F438106

General Info

Members Datasets Scaffolds Average Seq Length
413 146 826 216

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0407336|Ga0373935_0407336_86_781
Length 231
Sequence MLDSILEVWRSLTDPERLIHLLTQVLTGWYGYALLGGIVFSETGLLVGLFLPGDSLLFTVGVVTGAGQLDIVSVCALLTVMSILGDQSGYFLGRRTGPRIFSRPDSRFFKQEYVTRTQEFYEKHGGKTLIYAKFVPIVRTFAPFMAGVGRMRYSRFLMFNVVGGIGWVLAMTIAGYYLGGVPFVRRHFEKVVVAIVLVSVLPVVLQLLKSRRPTGASAAVQGDRPTPSVPH

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.48
Rhizosphere 99.27
Stem 0
Stem Tuber 0
Unclassified 15.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0407336 3300035692 Bacteria 977
2 Ga0070658_10006158 3300005327 Bacteria 9726
3 Ga0070683_100008853 3300005329 Bacteria 8567
4 Ga0070683_100012196 3300005329 Bacteria 7460
5 Ga0070683_100080324 3300005329 Bacteria 3052
6 Ga0070683_100147896 3300005329 Bacteria 2227
7 Ga0068869_100058010 3300005334 Bacteria 2829
8 Ga0070666_10003111 3300005335 Bacteria 10079
9 Ga0070666_10337536 3300005335 Bacteria 1077
10 Ga0070680_100199977 3300005336 Bacteria 1685
11 Ga0068868_100007197 3300005338 Bacteria 7907
12 Ga0068868_100034501 3300005338 Bacteria 3906
13 Ga0068868_100036803 3300005338 Bacteria 3791
14 Ga0068868_100403880 3300005338 Unclassified 1179
15 Ga0070660_100003418 3300005339 Bacteria 10919
16 Ga0070660_100262045 3300005339 Unclassified 1412
17 Ga0070689_100285995 3300005340 Bacteria 1369
18 Ga0070661_100195604 3300005344 Bacteria 1543
19 Ga0070661_100521759 3300005344 Bacteria 953
20 Ga0070675_100573993 3300005354 Bacteria 1021
21 Ga0070671_100351611 3300005355 Bacteria 1258
22 Ga0070688_100147804 3300005365 Bacteria 1603
23 Ga0070667_100421654 3300005367 Bacteria 1216
24 Ga0070709_10007059 3300005434 Bacteria 6143
25 Ga0070709_10060270 3300005434 Bacteria 2412
26 Ga0070713_100024258 3300005436 Bacteria 4722
27 Ga0070713_100265222 3300005436 Bacteria 1571
28 Ga0070711_100189207 3300005439 Unclassified 1581
29 Ga0070711_100370019 3300005439 Unclassified 1156
30 Ga0070711_100525124 3300005439 Unclassified 979
31 Ga0070662_100069691 3300005457 Bacteria 2589
32 Ga0070681_10034357 3300005458 Bacteria 5090
33 Ga0070681_10089490 3300005458 Bacteria 3030
34 Ga0070681_10238262 3300005458 Bacteria 1733
35 Ga0070681_10302563 3300005458 Bacteria 1509
36 Ga0068867_100015919 3300005459 Bacteria 5339
37 Ga0070698_100374125 3300005471 Bacteria 1357
38 Ga0070679_100196104 3300005530 Bacteria 1987
39 Ga0070679_100217246 3300005530 Bacteria 1874
40 Ga0070679_100410551 3300005530 Bacteria 1300
41 Ga0070679_100422848 3300005530 Bacteria 1278
42 Ga0070684_100039295 3300005535 Bacteria 4069
43 Ga0070684_100050793 3300005535 Bacteria 3602
44 Ga0070684_100202197 3300005535 Bacteria 1810
45 Ga0068853_100156868 3300005539 Unclassified 2051
46 Ga0068853_100825632 3300005539 Unclassified 888
47 Ga0070696_100225352 3300005546 Bacteria 1408
48 Ga0070665_100018123 3300005548 Bacteria 7064
49 Ga0070665_100178774 3300005548 Bacteria 2123
50 Ga0068855_100000624 3300005563 Bacteria 43497
51 Ga0068855_100004531 3300005563 Bacteria 16969
52 Ga0068855_100020194 3300005563 Bacteria 8000
53 Ga0068855_100098248 3300005563 Bacteria 3373
54 Ga0068855_100113577 3300005563 Bacteria 3107
55 Ga0070664_100068065 3300005564 Unclassified 3044
56 Ga0070664_100378181 3300005564 Bacteria 1292
57 Ga0068857_100014119 3300005577 Bacteria 6955
58 Ga0068857_100016602 3300005577 Bacteria 6450
59 Ga0068857_100023922 3300005577 Bacteria 5376
60 Ga0068857_100303734 3300005577 Bacteria 1471
61 Ga0068854_100529893 3300005578 Bacteria 996
62 Ga0068856_100014817 3300005614 Bacteria 7526
63 Ga0068856_100028892 3300005614 Bacteria 5418
64 Ga0068852_100067968 3300005616 Bacteria 3117
65 Ga0068859_100015143 3300005617 Bacteria 7741
66 Ga0068864_100026883 3300005618 Bacteria 4853
67 Ga0068866_10071485 3300005718 Bacteria 1835
68 Ga0068866_10090714 3300005718 Bacteria 1663
69 Ga0068863_100177883 3300005841 Bacteria 2042
70 Ga0068863_100402392 3300005841 Unclassified 1339
71 Ga0068858_100007597 3300005842 Bacteria 10473
72 Ga0068858_100045679 3300005842 Bacteria 4060
73 Ga0068858_100061866 3300005842 Bacteria 3461
74 Ga0068858_100416023 3300005842 Unclassified 1292
75 Ga0068860_100038540 3300005843 Bacteria 4572
76 Ga0068860_100095222 3300005843 Unclassified 2838
77 Ga0068860_100423443 3300005843 Bacteria 1320
78 Ga0068860_100702586 3300005843 Bacteria 1021
79 Ga0097621_100019487 3300006237 Bacteria 5207
80 Ga0097621_100042861 3300006237 Bacteria 3646
81 Ga0097621_100046230 3300006237 Bacteria 3521
82 Ga0097621_100050172 3300006237 Bacteria 3393
83 Ga0097621_100060125 3300006237 Bacteria 3114
84 Ga0097621_100362261 3300006237 Unclassified 1292
85 Ga0097621_100509077 3300006237 Unclassified 1091
86 Ga0068871_100001320 3300006358 Bacteria 16579
87 Ga0068871_100008319 3300006358 Bacteria 7457
88 Ga0068871_100016622 3300006358 Bacteria 5549
89 Ga0068871_100022811 3300006358 Unclassified 4831
90 Ga0068871_100179545 3300006358 Bacteria 1818
91 Ga0068871_100831232 3300006358 Bacteria 853
92 Ga0068865_100092122 3300006881 Bacteria 2201
93 Ga0097620_100015143 3300006931 Bacteria 7741
94 Ga0105240_10002616 3300009093 Bacteria 28749
95 Ga0105240_10020696 3300009093 Bacteria 8766
96 Ga0105240_10029121 3300009093 Bacteria 7201
97 Ga0105240_10034857 3300009093 Bacteria 6489
98 Ga0105240_10057555 3300009093 Unclassified 4856
99 Ga0105240_10083570 3300009093 Bacteria 3917
100 Ga0105240_10188051 3300009093 Bacteria 2431
101 Ga0105240_10245931 3300009093 Bacteria 2071
102 Ga0105240_10641033 3300009093 Bacteria 1166
103 Ga0105245_10002083 3300009098 Bacteria 18160
104 Ga0105245_10002115 3300009098 Bacteria 17979
105 Ga0105245_10006523 3300009098 Bacteria 10249
106 Ga0105245_10010567 3300009098 Bacteria 8031
107 Ga0105245_10014618 3300009098 Bacteria 6835
108 Ga0105245_10018502 3300009098 Bacteria 6092
109 Ga0105245_10047817 3300009098 Bacteria 3825
110 Ga0105245_10143655 3300009098 Archaea 2250
111 Ga0105245_10240029 3300009098 Bacteria 1756
112 Ga0105245_10295997 3300009098 Unclassified 1586
113 Ga0105245_10340217 3300009098 Bacteria 1483
114 Ga0105245_10366809 3300009098 Bacteria 1430
115 Ga0105245_10803219 3300009098 Bacteria 979
116 Ga0105243_10032240 3300009148 Bacteria 4047
117 Ga0105243_10501303 3300009148 Unclassified 1150
118 Ga0105241_10013542 3300009174 Bacteria 5977
119 Ga0105241_10016498 3300009174 Bacteria 5417
120 Ga0105241_10046250 3300009174 Bacteria 3305
121 Ga0105241_10084530 3300009174 Bacteria 2492
122 Ga0105241_10166178 3300009174 Bacteria 1818
123 Ga0105241_10626144 3300009174 Bacteria 975
124 Ga0105241_10970229 3300009174 Bacteria 793
125 Ga0105242_10002048 3300009176 Bacteria 15894
126 Ga0105242_10005629 3300009176 Bacteria 9672
127 Ga0105242_10029113 3300009176 Bacteria 4402
128 Ga0105242_10038322 3300009176 Bacteria 3854
129 Ga0105242_10046366 3300009176 Bacteria 3526
130 Ga0105242_10058814 3300009176 Bacteria 3153
131 Ga0105242_10102301 3300009176 Bacteria 2429
132 Ga0105242_10437360 3300009176 Bacteria 1230
133 Ga0105242_10670985 3300009176 Unclassified 1010
134 Ga0105248_10009732 3300009177 Bacteria 10588
135 Ga0105248_10019162 3300009177 Bacteria 7570
136 Ga0105248_10024910 3300009177 Bacteria 6650
137 Ga0105248_10054688 3300009177 Bacteria 4477
138 Ga0105248_10060017 3300009177 Unclassified 4271
139 Ga0105248_10060491 3300009177 Bacteria 4253
140 Ga0105248_10070923 3300009177 Unclassified 3912
141 Ga0105248_10255937 3300009177 Unclassified 1971
142 Ga0105248_10274587 3300009177 Unclassified 1898
143 Ga0105248_10380235 3300009177 Bacteria 1590
144 Ga0105248_10476470 3300009177 Bacteria 1407
145 Ga0105248_10622626 3300009177 Bacteria 1218
146 Ga0105248_10715572 3300009177 Bacteria 1130
147 Ga0105248_11033965 3300009177 Bacteria 928
148 Ga0105237_10001306 3300009545 Bacteria 33144
149 Ga0105237_10002960 3300009545 Bacteria 20556
150 Ga0105237_10017544 3300009545 Bacteria 7419
151 Ga0105237_10102259 3300009545 Bacteria 2857
152 Ga0105237_10382167 3300009545 Unclassified 1413
153 Ga0105238_10000700 3300009551 Bacteria 35163
154 Ga0105238_10001942 3300009551 Bacteria 20789
155 Ga0105238_10022766 3300009551 Bacteria 6385
156 Ga0105238_10023701 3300009551 Bacteria 6255
157 Ga0105238_10027276 3300009551 Bacteria 5819
158 Ga0105238_10028896 3300009551 Bacteria 5648
159 Ga0105238_10034991 3300009551 Bacteria 5110
160 Ga0105238_10122578 3300009551 Bacteria 2579
161 Ga0105238_10963399 3300009551 Unclassified 873
162 Ga0105249_10036777 3300009553 Bacteria 4442
163 Ga0105249_10122890 3300009553 Bacteria 2469
164 Ga0105249_10815321 3300009553 Bacteria 998
165 Ga0105239_10000464 3300010375 Bacteria 59142
166 Ga0105239_10007822 3300010375 Bacteria 12226
167 Ga0105239_10011187 3300010375 Bacteria 10016
168 Ga0105239_10016811 3300010375 Bacteria 8086
169 Ga0105239_10026681 3300010375 Bacteria 6358
170 Ga0105239_10076684 3300010375 Bacteria 3677
171 Ga0105246_10012951 3300011119 Bacteria 5218
172 Ga0105246_10055294 3300011119 Bacteria 2738
173 Ga0105246_10312298 3300011119 Bacteria 1274
174 Ga0105246_10359194 3300011119 Bacteria 1196
175 Ga0157370_10001764 3300013104 Bacteria 26693
176 Ga0157370_10003081 3300013104 Bacteria 19749
177 Ga0157370_10008519 3300013104 Bacteria 11054
178 Ga0157370_10018852 3300013104 Bacteria 6939
179 Ga0157370_10059746 3300013104 Bacteria 3622
180 Ga0157369_10004154 3300013105 Bacteria 17157
181 Ga0157369_10021854 3300013105 Bacteria 7151
182 Ga0157369_10068910 3300013105 Bacteria 3801
183 Ga0157369_10080212 3300013105 Bacteria 3495
184 Ga0157369_10227699 3300013105 Bacteria 1950
185 Ga0157374_10087137 3300013296 Unclassified 2971
186 Ga0157374_10138473 3300013296 Bacteria 2361
187 Ga0157374_10141045 3300013296 Bacteria 2339
188 Ga0157374_10226334 3300013296 Bacteria 1837
189 Ga0157378_10007053 3300013297 Bacteria 9810
190 Ga0157378_10013481 3300013297 Bacteria 7149
191 Ga0157378_10022798 3300013297 Bacteria 5511
192 Ga0157378_10351716 3300013297 Unclassified 1439
193 Ga0157378_10727415 3300013297 Bacteria 1014
194 Ga0163162_10003996 3300013306 Bacteria 14153
195 Ga0163162_10026209 3300013306 Bacteria 5762
196 Ga0163162_10312102 3300013306 Unclassified 1705
197 Ga0163162_10553424 3300013306 Bacteria 1279
198 Ga0163162_10849518 3300013306 Bacteria 1028
199 Ga0157372_10017782 3300013307 Bacteria 7633
200 Ga0157372_10057699 3300013307 Bacteria 4340
201 Ga0157372_10093123 3300013307 Bacteria 3429
202 Ga0157372_10131999 3300013307 Bacteria 2874
203 Ga0157372_10161612 3300013307 Unclassified 2589
204 Ga0157372_10227339 3300013307 Bacteria 2163
205 Ga0157372_11095896 3300013307 Bacteria 921
206 Ga0157375_10003364 3300013308 Bacteria 13862
207 Ga0157375_10012258 3300013308 Bacteria 7600
208 Ga0157375_10099847 3300013308 Unclassified 2982
209 Ga0157375_10405389 3300013308 Bacteria 1530
210 Ga0157375_10757494 3300013308 Unclassified 1122
211 Ga0157375_10963227 3300013308 Bacteria 994
212 Ga0163163_10013852 3300014325 Bacteria 7396
213 Ga0163163_10015153 3300014325 Bacteria 7118
214 Ga0163163_10068074 3300014325 Bacteria 3542
215 Ga0163163_10083515 3300014325 Bacteria 3199
216 Ga0163163_10230278 3300014325 Bacteria 1902
217 Ga0163163_10235562 3300014325 Unclassified 1880
218 Ga0157379_10063390 3300014968 Bacteria 3305
219 Ga0157379_10072988 3300014968 Bacteria 3071
220 Ga0157379_10362767 3300014968 Bacteria 1328
221 Ga0157376_10006445 3300014969 Bacteria 8290
222 Ga0157376_10067400 3300014969 Bacteria 3027
223 Ga0157376_10082771 3300014969 Bacteria 2759
224 Ga0157376_10305253 3300014969 Bacteria 1508
225 Ga0213872_10012767 3300021361 Bacteria 3944
226 Ga0213871_10060159 3300021441 Bacteria 1057
227 Ga0207680_10012853 3300025903 Unclassified 4277
228 Ga0207699_10013143 3300025906 Bacteria 4228
229 Ga0207699_10122260 3300025906 Bacteria 1686
230 Ga0207645_10122713 3300025907 Unclassified 1687
231 Ga0207645_10277302 3300025907 Bacteria 1113
232 Ga0207705_10048854 3300025909 Bacteria 3045
233 Ga0207654_10020272 3300025911 Bacteria 3522
234 Ga0207654_10086884 3300025911 Unclassified 1896
235 Ga0207654_10102513 3300025911 Bacteria 1765
236 Ga0207654_10150346 3300025911 Bacteria 1494
237 Ga0207654_10208447 3300025911 Bacteria 1290
238 Ga0207707_10053182 3300025912 Bacteria 3525
239 Ga0207707_10072427 3300025912 Bacteria 3003
240 Ga0207707_10230874 3300025912 Bacteria 1610
241 Ga0207695_10003663 3300025913 Bacteria 21424
242 Ga0207695_10006095 3300025913 Bacteria 15731
243 Ga0207695_10024660 3300025913 Bacteria 6756
244 Ga0207695_10035076 3300025913 Bacteria 5445
245 Ga0207695_10168317 3300025913 Bacteria 2118
246 Ga0207695_10206829 3300025913 Bacteria 1875
247 Ga0207671_10043096 3300025914 Bacteria 3337
248 Ga0207663_10459941 3300025916 Unclassified 983
249 Ga0207660_10182005 3300025917 Bacteria 1632
250 Ga0207660_10571775 3300025917 Bacteria 920
251 Ga0207657_10000611 3300025919 Bacteria 37877
252 Ga0207657_10036386 3300025919 Bacteria 4406
253 Ga0207649_10184494 3300025920 Bacteria 1463
254 Ga0207652_10212551 3300025921 Bacteria 1742
255 Ga0207652_10379697 3300025921 Bacteria 1275
256 Ga0207694_10001557 3300025924 Bacteria 19467
257 Ga0207694_10006938 3300025924 Bacteria 8599
258 Ga0207694_10007037 3300025924 Bacteria 8540
259 Ga0207694_10010818 3300025924 Bacteria 6888
260 Ga0207694_10019177 3300025924 Bacteria 5170
261 Ga0207694_10021476 3300025924 Bacteria 4891
262 Ga0207694_10049077 3300025924 Bacteria 3267
263 Ga0207694_10655461 3300025924 Unclassified 884
264 Ga0207659_10508101 3300025926 Bacteria 1021
265 Ga0207687_10000237 3300025927 Bacteria 37671
266 Ga0207687_10009827 3300025927 Bacteria 6263
267 Ga0207687_10009830 3300025927 Bacteria 6261
268 Ga0207687_10012855 3300025927 Bacteria 5472
269 Ga0207687_10014510 3300025927 Bacteria 5157
270 Ga0207687_10131667 3300025927 Bacteria 1886
271 Ga0207687_10352880 3300025927 Bacteria 1199
272 Ga0207700_10209892 3300025928 Unclassified 1646
273 Ga0207700_10338482 3300025928 Bacteria 1308
274 Ga0207644_10033965 3300025931 Bacteria 3569
275 Ga0207644_10142369 3300025931 Bacteria 1848
276 Ga0207690_10098910 3300025932 Bacteria 2079
277 Ga0207686_10001158 3300025934 Bacteria 15209
278 Ga0207686_10007180 3300025934 Bacteria 5997
279 Ga0207686_10048372 3300025934 Bacteria 2634
280 Ga0207686_10133115 3300025934 Bacteria 1708
281 Ga0207686_10178138 3300025934 Unclassified 1505
282 Ga0207704_10126846 3300025938 Unclassified 1759
283 Ga0207711_10002756 3300025941 Bacteria 15477
284 Ga0207711_10032602 3300025941 Bacteria 4404
285 Ga0207711_10070425 3300025941 Unclassified 3033
286 Ga0207711_10155098 3300025941 Bacteria 2069
287 Ga0207711_10177796 3300025941 Unclassified 1934
288 Ga0207711_10182089 3300025941 Bacteria 1911
289 Ga0207711_10284467 3300025941 Bacteria 1523
290 Ga0207711_10297208 3300025941 Unclassified 1489
291 Ga0207711_10577909 3300025941 Unclassified 1048
292 Ga0207711_11024567 3300025941 Bacteria 765
293 Ga0207689_10053226 3300025942 Bacteria 3335
294 Ga0207689_10347735 3300025942 Bacteria 1232
295 Ga0207661_10018474 3300025944 Bacteria 5179
296 Ga0207661_10042929 3300025944 Bacteria 3567
297 Ga0207661_10071440 3300025944 Unclassified 2836
298 Ga0207661_10118317 3300025944 Bacteria 2252
299 Ga0207661_10625323 3300025944 Bacteria 989
300 Ga0207679_10539257 3300025945 Bacteria 1045
301 Ga0207667_10012061 3300025949 Bacteria 9995
302 Ga0207667_10037772 3300025949 Bacteria 5161
303 Ga0207667_10055903 3300025949 Bacteria 4148
304 Ga0207667_10074244 3300025949 Bacteria 3533
305 Ga0207667_10084146 3300025949 Unclassified 3293
306 Ga0207667_10154766 3300025949 Bacteria 2359
307 Ga0207667_10480454 3300025949 Bacteria 1261
308 Ga0207712_10009976 3300025961 Bacteria 6019
309 Ga0207640_10513840 3300025981 Bacteria 1000
310 Ga0207658_10644593 3300025986 Bacteria 954
311 Ga0207677_10006575 3300026023 Bacteria 6377
312 Ga0207677_10006811 3300026023 Bacteria 6276
313 Ga0207703_10010926 3300026035 Bacteria 7076
314 Ga0207703_10018666 3300026035 Bacteria 5417
315 Ga0207703_10028877 3300026035 Bacteria 4377
316 Ga0207639_10239819 3300026041 Unclassified 1576
317 Ga0207639_10587078 3300026041 Bacteria 1026
318 Ga0207702_10029337 3300026078 Bacteria 4577
319 Ga0207702_10131675 3300026078 Bacteria 2251
320 Ga0207702_10301308 3300026078 Bacteria 1521
321 Ga0207702_10335461 3300026078 Bacteria 1443
322 Ga0207641_10035205 3300026088 Bacteria 4170
323 Ga0207641_10164376 3300026088 Unclassified 2020
324 Ga0207641_10167123 3300026088 Bacteria 2005
325 Ga0207641_10750039 3300026088 Unclassified 964
326 Ga0207648_10024673 3300026089 Bacteria 5363
327 Ga0207648_10039640 3300026089 Bacteria 4142
328 Ga0207648_10493062 3300026089 Bacteria 1120
329 Ga0207676_10030456 3300026095 Bacteria 4051
330 Ga0207676_10075541 3300026095 Bacteria 2719
331 Ga0207676_10478413 3300026095 Bacteria 1179
332 Ga0207674_10002275 3300026116 Bacteria 24344
333 Ga0207674_10002443 3300026116 Bacteria 23468
334 Ga0207674_10004583 3300026116 Bacteria 16589
335 Ga0207674_10120153 3300026116 Bacteria 2596
336 Ga0207675_100197606 3300026118 Bacteria 1931
337 Ga0207675_100633463 3300026118 Bacteria 1074
338 Ga0207698_10108512 3300026142 Bacteria 2320
339 Ga0207698_10196408 3300026142 Unclassified 1803
340 Ga0207698_10934773 3300026142 Bacteria 876
341 Ga0268266_10007959 3300028379 Bacteria 9478
342 Ga0268266_10277821 3300028379 Bacteria 1556
343 Ga0268264_10002148 3300028381 Bacteria 17588
344 Ga0268264_10083237 3300028381 Bacteria 2740
345 Ga0265323_10017536 3300028653 Bacteria 2779
346 Ga0265322_10000152 3300028654 Unclassified 31582
347 Ga0265332_10017928 3300031238 Unclassified 3120
348 Ga0265327_10090158 3300031251 Bacteria 1497
349 Ga0265316_10012903 3300031344 Archaea 7455
350 Ga0265316_10068114 3300031344 Bacteria 2751
351 Ga0265314_10003192 3300031711 Bacteria 16054
352 Ga0265314_10126872 3300031711 Unclassified 1597
353 Ga0265342_10019798 3300031712 Archaea 4330
354 Ga0265342_10065803 3300031712 Archaea 2123
355 Ga0373923_0209541 3300035111 Bacteria 903
356 Ga0373935_0180389 3300035692 Bacteria 1450
357 Ga0373935_0338272 3300035692 Bacteria 1071
358 Ga0373927_0066458 3300035695 Bacteria 2332
359 Ga0373927_0066731 3300035695 Bacteria 2328
360 Ga0373933_0153339 3300035724 Bacteria 1460
361 Ga0373947_0015922 3300035725 Bacteria 4320
362 Ga0373937_0038003 3300036401 Bacteria 4388
363 Ga0373937_0612287 3300036401 Bacteria 1034
364 Ga0373925_0033558 3300037068 Unclassified 3782
365 Ga0436360_1205468 3300039438 Bacteria 1237
366 Ga0436361_0362536 3300039447 Bacteria 55339
367 Ga0436363_1294397 3300039450 Unclassified 1974
368 Ga0451577_0057106 3300042876 Archaea 3480
369 Ga0451577_0303446 3300042876 Bacteria 1447
370 Ga0451577_0330957 3300042876 Unclassified 1381
371 Ga0451577_0341857 3300042876 Unclassified 1357
372 Ga0453684_0000050 3300044712 Archaea 558429
373 Ga0453684_0000129 3300044712 Archaea 332975
374 Ga0453684_0002000 3300044712 Archaea 52200
375 Ga0453684_0002394 3300044712 Archaea 45723
376 Ga0453684_0007146 3300044712 Archaea 20778
377 Ga0453684_0063961 3300044712 Archaea 4702
378 Ga0453684_0422165 3300044712 Bacteria 1489
379 Ga0453684_1057709 3300044712 Archaea 860
380 Ga0451576_0005251 3300045051 Bacteria 16353
381 Ga0451576_0096355 3300045051 Bacteria 3078
382 Ga0451576_0249656 3300045051 Archaea 1854
383 Ga0451576_0579013 3300045051 Bacteria 1180
384 Ga0451576_0648778 3300045051 Bacteria 1109
385 Ga0495592_0009979 3300046454 Bacteria 7149
386 Ga0495580_0044797 3300046472 Bacteria 3145
387 Ga0495580_0047773 3300046472 Bacteria 3033
388 Ga0495580_0204188 3300046472 Unclassified 1361
389 Ga0495582_0003206 3300046473 Bacteria 9186
390 Ga0495594_0047397 3300046499 Bacteria 2360
391 Ga0495618_0340250 3300046514 Unclassified 926
392 Ga0495652_0040298 3300046529 Bacteria 4037
393 Ga0495652_0165179 3300046529 Bacteria 1714
394 Ga0495665_0019657 3300046531 Bacteria 3633
395 Ga0495665_0048614 3300046531 Unclassified 2249
396 Ga0495665_0211519 3300046531 Bacteria 1004
397 Ga0495586_0264060 3300046535 Bacteria 983
398 Ga0495587_0002297 3300046536 Bacteria 12806
399 Ga0495599_0020583 3300046678 Bacteria 4109
400 Ga0495599_0234543 3300046678 Bacteria 1120
401 Ga0495623_0095585 3300046679 Bacteria 1817
402 Ga0495658_0357351 3300046683 Bacteria 929
403 Ga0495674_0659643 3300047319 Unclassified 824
404 Ga0495680_0189935 3300047322 Bacteria 1478
405 Ga0495684_0085269 3300047471 Bacteria 2395
406 Ga0495684_0360990 3300047471 Unclassified 1029
407 Ga0495602_0069123 3300048088 Bacteria 3029
408 Ga0495602_0407000 3300048088 Bacteria 969
409 Ga0496104_0053924 3300048907 Unclassified 3800
410 Ga0496110_0384629 3300048913 Unclassified 1279
411 Ga0501071_0288808 3300049587 Bacteria 1242
412 nmdc:mga0n895_548243_c1 3300050512 Bacteria 1162
413 nmdc:mga0rr50_280002_c1 3300050513 Bacteria 1391
414 Ga0373935_0407336
415 Ga0070658_10006158
416 Ga0070683_100008853
417 Ga0070683_100012196
418 Ga0070683_100080324
419 Ga0070683_100147896
420 Ga0068869_100058010
421 Ga0070666_10003111
422 Ga0070666_10337536
423 Ga0070680_100199977
424 Ga0068868_100007197
425 Ga0068868_100034501
426 Ga0068868_100036803
427 Ga0068868_100403880
428 Ga0070660_100003418
429 Ga0070660_100262045
430 Ga0070689_100285995
431 Ga0070661_100195604
432 Ga0070661_100521759
433 Ga0070675_100573993
434 Ga0070671_100351611
435 Ga0070688_100147804
436 Ga0070667_100421654
437 Ga0070709_10007059
438 Ga0070709_10060270
439 Ga0070713_100024258
440 Ga0070713_100265222
441 Ga0070711_100189207
442 Ga0070711_100370019
443 Ga0070711_100525124
444 Ga0070662_100069691
445 Ga0070681_10034357
446 Ga0070681_10089490
447 Ga0070681_10238262
448 Ga0070681_10302563
449 Ga0068867_100015919
450 Ga0070698_100374125
451 Ga0070679_100196104
452 Ga0070679_100217246
453 Ga0070679_100410551
454 Ga0070679_100422848
455 Ga0070684_100039295
456 Ga0070684_100050793
457 Ga0070684_100202197
458 Ga0068853_100156868
459 Ga0068853_100825632
460 Ga0070696_100225352
461 Ga0070665_100018123
462 Ga0070665_100178774
463 Ga0068855_100000624
464 Ga0068855_100004531
465 Ga0068855_100020194
466 Ga0068855_100098248
467 Ga0068855_100113577
468 Ga0070664_100068065
469 Ga0070664_100378181
470 Ga0068857_100014119
471 Ga0068857_100016602
472 Ga0068857_100023922
473 Ga0068857_100303734
474 Ga0068854_100529893
475 Ga0068856_100014817
476 Ga0068856_100028892
477 Ga0068852_100067968
478 Ga0068859_100015143
479 Ga0068864_100026883
480 Ga0068866_10071485
481 Ga0068866_10090714
482 Ga0068863_100177883
483 Ga0068863_100402392
484 Ga0068858_100007597
485 Ga0068858_100045679
486 Ga0068858_100061866
487 Ga0068858_100416023
488 Ga0068860_100038540
489 Ga0068860_100095222
490 Ga0068860_100423443
491 Ga0068860_100702586
492 Ga0097621_100019487
493 Ga0097621_100042861
494 Ga0097621_100046230
495 Ga0097621_100050172
496 Ga0097621_100060125
497 Ga0097621_100362261
498 Ga0097621_100509077
499 Ga0068871_100001320
500 Ga0068871_100008319
501 Ga0068871_100016622
502 Ga0068871_100022811
503 Ga0068871_100179545
504 Ga0068871_100831232
505 Ga0068865_100092122
506 Ga0097620_100015143
507 Ga0105240_10002616
508 Ga0105240_10020696
509 Ga0105240_10029121
510 Ga0105240_10034857
511 Ga0105240_10057555
512 Ga0105240_10083570
513 Ga0105240_10188051
514 Ga0105240_10245931
515 Ga0105240_10641033
516 Ga0105245_10002083
517 Ga0105245_10002115
518 Ga0105245_10006523
519 Ga0105245_10010567
520 Ga0105245_10014618
521 Ga0105245_10018502
522 Ga0105245_10047817
523 Ga0105245_10143655
524 Ga0105245_10240029
525 Ga0105245_10295997
526 Ga0105245_10340217
527 Ga0105245_10366809
528 Ga0105245_10803219
529 Ga0105243_10032240
530 Ga0105243_10501303
531 Ga0105241_10013542
532 Ga0105241_10016498
533 Ga0105241_10046250
534 Ga0105241_10084530
535 Ga0105241_10166178
536 Ga0105241_10626144
537 Ga0105241_10970229
538 Ga0105242_10002048
539 Ga0105242_10005629
540 Ga0105242_10029113
541 Ga0105242_10038322
542 Ga0105242_10046366
543 Ga0105242_10058814
544 Ga0105242_10102301
545 Ga0105242_10437360
546 Ga0105242_10670985
547 Ga0105248_10009732
548 Ga0105248_10019162
549 Ga0105248_10024910
550 Ga0105248_10054688
551 Ga0105248_10060017
552 Ga0105248_10060491
553 Ga0105248_10070923
554 Ga0105248_10255937
555 Ga0105248_10274587
556 Ga0105248_10380235
557 Ga0105248_10476470
558 Ga0105248_10622626
559 Ga0105248_10715572
560 Ga0105248_11033965
561 Ga0105237_10001306
562 Ga0105237_10002960
563 Ga0105237_10017544
564 Ga0105237_10102259
565 Ga0105237_10382167
566 Ga0105238_10000700
567 Ga0105238_10001942
568 Ga0105238_10022766
569 Ga0105238_10023701
570 Ga0105238_10027276
571 Ga0105238_10028896
572 Ga0105238_10034991
573 Ga0105238_10122578
574 Ga0105238_10963399
575 Ga0105249_10036777
576 Ga0105249_10122890
577 Ga0105249_10815321
578 Ga0105239_10000464
579 Ga0105239_10007822
580 Ga0105239_10011187
581 Ga0105239_10016811
582 Ga0105239_10026681
583 Ga0105239_10076684
584 Ga0105246_10012951
585 Ga0105246_10055294
586 Ga0105246_10312298
587 Ga0105246_10359194
588 Ga0157370_10001764
589 Ga0157370_10003081
590 Ga0157370_10008519
591 Ga0157370_10018852
592 Ga0157370_10059746
593 Ga0157369_10004154
594 Ga0157369_10021854
595 Ga0157369_10068910
596 Ga0157369_10080212
597 Ga0157369_10227699
598 Ga0157374_10087137
599 Ga0157374_10138473
600 Ga0157374_10141045
601 Ga0157374_10226334
602 Ga0157378_10007053
603 Ga0157378_10013481
604 Ga0157378_10022798
605 Ga0157378_10351716
606 Ga0157378_10727415
607 Ga0163162_10003996
608 Ga0163162_10026209
609 Ga0163162_10312102
610 Ga0163162_10553424
611 Ga0163162_10849518
612 Ga0157372_10017782
613 Ga0157372_10057699
614 Ga0157372_10093123
615 Ga0157372_10131999
616 Ga0157372_10161612
617 Ga0157372_10227339
618 Ga0157372_11095896
619 Ga0157375_10003364
620 Ga0157375_10012258
621 Ga0157375_10099847
622 Ga0157375_10405389
623 Ga0157375_10757494
624 Ga0157375_10963227
625 Ga0163163_10013852
626 Ga0163163_10015153
627 Ga0163163_10068074
628 Ga0163163_10083515
629 Ga0163163_10230278
630 Ga0163163_10235562
631 Ga0157379_10063390
632 Ga0157379_10072988
633 Ga0157379_10362767
634 Ga0157376_10006445
635 Ga0157376_10067400
636 Ga0157376_10082771
637 Ga0157376_10305253
638 Ga0213872_10012767
639 Ga0213871_10060159
640 Ga0207680_10012853
641 Ga0207699_10013143
642 Ga0207699_10122260
643 Ga0207645_10122713
644 Ga0207645_10277302
645 Ga0207705_10048854
646 Ga0207654_10020272
647 Ga0207654_10086884
648 Ga0207654_10102513
649 Ga0207654_10150346
650 Ga0207654_10208447
651 Ga0207707_10053182
652 Ga0207707_10072427
653 Ga0207707_10230874
654 Ga0207695_10003663
655 Ga0207695_10006095
656 Ga0207695_10024660
657 Ga0207695_10035076
658 Ga0207695_10168317
659 Ga0207695_10206829
660 Ga0207671_10043096
661 Ga0207663_10459941
662 Ga0207660_10182005
663 Ga0207660_10571775
664 Ga0207657_10000611
665 Ga0207657_10036386
666 Ga0207649_10184494
667 Ga0207652_10212551
668 Ga0207652_10379697
669 Ga0207694_10001557
670 Ga0207694_10006938
671 Ga0207694_10007037
672 Ga0207694_10010818
673 Ga0207694_10019177
674 Ga0207694_10021476
675 Ga0207694_10049077
676 Ga0207694_10655461
677 Ga0207659_10508101
678 Ga0207687_10000237
679 Ga0207687_10009827
680 Ga0207687_10009830
681 Ga0207687_10012855
682 Ga0207687_10014510
683 Ga0207687_10131667
684 Ga0207687_10352880
685 Ga0207700_10209892
686 Ga0207700_10338482
687 Ga0207644_10033965
688 Ga0207644_10142369
689 Ga0207690_10098910
690 Ga0207686_10001158
691 Ga0207686_10007180
692 Ga0207686_10048372
693 Ga0207686_10133115
694 Ga0207686_10178138
695 Ga0207704_10126846
696 Ga0207711_10002756
697 Ga0207711_10032602
698 Ga0207711_10070425
699 Ga0207711_10155098
700 Ga0207711_10177796
701 Ga0207711_10182089
702 Ga0207711_10284467
703 Ga0207711_10297208
704 Ga0207711_10577909
705 Ga0207711_11024567
706 Ga0207689_10053226
707 Ga0207689_10347735
708 Ga0207661_10018474
709 Ga0207661_10042929
710 Ga0207661_10071440
711 Ga0207661_10118317
712 Ga0207661_10625323
713 Ga0207679_10539257
714 Ga0207667_10012061
715 Ga0207667_10037772
716 Ga0207667_10055903
717 Ga0207667_10074244
718 Ga0207667_10084146
719 Ga0207667_10154766
720 Ga0207667_10480454
721 Ga0207712_10009976
722 Ga0207640_10513840
723 Ga0207658_10644593
724 Ga0207677_10006575
725 Ga0207677_10006811
726 Ga0207703_10010926
727 Ga0207703_10018666
728 Ga0207703_10028877
729 Ga0207639_10239819
730 Ga0207639_10587078
731 Ga0207702_10029337
732 Ga0207702_10131675
733 Ga0207702_10301308
734 Ga0207702_10335461
735 Ga0207641_10035205
736 Ga0207641_10164376
737 Ga0207641_10167123
738 Ga0207641_10750039
739 Ga0207648_10024673
740 Ga0207648_10039640
741 Ga0207648_10493062
742 Ga0207676_10030456
743 Ga0207676_10075541
744 Ga0207676_10478413
745 Ga0207674_10002275
746 Ga0207674_10002443
747 Ga0207674_10004583
748 Ga0207674_10120153
749 Ga0207675_100197606
750 Ga0207675_100633463
751 Ga0207698_10108512
752 Ga0207698_10196408
753 Ga0207698_10934773
754 Ga0268266_10007959
755 Ga0268266_10277821
756 Ga0268264_10002148
757 Ga0268264_10083237
758 Ga0265323_10017536
759 Ga0265322_10000152
760 Ga0265332_10017928
761 Ga0265327_10090158
762 Ga0265316_10012903
763 Ga0265316_10068114
764 Ga0265314_10003192
765 Ga0265314_10126872
766 Ga0265342_10019798
767 Ga0265342_10065803
768 Ga0373923_0209541
769 Ga0373935_0180389
770 Ga0373935_0338272
771 Ga0373927_0066458
772 Ga0373927_0066731
773 Ga0373933_0153339
774 Ga0373947_0015922
775 Ga0373937_0038003
776 Ga0373937_0612287
777 Ga0373925_0033558
778 Ga0436360_1205468
779 Ga0436361_0362536
780 Ga0436363_1294397
781 Ga0451577_0057106
782 Ga0451577_0303446
783 Ga0451577_0330957
784 Ga0451577_0341857
785 Ga0453684_0000050
786 Ga0453684_0000129
787 Ga0453684_0002000
788 Ga0453684_0002394
789 Ga0453684_0007146
790 Ga0453684_0063961
791 Ga0453684_0422165
792 Ga0453684_1057709
793 Ga0451576_0005251
794 Ga0451576_0096355
795 Ga0451576_0249656
796 Ga0451576_0579013
797 Ga0451576_0648778
798 Ga0495592_0009979
799 Ga0495580_0044797
800 Ga0495580_0047773
801 Ga0495580_0204188
802 Ga0495582_0003206
803 Ga0495594_0047397
804 Ga0495618_0340250
805 Ga0495652_0040298
806 Ga0495652_0165179
807 Ga0495665_0019657
808 Ga0495665_0048614
809 Ga0495665_0211519
810 Ga0495586_0264060
811 Ga0495587_0002297
812 Ga0495599_0020583
813 Ga0495599_0234543
814 Ga0495623_0095585
815 Ga0495658_0357351
816 Ga0495674_0659643
817 Ga0495680_0189935
818 Ga0495684_0085269
819 Ga0495684_0360990
820 Ga0495602_0069123
821 Ga0495602_0407000
822 Ga0496104_0053924
823 Ga0496110_0384629
824 Ga0501071_0288808
825 nmdc:mga0n895_548243_c1
826 nmdc:mga0rr50_280002_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

51

177

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e26-assembly1.cif.gz_D structure of pffnt in apo state 0.3491 47 212
3kcv-assembly2.cif.gz_J structure of formate channel 0.3158 34 210
7un3-assembly1.cif.gz_A complex of ube2o with nap1l1 and ubiquitylated ul2 0.3013 73 174
6f0k-assembly1.cif.gz_C alternative complex iii 0.2941 35 195
3cax-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein pf0695 0.2937 35 198
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7963 53 174 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7595 53 174 1.10.1760.20
af_Q38956_275_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4283 31 199 1.20.1250.20
af_Q3V050_274_435_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4024 4 200 1.20.1250.20
af_Q0D624_270_429_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3878 3 199 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3B9U612-F1-model_v4 VTT domain-containing protein 0.9633 19 179 GO:0005886
AF-A0A3S0XYG1-F1-model_v4 DedA family protein 0.9547 18 211 GO:0005886
AF-A0A7J4J3N4-F1-model_v4 DedA family protein 0.9441 21 213 GO:0005886
AF-A0A2V8Z8A4-F1-model_v4 VTT domain-containing protein 0.9438 9 216 GO:0005886
AF-A0A238TCW4-F1-model_v4 Inner membrane protein YqjA 0.9434 19 212 GO:0005886

Map