ga0207678_10176202 3300026067 Bacteria 1826
249 Ga0207678_10241643 3300026067 Bacteria 1546
250 Ga0207678_10742700 3300026067 Bacteria 865
251 Ga0207702_10108238 3300026078 Bacteria 2466
252 Ga0207641_10013781 3300026088 Bacteria 6630
253 Ga0207641_10028964 3300026088 Bacteria 4578
254 Ga0207641_10498751 3300026088 Bacteria 1182
255 Ga0207641_10523991 3300026088 Bacteria 1153
256 Ga0207641_10527376 3300026088 Bacteria 1149
257 Ga0207676_10016237 3300026095 Bacteria 5391
258 Ga0207674_10063241 3300026116 Bacteria 3735
259 Ga0207674_10091985 3300026116 Bacteria 3023
260 Ga0207674_10094888 3300026116 Bacteria 2969
261 Ga0207674_10276180 3300026116 Bacteria 1628
262 Ga0207675_100108114 3300026118 Bacteria 2623
263 Ga0207675_100667077 3300026118 Bacteria 1047
264 Ga0207675_101456488 3300026118 Bacteria 705
265 Ga0207698_10006549 3300026142 Bacteria 7278
266 Ga0207698_10094722 3300026142 Bacteria 2456
267 Ga0207698_10113936 3300026142 Bacteria 2273
268 Ga0207698_10136100 3300026142 Bacteria 2108
269 Ga0207698_10157737 3300026142 Bacteria 1980
270 Ga0207698_10578740 3300026142 Bacteria 1104
271 Ga0268266_10000001 3300028379 Bacteria 4040580
272 Ga0268266_10000008 3300028379 Bacteria 1161875
273 Ga0268266_10047206 3300028379 Bacteria 3688
274 Ga0268266_10226212 3300028379 Bacteria 1721
275 Ga0268266_10298955 3300028379 Bacteria 1501
276 Ga0268266_10735806 3300028379 Bacteria 951
277 Ga0268265_10003567 3300028380 Bacteria 11120
278 Ga0268264_10008829 3300028381 Bacteria 8355
279 Ga0268264_10044131 3300028381 Bacteria 3697
280 Ga0268264_10229041 3300028381 Bacteria 1715
281 Ga0307517_10247165 3300028786 Bacteria 1051
282 Ga0265331_10024635 3300031250 Bacteria 3042
283 Ga0265327_10000135 3300031251 Bacteria 162683
284 Ga0307508_10199638 3300031616 Bacteria 1601
285 Ga0307516_10054699 3300031730 Bacteria 3899
286 Ga0307414_10023737 3300032004 Bacteria 3895
287 Ga0307507_10168965 3300033179 Bacteria 1594
288 Ga0373954_0339464 3300035118 Bacteria 742
289 Ga0373933_0293984 3300035724 Bacteria 1051
290 Ga0373937_0028240 3300036401 Bacteria 5075
291 Ga0436365_0263381 3300039437 Bacteria 1616
292 Ga0436365_0281433 3300039437 Bacteria 2940
293 Ga0451793_0132042 3300041452 Bacteria 1762
294 Ga0451795_0055894 3300041456 Bacteria 1487
295 Ga0451795_0115822 3300041456 Bacteria 1152
296 Ga0451835_1153108 3300041492 Unclassified 832
297 Ga0451841_1095515 3300041498 Bacteria 1358
298 Ga0451853_1414463 3300041512 Bacteria 1469
299 Ga0451853_2050411 3300041512 Bacteria 910
300 Ga0451853_3184719 3300041512 Bacteria 1489
301 Ga0466959_0002040 3300045049 Bacteria 12764
302 Ga0466967_0368297 3300045976 Bacteria 1393
303 Ga0495582_0223634 3300046473 Bacteria 1077
304 Ga0495639_0075881 3300046475 Bacteria 1559
305 Ga0495664_0245908 3300046477 Bacteria 1082
306 Ga0495630_0168184 3300046517 Bacteria 1670
307 Ga0495665_0256274 3300046531 Bacteria 900
308 Ga0495613_0670238 3300046689 Bacteria 685
309 Ga0495604_0366577 3300047317 Bacteria 954
310 Ga0495674_0278923 3300047319 Bacteria 1370
311 Ga0495686_0005616 3300047472 Bacteria 9843
312 Ga0495686_0166653 3300047472 Bacteria 1284
313 Ga0496102_0295372 3300048905 Bacteria 1527
314 Ga0496103_0053193 3300048906 Bacteria 2509
315 Ga0496104_0000045 3300048907 Bacteria 152445
316 Ga0496105_0000075 3300048908 Bacteria 75152
317 Ga0496113_0222606 3300048916 Bacteria 1504
318 Ga0496114_0455811 3300048917 Bacteria 1132
319 Ga0496115_0000164 3300048918 Bacteria 62174
320 Ga0496115_0084489 3300048918 Bacteria 2588
321 Ga0496117_0062670 3300048920 Bacteria 2547
322 Ga0496117_0133461 3300048920 Bacteria 1500
323 Ga0496118_0003096 3300048921 Bacteria 21335
324 Ga0496118_0096171 3300048921 Bacteria 2019
325 Ga0496118_0198978 3300048921 Bacteria 1189
326 Ga0496121_0162071 3300048924 Bacteria 1634
327 Ga0496122_0000178 3300048925 Bacteria 150162
328 Ga0496123_0001277 3300048926 Bacteria 35976
329 Ga0496126_0000683 3300048929 Bacteria 62337
330 Ga0496126_0207894 3300048929 Bacteria 1649
331 Ga0501031_0006970 3300049568 Bacteria 7381
332 Ga0501031_0165087 3300049568 Bacteria 1447
333 Ga0501032_0005906 3300049569 Bacteria 9048
334 Ga0501032_0007665 3300049569 Bacteria 7870
335 Ga0501032_0045508 3300049569 Bacteria 2967
336 Ga0501032_0144874 3300049569 Bacteria 1564
337 Ga0501032_0280609 3300049569 Bacteria 1078
338 Ga0501033_0008693 3300049570 Bacteria 7852
339 Ga0501033_0060701 3300049570 Bacteria 2788
340 Ga0501033_0162963 3300049570 Bacteria 1604
341 Ga0501033_0345627 3300049570 Bacteria 1042
342 Ga0501034_0000311 3300049571 Bacteria 86241
343 Ga0501034_0022616 3300049571 Bacteria 6404
344 Ga0501034_0046171 3300049571 Bacteria 4401
345 Ga0501034_0058796 3300049571 Bacteria 3862
346 Ga0501034_0271827 3300049571 Bacteria 1635
347 Ga0501034_0355917 3300049571 Bacteria 1391
348 Ga0501036_0008228 3300049572 Bacteria 8550
349 Ga0501036_0019598 3300049572 Bacteria 5679
350 Ga0501036_0213148 3300049572 Bacteria 1622
351 Ga0501036_1120667 3300049572 Bacteria 642
352 Ga0501037_0010373 3300049573 Bacteria 6834
353 Ga0501037_0100920 3300049573 Bacteria 2083
354 Ga0501037_0187718 3300049573 Bacteria 1464
355 Ga0501037_0465879 3300049573 Bacteria 860
356 Ga0501038_0009034 3300049574 Bacteria 9146
357 Ga0501038_0021010 3300049574 Bacteria 5865
358 Ga0501038_0060023 3300049574 Bacteria 3256
359 Ga0501038_0187589 3300049574 Bacteria 1665
360 Ga0501038_0253767 3300049574 Bacteria 1392
361 Ga0501039_0001729 3300049575 Bacteria 16082
362 Ga0501039_0007053 3300049575 Bacteria 8555
363 Ga0501039_0029680 3300049575 Bacteria 4212
364 Ga0501042_0072075 3300049578 Bacteria 2472
365 Ga0501043_0003817 3300049579 Bacteria 12394
366 Ga0501043_0170228 3300049579 Bacteria 1699
367 Ga0501046_0002126 3300049580 Bacteria 18729
368 Ga0501046_0026451 3300049580 Bacteria 4739
369 Ga0501046_0290526 3300049580 Bacteria 1196
370 Ga0501047_0008470 3300049581 Bacteria 9704
371 Ga0501047_0111545 3300049581 Bacteria 2617
372 Ga0501047_0214507 3300049581 Bacteria 1782
373 Ga0501047_0339641 3300049581 Bacteria 1339
374 Ga0501048_0036626 3300049582 Bacteria 3525
375 Ga0501048_0109663 3300049582 Bacteria 1949
376 Ga0501068_0185122 3300049584 Bacteria 1317
377 Ga0501069_0090566 3300049585 Bacteria 1729
378 Ga0501070_0209684 3300049586 Bacteria 1599
379 Ga0501070_0215678 3300049586 Bacteria 1574
380 Ga0501070_0285094 3300049586 Bacteria 1347
381 Ga0501071_0065559 3300049587 Bacteria 2637
382 Ga0501071_0096880 3300049587 Bacteria 2171
383 Ga0501073_0011441 3300049589 Bacteria 6492
384 Ga0501073_0195916 3300049589 Bacteria 1397
385 Ga0501073_0439978 3300049589 Bacteria 901
386 Ga0501073_0718946 3300049589 Bacteria 689
387 Ga0501074_0426514 3300049590 Bacteria 940
388 Ga0501079_0033342 3300049741 Bacteria 3961
389 Ga0501079_0175065 3300049741 Bacteria 1673
390 Ga0501080_0051612 3300049742 Bacteria 3827
391 Ga0501080_0120163 3300049742 Bacteria 2435
392 Ga0501080_0129641 3300049742 Bacteria 2334
393 Ga0501080_0261833 3300049742 Bacteria 1575
394 Ga0501083_0015058 3300049744 Bacteria 5412
395 Ga0501083_0192955 3300049744 Bacteria 1329
396 Ga0501083_0447092 3300049744 Bacteria 841
397 Ga0501035_0009523 3300049822 Bacteria 9033
398 Ga0501035_0011810 3300049822 Bacteria 8086
399 Ga0501035_0140201 3300049822 Bacteria 2102
400 Ga0501035_0521109 3300049822 Bacteria 976
401 Ga0501044_0004326 3300049823 Bacteria 15919
402 Ga0501044_0093337 3300049823 Bacteria 3034
403 Ga0501044_0176414 3300049823 Bacteria 2106
404 Ga0501044_0206149 3300049823 Bacteria 1922
405 Ga0501044_0384133 3300049823 Bacteria 1319
406 Ga0501045_0346387 3300049824 Bacteria 1106
407 Ga0500610_0000179 3300053079 Bacteria 19090
408 Ga0500651_0000508 3300053093 Bacteria 20161
409 Ga0500597_038480 3300053120 Bacteria 2002
410 Ga0500588_0053279 3300053146 Bacteria 1270
411 Ga0500661_015721 3300055283 Bacteria 1356
412 Ga0501082_0003274 3300060353 Bacteria 14138
413 Ga0501082_0127714 3300060353 Bacteria 2205
414 Ga0530510_0520765 3300061734 Bacteria 902
415 Ga0105241_10038202
416 JGI24736J21556_1003621
417 Ga0070676_10127106
418 Ga0070676_10200442
419 Ga0070670_100065422
420 Ga0068869_100065110
421 Ga0068869_100921993
422 Ga0070666_10000563
423 Ga0070666_10104626
424 Ga0070666_10233303
425 Ga0068868_100086312
426 Ga0070689_100238857
427 Ga0070661_100023472
428 Ga0070661_100299300
429 Ga0070668_100091262
430 Ga0070668_100343560
431 Ga0070669_100023263
432 Ga0070669_100064547
433 Ga0070675_100113827
434 Ga0070671_100189178
435 Ga0070674_100323039
436 Ga0070673_100104403
437 Ga0070659_100353008
438 Ga0070667_100000310
439 Ga0070667_100026425
440 Ga0070667_100087870
441 Ga0070667_100137297
442 Ga0070667_100252022
443 Ga0070667_100275205
444 Ga0070667_100471731
445 Ga0070709_10230956
446 Ga0070711_100034492
447 Ga0070711_100302226
448 Ga0070663_100000474
449 Ga0070663_100011548
450 Ga0070663_100059735
451 Ga0070663_100172522
452 Ga0070663_100316486
453 Ga0070662_100070658
454 Ga0070681_10069399
455 Ga0070685_10000267
456 Ga0070685_10276351
457 Ga0070679_100502085
458 Ga0068853_100001600
459 Ga0068853_100002817
460 Ga0068853_100006089
461 Ga0068853_100019203
462 Ga0068853_100103801
463 Ga0068853_100279316
464 Ga0070665_100000126
465 Ga0070665_100000457
466 Ga0070665_100077038
467 Ga0070665_100119933
468 Ga0070665_100189850
469 Ga0070665_100198350
470 Ga0068855_100052168
471 Ga0068855_100173653
472 Ga0068855_100285937
473 Ga0068855_100523151
474 Ga0068855_100882291
475 Ga0070664_100506918
476 Ga0068857_100055516
477 Ga0068857_100120134
478 Ga0068857_100198249
479 Ga0068857_100264110
480 Ga0068857_100475368
481 Ga0068854_100027644
482 Ga0068854_100469296
483 Ga0068856_100149203
484 Ga0068852_100028406
485 Ga0068852_100038809
486 Ga0068852_100152905
487 Ga0068852_100160511
488 Ga0068852_100257998
489 Ga0068852_100752417
490 Ga0068859_100008015
491 Ga0068864_100002081
492 Ga0068861_100150360
493 Ga0068851_10034161
494 Ga0068851_10062009
495 Ga0068863_100006704
496 Ga0068863_100025855
497 Ga0068863_100178607
498 Ga0068863_100211297
499 Ga0068863_100225974
500 Ga0068863_100851595
501 Ga0068858_100000546
502 Ga0068858_100354957
503 Ga0068860_100002226
504 Ga0068860_100021545
505 Ga0068860_100307399
506 Ga0068862_100000076
507 Ga0097621_100256480
508 Ga0068865_100028187
509 Ga0068865_100044532
510 Ga0068865_100163796
511 Ga0068865_100204803
512 Ga0068865_100813864
513 Ga0097620_100008016
514 Ga0097620_100029254
515 Ga0105240_10017406
516 Ga0105240_10280368
517 Ga0105240_10601223
518 Ga0105245_10180249
519 Ga0105245_10748372
520 Ga0105247_10024640
521 Ga0105247_10593751
522 Ga0105241_10071671
523 Ga0105241_10416173
524 Ga0105241_11158514
525 Ga0105242_10004611
526 Ga0105242_10408337
527 Ga0105242_11055625
528 Ga0105248_10000234
529 Ga0105248_10723313
530 Ga0105248_10789299
531 Ga0105248_10844887
532 Ga0105237_10008582
533 Ga0105237_10046393
534 Ga0105237_10117360
535 Ga0105237_10735233
536 Ga0105238_10000775
537 Ga0105238_10012856
538 Ga0105238_10071957
539 Ga0105249_10005320
540 Ga0105249_10013647
541 Ga0105249_10042362
542 Ga0105249_10339071
543 Ga0105239_10001838
544 Ga0105239_10022690
545 Ga0105239_10052174
546 Ga0105239_10077317
547 Ga0105239_10410674
548 Ga0105239_10637151
549 Ga0105239_10937352
550 Ga0157371_10093808
551 Ga0157370_11250914
552 Ga0157369_10000021
553 Ga0157374_10142986
554 Ga0157374_10203043
555 Ga0157378_10000010
556 Ga0163162_10000014
557 Ga0163162_10751852
558 Ga0163162_11181039
559 Ga0157372_10009673
560 Ga0157372_10097564
561 Ga0157372_10349146
562 Ga0157372_10933671
563 Ga0157375_10000281
564 Ga0163163_10540394
565 Ga0163163_11045296
566 Ga0182008_10101200
567 Ga0182008_10456413
568 Ga0157379_10005182
569 Ga0157379_10204821
570 Ga0157376_10016469
571 Ga0157376_10031966
572 Ga0157376_10467100
573 Ga0213876_10101721
574 Ga0209233_1035352
575 Ga0209673_1065364
576 Ga0209673_1083356
577 Ga0209051_1010231
578 Ga0207656_10006405
579 Ga0207656_10006499
580 Ga0207692_10058068
581 Ga0207710_10194828
582 Ga0207680_10004553
583 Ga0207680_10230111
584 Ga0207680_10307756
585 Ga0207647_10000823
586 Ga0207647_10105710
587 Ga0207699_10509754
588 Ga0207645_10037945
589 Ga0207643_10065556
590 Ga0207705_10094151
591 Ga0207654_10006180
592 Ga0207654_10069891
593 Ga0207654_10297692
594 Ga0207707_10141860
595 Ga0207695_10000219
596 Ga0207695_10008552
597 Ga0207695_10018571
598 Ga0207695_10442087
599 Ga0207695_10451045
600 Ga0207671_10003768
601 Ga0207671_10007167
602 Ga0207671_10007375
603 Ga0207671_10406384
604 Ga0207663_10083706
605 Ga0207649_10023143
606 Ga0207649_10470018
607 Ga0207652_10334779
608 Ga0207681_10015224
609 Ga0207681_10136632
610 Ga0207694_10001049
611 Ga0207694_10001086
612 Ga0207694_10005872
613 Ga0207694_10206765
614 Ga0207650_10003320
615 Ga0207650_10145431
616 Ga0207650_10639450
617 Ga0207687_10111825
618 Ga0207644_10254976
619 Ga0207644_10346727
620 Ga0207706_10067047
621 Ga0207686_10706913
622 Ga0207704_10018063
623 Ga0207704_10036227
624 Ga0207704_10131415
625 Ga0207704_10429502
626 Ga0207711_10000968
627 Ga0207711_10115224
628 Ga0207689_10027861
629 Ga0207689_10496884
630 Ga0207689_10840627
631 Ga0207661_10347363
632 Ga0207679_11211973
633 Ga0207667_10007168
634 Ga0207667_10064752
635 Ga0207667_10353640
636 Ga0207667_10838500
637 Ga0207651_10118162
638 Ga0207712_10000198
639 Ga0207712_10000743
640 Ga0207712_10366903
641 Ga0207668_10045664
642 Ga0207668_10329655
643 Ga0207640_10016234
644 Ga0207640_10276809
645 Ga0207658_10000156
646 Ga0207658_10025831
647 Ga0207658_10091461
648 Ga0207658_10221064
649 Ga0207658_10284288
650 Ga0207677_10110584
651 Ga0207677_10277100
652 Ga0207703_10000344
653 Ga0207639_10000397
654 Ga0207639_10000606
655 Ga0207639_10002439
656 Ga0207639_10005980
657 Ga0207639_10423962
658 Ga0207678_10000962
659 Ga0207678_10064669
660 Ga0207678_10084651
661 Ga0207678_10088988
662 Ga0207678_10176202
663 Ga0207678_10241643
664 Ga0207678_10742700
665 Ga0207702_10108238
666 Ga0207641_10013781
667 Ga0207641_10028964
668 Ga0207641_10498751
669 Ga0207641_10523991
670 Ga0207641_10527376
671 Ga0207676_10016237
672 Ga0207674_10063241
673 Ga0207674_10091985
674 Ga0207674_10094888
675 Ga0207674_10276180
676 Ga0207675_100108114
677 Ga0207675_100667077
678 Ga0207675_101456488
679 Ga0207698_10006549
680 Ga0207698_10094722
681 Ga0207698_10113936
682 Ga0207698_10136100
683 Ga0207698_10157737
684 Ga0207698_10578740
685 Ga0268266_10000001
686 Ga0268266_10000008
687 Ga0268266_10047206
688 Ga0268266_10226212
689 Ga0268266_10298955
690 Ga0268266_10735806
691 Ga0268265_10003567
692 Ga0268264_10008829
693 Ga0268264_10044131
694 Ga0268264_10229041
695 Ga0307517_10247165
696 Ga0265331_10024635
697 Ga0265327_10000135
698 Ga0307508_10199638
699 Ga0307516_10054699
700 Ga0307414_10023737
701 Ga0307507_10168965
702 Ga0373954_0339464
703 Ga0373933_0293984
704 Ga0373937_0028240
705 Ga0436365_0263381
706 Ga0436365_0281433
707 Ga0451793_0132042
708 Ga0451795_0055894
709 Ga0451795_0115822
710 Ga0451835_1153108
711 Ga0451841_1095515
712 Ga0451853_1414463
713 Ga0451853_2050411
714 Ga0451853_3184719
715 Ga0466959_0002040
716 Ga0466967_0368297
717 Ga0495582_0223634
718 Ga0495639_0075881
719 Ga0495664_0245908
720 Ga0495630_0168184
721 Ga0495665_0256274
722 Ga0495613_0670238
723 Ga0495604_0366577
724 Ga0495674_0278923
725 Ga0495686_0005616
726 Ga0495686_0166653
727 Ga0496102_0295372
728 Ga0496103_0053193
729 Ga0496104_0000045
730 Ga0496105_0000075
731 Ga0496113_0222606
732 Ga0496114_0455811
733 Ga0496115_0000164
734 Ga0496115_0084489
735 Ga0496117_0062670
736 Ga0496117_0133461
737 Ga0496118_0003096
738 Ga0496118_0096171
739 Ga0496118_0198978
740 Ga0496121_0162071
741 Ga0496122_0000178
742 Ga0496123_0001277
743 Ga0496126_0000683
744 Ga0496126_0207894
745 Ga0501031_0006970
746 Ga0501031_0165087
747 Ga0501032_0005906
748 Ga0501032_0007665
749 Ga0501032_0045508
750 Ga0501032_0144874
751 Ga0501032_0280609
752 Ga0501033_0008693
753 Ga0501033_0060701
754 Ga0501033_0162963
755 Ga0501033_0345627
756 Ga0501034_0000311
757 Ga0501034_0022616
758 Ga0501034_0046171
759 Ga0501034_0058796
760 Ga0501034_0271827
761 Ga0501034_0355917
762 Ga0501036_0008228
763 Ga0501036_0019598
764 Ga0501036_0213148
765 Ga0501036_1120667
766 Ga0501037_0010373
767 Ga0501037_0100920
768 Ga0501037_0187718
769 Ga0501037_0465879
770 Ga0501038_0009034
771 Ga0501038_0021010
772 Ga0501038_0060023
773 Ga0501038_0187589
774 Ga0501038_0253767
775 Ga0501039_0001729
776 Ga0501039_0007053
777 Ga0501039_0029680
778 Ga0501042_0072075
779 Ga0501043_0003817
780 Ga0501043_0170228
781 Ga0501046_0002126
782 Ga0501046_0026451
783 Ga0501046_0290526
784 Ga0501047_0008470
785 Ga0501047_0111545
786 Ga0501047_0214507
787 Ga0501047_0339641
788 Ga0501048_0036626
789 Ga0501048_0109663
790 Ga0501068_0185122
791 Ga0501069_0090566
792 Ga0501070_0209684
793 Ga0501070_0215678
794 Ga0501070_0285094
795 Ga0501071_0065559
796 Ga0501071_0096880
797 Ga0501073_0011441
798 Ga0501073_0195916
799 Ga0501073_0439978
800 Ga0501073_0718946
801 Ga0501074_0426514
802 Ga0501079_0033342
803 Ga0501079_0175065
804 Ga0501080_0051612
805 Ga0501080_0120163
806 Ga0501080_0129641
807 Ga0501080_0261833
808 Ga0501083_0015058
809 Ga0501083_0192955
810 Ga0501083_0447092
811 Ga0501035_0009523
812 Ga0501035_0011810
813 Ga0501035_0140201
814 Ga0501035_0521109
815 Ga0501044_0004326
816 Ga0501044_0093337
817 Ga0501044_0176414
818 Ga0501044_0206149
819 Ga0501044_0384133
820 Ga0501045_0346387
821 Ga0500610_0000179
822 Ga0500651_0000508
823 Ga0500597_038480
824 Ga0500588_0053279
825 Ga0500661_015721
826 Ga0501082_0003274
827 Ga0501082_0127714
828 Ga0530510_0520765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04442

CtaG_Cox11

Cytochrome c oxidase assembly protein CtaG/Cox11

28

174

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cu7-assembly2.cif.gz_B human complement component 5 0.7617 99 159
3cu7-assembly3.cif.gz_A human complement component 5 0.7592 99 159
4o65-assembly1.cif.gz_A crystal structure of the cupredoxin domain of amob from nitrosocaldus yellowstonii 0.7533 99 158
1sp0-assembly1.cif.gz_A solution structure of apocox11 0.7386 57 176
7q5z-assembly1.cif.gz_A cryo-em structure of native human a2ml1 0.7099 83 158
ID Description Score Start End Superfamily
af_A0A1D6L299_106_203_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.956 66 156 2.60.370.10
af_Q8GWR0_141_281_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.9448 66 179 2.60.370.10
af_A3KNN8_122_254_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.9443 59 177 2.60.370.10
af_Q4DEH9_91_226_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.8932 67 187 2.60.370.10
af_A0A1D6L299_106_203_2.60.370.10 Mainly Beta;Sandwich;Ctag/Cox11 (Pfam 04442);Ctag/Cox11 0.8809 66 156 2.60.370.10
ID Description Score Start End GO Terms
AF-F3FMN7-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.964 63 178 GO:0005507
GO:0005886
AF-A0A4Q2LCD7-F1-model_v4 deleted 0.9599 63 178
AF-A0A6I1R0Z6-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9535 69 177 GO:0005507
GO:0005886
AF-A0A645HMB3-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9514 62 178 GO:0005507
GO:0016020
AF-A0A534SP11-F1-model_v4 Cytochrome c oxidase assembly protein CtaG 0.9511 69 177 GO:0005507
GO:0005886

Map