F438091

General Info

Members Datasets Scaffolds Average Seq Length
413 230 826 162

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100223154|Ga0207675_1002231543
Length 194
Sequence MTEAFEKLVSLLDYPMFVVTTRAGDESAGCLVGFASQVSIRPPRFLVGLSKRNHIYRVAKGASHVAVHLIERRHGELARLFGSVTGDRTDKFARCAWRSGPHGLPILDDAAGWFAGMVLSRYDVGDHVGFLLEPVAGGAPAQFHQLSQLIKTIMMMGILSMIFLKYYVFYFQLLYNRSVFKFNKLFCCIYLILI

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
229 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
230 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.56
Nodule 0
Rhizoplane 8.96
Rhizosphere 75.54
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100223154 3300026118 Bacteria 1816
2 JGI24737J22298_10018871 3300001990 Bacteria 2208
3 JGI24744J21845_10004848 3300002077 Bacteria 2781
4 JGI24751J29686_10030257 3300002459 Bacteria 1123
5 Ga0070676_10034255 3300005328 Bacteria 2916
6 Ga0070690_100141819 3300005330 Bacteria 1632
7 Ga0070670_100553440 3300005331 Bacteria 1026
8 Ga0070680_100054533 3300005336 Bacteria 3265
9 Ga0070682_100165966 3300005337 Bacteria 1530
10 Ga0068868_100085154 3300005338 Bacteria 2539
11 Ga0068868_100194880 3300005338 Bacteria 1686
12 Ga0068868_101031113 3300005338 Bacteria 754
13 Ga0070660_100805873 3300005339 Bacteria 790
14 Ga0070689_100353831 3300005340 Bacteria 1232
15 Ga0070689_100490216 3300005340 Bacteria 1051
16 Ga0070691_10007153 3300005341 Bacteria 5114
17 Ga0070691_10046118 3300005341 Bacteria 2069
18 Ga0070687_100058984 3300005343 Bacteria 2019
19 Ga0070692_10224383 3300005345 Bacteria 1112
20 Ga0070668_100042708 3300005347 Bacteria 3475
21 Ga0070668_100043174 3300005347 Bacteria 3457
22 Ga0070668_100750083 3300005347 Bacteria 864
23 Ga0070669_100245630 3300005353 Bacteria 1423
24 Ga0070671_100312229 3300005355 Bacteria 1339
25 Ga0070671_100334124 3300005355 Bacteria 1292
26 Ga0070674_100557468 3300005356 Bacteria 962
27 Ga0070673_100033466 3300005364 Bacteria 3882
28 Ga0070667_100058335 3300005367 Bacteria 3263
29 Ga0070667_100198345 3300005367 Bacteria 1780
30 Ga0070667_100288347 3300005367 Bacteria 1475
31 Ga0070667_100386679 3300005367 Bacteria 1271
32 Ga0070709_10236764 3300005434 Bacteria 1309
33 Ga0070714_100443725 3300005435 Bacteria 1232
34 Ga0070714_100654141 3300005435 Bacteria 1012
35 Ga0070710_10046781 3300005437 Bacteria 2411
36 Ga0070710_10105229 3300005437 Bacteria 1687
37 Ga0070701_10065416 3300005438 Bacteria 1929
38 Ga0070711_100012523 3300005439 Bacteria 5302
39 Ga0070711_100502731 3300005439 Bacteria 1000
40 Ga0070705_100199466 3300005440 Bacteria 1370
41 Ga0070705_100788781 3300005440 Bacteria 755
42 Ga0070700_100009057 3300005441 Bacteria 5454
43 Ga0070694_100079052 3300005444 Bacteria 2283
44 Ga0070678_100019023 3300005456 Bacteria 4465
45 Ga0070662_100010742 3300005457 Bacteria 6028
46 Ga0070662_100013685 3300005457 Bacteria 5402
47 Ga0068867_100008040 3300005459 Bacteria 7453
48 Ga0070685_10099622 3300005466 Bacteria 1773
49 Ga0070679_100610092 3300005530 Bacteria 1034
50 Ga0070679_100846680 3300005530 Bacteria 858
51 Ga0068853_100055999 3300005539 Bacteria 3399
52 Ga0070672_100138032 3300005543 Bacteria 2009
53 Ga0070686_100066988 3300005544 Bacteria 2338
54 Ga0070695_100081387 3300005545 Bacteria 2143
55 Ga0070696_100025549 3300005546 Bacteria 4016
56 Ga0070696_100035326 3300005546 Bacteria 3441
57 Ga0070696_100470383 3300005546 Bacteria 995
58 Ga0070693_100058742 3300005547 Bacteria 2227
59 Ga0070693_100345803 3300005547 Bacteria 1016
60 Ga0070665_100177793 3300005548 Bacteria 2129
61 Ga0070704_100092083 3300005549 Bacteria 2262
62 Ga0068855_100461576 3300005563 Bacteria 1385
63 Ga0070702_100025633 3300005615 Bacteria 3161
64 Ga0070702_100527907 3300005615 Bacteria 872
65 Ga0068852_100366090 3300005616 Bacteria 1411
66 Ga0068859_100522887 3300005617 Bacteria 1281
67 Ga0068859_101295617 3300005617 Bacteria 803
68 Ga0068864_101434705 3300005618 Bacteria 692
69 Ga0068861_100176354 3300005719 Bacteria 1775
70 Ga0068861_100706823 3300005719 Bacteria 937
71 Ga0068870_10903305 3300005840 Bacteria 624
72 Ga0068863_100062875 3300005841 Bacteria 3510
73 Ga0068863_100108155 3300005841 Bacteria 2646
74 Ga0068858_100361873 3300005842 Bacteria 1390
75 Ga0068858_100677552 3300005842 Bacteria 1003
76 Ga0068860_100307373 3300005843 Bacteria 1554
77 Ga0068860_100562688 3300005843 Bacteria 1143
78 Ga0068862_100040379 3300005844 Bacteria 3966
79 Ga0068862_100052755 3300005844 Bacteria 3480
80 Ga0068862_100406414 3300005844 Bacteria 1275
81 Ga0068862_101814187 3300005844 Bacteria 619
82 Ga0070717_10968565 3300006028 Bacteria 775
83 Ga0075365_10007241 3300006038 Bacteria 6199
84 Ga0075365_10028281 3300006038 Bacteria 3575
85 Ga0075368_10213947 3300006042 Bacteria 818
86 Ga0075363_100000026 3300006048 Bacteria 30639
87 Ga0075363_100002955 3300006048 Bacteria 7093
88 Ga0075363_100033183 3300006048 Bacteria 2686
89 Ga0075363_100041433 3300006048 Bacteria 2429
90 Ga0075363_100123911 3300006048 Bacteria 1445
91 Ga0075363_100443759 3300006048 Bacteria 766
92 Ga0075364_10006840 3300006051 Bacteria 6730
93 Ga0075364_10006903 3300006051 Bacteria 6703
94 Ga0075364_10054403 3300006051 Bacteria 2617
95 Ga0075364_10082609 3300006051 Bacteria 2125
96 Ga0075364_10272392 3300006051 Bacteria 1151
97 Ga0075364_10695017 3300006051 Bacteria 694
98 Ga0070715_10019725 3300006163 Bacteria 2591
99 Ga0070716_100026616 3300006173 Bacteria 3099
100 Ga0070716_100125309 3300006173 Bacteria 1615
101 Ga0070712_100013125 3300006175 Bacteria 5284
102 Ga0070712_100086967 3300006175 Bacteria 2279
103 Ga0070712_100454399 3300006175 Bacteria 1067
104 Ga0075362_10593041 3300006177 Bacteria 572
105 Ga0075367_10028586 3300006178 Bacteria 3182
106 Ga0075367_10033025 3300006178 Bacteria 2980
107 Ga0075367_10325971 3300006178 Bacteria 968
108 Ga0075367_10432292 3300006178 Bacteria 834
109 Ga0075367_10459394 3300006178 Bacteria 807
110 Ga0075369_10010543 3300006186 Bacteria 3616
111 Ga0075369_10022709 3300006186 Bacteria 2590
112 Ga0075369_10126826 3300006186 Bacteria 1158
113 Ga0075369_10152762 3300006186 Bacteria 1056
114 Ga0075369_10303170 3300006186 Bacteria 746
115 Ga0097621_100158867 3300006237 Bacteria 1942
116 Ga0075370_10041612 3300006353 Bacteria 2594
117 Ga0075370_10075775 3300006353 Bacteria 1929
118 Ga0068871_100073590 3300006358 Bacteria 2817
119 Ga0075428_100085918 3300006844 Bacteria 3431
120 Ga0075430_100007642 3300006846 Bacteria 9132
121 Ga0075430_100081268 3300006846 Bacteria 2715
122 Ga0075430_100372952 3300006846 Bacteria 1178
123 Ga0075431_100094951 3300006847 Bacteria 3078
124 Ga0075434_100677177 3300006871 Bacteria 1049
125 Ga0075429_100674860 3300006880 Bacteria 905
126 Ga0068865_100248701 3300006881 Bacteria 1402
127 Ga0097620_100522877 3300006931 Bacteria 1281
128 Ga0097620_101295716 3300006931 Bacteria 803
129 Ga0105250_10026290 3300009092 Bacteria 2344
130 Ga0105240_10212233 3300009093 Bacteria 2261
131 Ga0105245_10136830 3300009098 Bacteria 2303
132 Ga0105245_10140193 3300009098 Bacteria 2276
133 Ga0105245_10142640 3300009098 Bacteria 2258
134 Ga0105247_10010694 3300009101 Bacteria 5540
135 Ga0105247_10014578 3300009101 Bacteria 4715
136 Ga0114129_10080950 3300009147 Bacteria 4515
137 Ga0105243_10035359 3300009148 Bacteria 3872
138 Ga0105243_10118428 3300009148 Bacteria 2228
139 Ga0105241_10038093 3300009174 Bacteria 3626
140 Ga0105242_10029051 3300009176 Bacteria 4407
141 Ga0105242_10416287 3300009176 Bacteria 1258
142 Ga0105248_10026589 3300009177 Bacteria 6436
143 Ga0105248_11219674 3300009177 Bacteria 851
144 Ga0105237_10111589 3300009545 Bacteria 2726
145 Ga0105249_10006495 3300009553 Bacteria 10170
146 Ga0105249_10042961 3300009553 Bacteria 4111
147 Ga0105239_11108030 3300010375 Bacteria 911
148 Ga0105246_10323451 3300011119 Bacteria 1254
149 Ga0105246_11460031 3300011119 Bacteria 641
150 Ga0157374_10006683 3300013296 Bacteria 9799
151 Ga0157374_10555508 3300013296 Bacteria 1156
152 Ga0157378_10013379 3300013297 Bacteria 7171
153 Ga0157378_10363301 3300013297 Bacteria 1417
154 Ga0163162_10231755 3300013306 Bacteria 1977
155 Ga0163162_12391074 3300013306 Bacteria 607
156 Ga0157372_10089858 3300013307 Bacteria 3490
157 Ga0157375_10070570 3300013308 Bacteria 3504
158 Ga0157375_11044163 3300013308 Bacteria 955
159 Ga0163163_10029072 3300014325 Bacteria 5314
160 Ga0163163_10662174 3300014325 Bacteria 1107
161 Ga0157380_10038897 3300014326 Bacteria 3696
162 Ga0157380_10298687 3300014326 Bacteria 1482
163 Ga0157377_10048276 3300014745 Bacteria 2388
164 Ga0157377_10101125 3300014745 Bacteria 1718
165 Ga0157379_10069881 3300014968 Bacteria 3141
166 Ga0157379_10120331 3300014968 Bacteria 2362
167 Ga0157376_10071854 3300014969 Bacteria 2942
168 Ga0157376_10231281 3300014969 Bacteria 1717
169 Ga0163161_10138886 3300017792 Bacteria 1839
170 Ga0163161_10156843 3300017792 Bacteria 1733
171 Ga0213874_10077550 3300021377 Bacteria 1071
172 Ga0207653_10033109 3300025885 Bacteria 1675
173 Ga0207692_10012497 3300025898 Bacteria 3649
174 Ga0207692_10115671 3300025898 Bacteria 1494
175 Ga0207642_10001320 3300025899 Bacteria 7662
176 Ga0207642_10026004 3300025899 Bacteria 2377
177 Ga0207710_10023584 3300025900 Bacteria 2645
178 Ga0207710_10086163 3300025900 Bacteria 1464
179 Ga0207688_10001401 3300025901 Bacteria 12564
180 Ga0207688_10003181 3300025901 Bacteria 8954
181 Ga0207680_10317062 3300025903 Bacteria 1089
182 Ga0207645_10060973 3300025907 Bacteria 2409
183 Ga0207645_10093343 3300025907 Bacteria 1936
184 Ga0207654_10067036 3300025911 Bacteria 2119
185 Ga0207671_10058481 3300025914 Bacteria 2858
186 Ga0207671_10254878 3300025914 Bacteria 1380
187 Ga0207693_10001138 3300025915 Bacteria 23835
188 Ga0207693_10015321 3300025915 Bacteria 6153
189 Ga0207693_10442101 3300025915 Bacteria 1016
190 Ga0207660_10047754 3300025917 Bacteria 3029
191 Ga0207662_10407811 3300025918 Bacteria 923
192 Ga0207657_10122990 3300025919 Bacteria 2134
193 Ga0207652_10398066 3300025921 Unclassified 1242
194 Ga0207652_10463521 3300025921 Bacteria 1142
195 Ga0207652_10915624 3300025921 Unclassified 774
196 Ga0207650_10678843 3300025925 Bacteria 869
197 Ga0207687_10049623 3300025927 Bacteria 2919
198 Ga0207687_10081579 3300025927 Bacteria 2338
199 Ga0207664_10378177 3300025929 Bacteria 1257
200 Ga0207644_10009339 3300025931 Bacteria 6440
201 Ga0207644_10313929 3300025931 Bacteria 1266
202 Ga0207644_10329479 3300025931 Bacteria 1236
203 Ga0207690_10283214 3300025932 Bacteria 1291
204 Ga0207690_10368421 3300025932 Bacteria 1139
205 Ga0207706_10024657 3300025933 Bacteria 5391
206 Ga0207706_10049238 3300025933 Bacteria 3725
207 Ga0207686_11024820 3300025934 Bacteria 670
208 Ga0207709_10173143 3300025935 Bacteria 1517
209 Ga0207670_10317576 3300025936 Bacteria 1225
210 Ga0207669_10092937 3300025937 Bacteria 1969
211 Ga0207669_10228780 3300025937 Bacteria 1370
212 Ga0207704_10001134 3300025938 Bacteria 11852
213 Ga0207665_10012379 3300025939 Bacteria 5604
214 Ga0207665_10052834 3300025939 Bacteria 2738
215 Ga0207665_10229192 3300025939 Bacteria 1365
216 Ga0207691_10188601 3300025940 Bacteria 1799
217 Ga0207689_10202471 3300025942 Bacteria 1639
218 Ga0207667_11312419 3300025949 Bacteria 700
219 Ga0207651_10049142 3300025960 Bacteria 2856
220 Ga0207712_10056558 3300025961 Bacteria 2764
221 Ga0207712_10067450 3300025961 Bacteria 2561
222 Ga0207712_10082972 3300025961 Bacteria 2338
223 Ga0207668_10124543 3300025972 Bacteria 1957
224 Ga0207668_10711530 3300025972 Bacteria 883
225 Ga0207668_10902292 3300025972 Bacteria 786
226 Ga0207668_10902472 3300025972 Bacteria 786
227 Ga0207640_10063790 3300025981 Bacteria 2449
228 Ga0207658_10030636 3300025986 Bacteria 3811
229 Ga0207658_10100538 3300025986 Bacteria 2264
230 Ga0207658_10235331 3300025986 Bacteria 1548
231 Ga0207658_10539255 3300025986 Bacteria 1043
232 Ga0207677_10023172 3300026023 Bacteria 3829
233 Ga0207677_10049815 3300026023 Bacteria 2829
234 Ga0207703_10040512 3300026035 Bacteria 3728
235 Ga0207703_10083929 3300026035 Bacteria 2663
236 Ga0207678_10053720 3300026067 Bacteria 3471
237 Ga0207678_10231930 3300026067 Bacteria 1580
238 Ga0207708_10000968 3300026075 Bacteria 21532
239 Ga0207708_10024716 3300026075 Bacteria 4544
240 Ga0207641_10032945 3300026088 Bacteria 4304
241 Ga0207641_11366079 3300026088 Bacteria 709
242 Ga0207648_10028936 3300026089 Bacteria 4912
243 Ga0207648_10089528 3300026089 Bacteria 2689
244 Ga0207676_10313668 3300026095 Bacteria 1437
245 Ga0207675_100000092 3300026118 Bacteria 70351
246 Ga0207675_100015244 3300026118 Bacteria 7169
247 Ga0207675_100407485 3300026118 Bacteria 1341
248 Ga0207683_10040953 3300026121 Bacteria 4044
249 Ga0207683_10042224 3300026121 Bacteria 3983
250 Ga0207698_10146362 3300026142 Bacteria 2044
251 Ga0209813_10116056 3300027866 Bacteria 927
252 Ga0209813_10159748 3300027866 Bacteria 812
253 Ga0207428_10405789 3300027907 Bacteria 997
254 Ga0268266_10001787 3300028379 Bacteria 24374
255 Ga0268266_10105575 3300028379 Bacteria 2489
256 Ga0268265_10146327 3300028380 Bacteria 1986
257 Ga0268265_11192837 3300028380 Bacteria 758
258 Ga0268264_10313306 3300028381 Bacteria 1481
259 Ga0268264_10318686 3300028381 Bacteria 1469
260 Ga0307413_10032821 3300031824 Bacteria 2948
261 Ga0307410_10331081 3300031852 Bacteria 1211
262 Ga0307410_10712633 3300031852 Bacteria 847
263 Ga0307407_10208203 3300031903 Bacteria 1315
264 Ga0373962_0088777 3300035242 Bacteria 949
265 Ga0373931_0092836 3300035691 Bacteria 1685
266 Ga0436364_1110548 3300037853 Bacteria 23022
267 Ga0436365_0350974 3300039437 Bacteria 14303
268 Ga0436365_1265129 3300039437 Bacteria 1454
269 Ga0436363_0895048 3300039450 Bacteria 974
270 Ga0436363_1461726 3300039450 Bacteria 1560
271 Ga0439461_0005504 3300041410 Bacteria 2161
272 Ga0439461_0006666 3300041410 Bacteria 2018
273 Ga0439466_0010327 3300041411 Bacteria 3471
274 Ga0439466_0042609 3300041411 Bacteria 1510
275 Ga0439466_0081884 3300041411 Bacteria 1017
276 Ga0439465_0011141 3300041413 Bacteria 2822
277 Ga0439465_0016303 3300041413 Bacteria 2318
278 Ga0439465_0016934 3300041413 Bacteria 2274
279 Ga0451797_0853914 3300041453 Bacteria 1171
280 Ga0439431_0000965 3300041997 Bacteria 6242
281 Ga0439431_0013380 3300041997 Bacteria 1892
282 Ga0439442_079045 3300042002 Bacteria 703
283 Ga0439445_0006007 3300042004 Bacteria 2782
284 Ga0439445_0042384 3300042004 Bacteria 1212
285 Ga0439448_0197429 3300042005 Bacteria 705
286 Ga0439434_0017819 3300042435 Bacteria 2125
287 Ga0466969_0240250 3300044656 Bacteria 822
288 Ga0466972_0052220 3300044658 Bacteria 1971
289 Ga0466972_0295479 3300044658 Bacteria 757
290 Ga0466972_0521558 3300044658 Bacteria 560
291 Ga0466965_0006044 3300044683 Bacteria 5471
292 Ga0466965_0015445 3300044683 Bacteria 3628
293 Ga0466961_0086978 3300044693 Bacteria 1975
294 Ga0466963_0042265 3300044694 Bacteria 2992
295 Ga0466963_0196529 3300044694 Bacteria 1410
296 Ga0466964_0082219 3300044706 Bacteria 1385
297 Ga0466968_0002052 3300044735 Bacteria 7330
298 Ga0466970_0194521 3300044765 Bacteria 1127
299 Ga0466957_0012299 3300044842 Bacteria 4955
300 Ga0466957_0381311 3300044842 Bacteria 961
301 Ga0466960_0036297 3300044901 Bacteria 2307
302 Ga0466960_0075683 3300044901 Bacteria 1684
303 Ga0466960_0122193 3300044901 Bacteria 1365
304 Ga0466959_0010136 3300045049 Bacteria 6722
305 Ga0466959_0124245 3300045049 Bacteria 1832
306 Ga0466959_0457473 3300045049 Unclassified 865
307 Ga0466958_0210038 3300045836 Bacteria 1240
308 Ga0466958_0231679 3300045836 Bacteria 1179
309 Ga0466958_0383509 3300045836 Unclassified 906
310 Ga0466967_0006974 3300045976 Bacteria 8085
311 Ga0466967_0060239 3300045976 Bacteria 3363
312 Ga0466967_0070684 3300045976 Bacteria 3123
313 Ga0466967_0172720 3300045976 Bacteria 2034
314 Ga0466967_0246275 3300045976 Bacteria 1706
315 Ga0466967_0543919 3300045976 Bacteria 1143
316 Ga0466967_0710623 3300045976 Unclassified 996
317 Ga0466967_0740253 3300045976 Bacteria 975
318 Ga0495649_0263822 3300046694 Bacteria 882
319 Ga0495672_0094612 3300047320 Bacteria 1633
320 Ga0495672_0381403 3300047320 Bacteria 648
321 Ga0496100_0030433 3300048903 Bacteria 3348
322 Ga0496101_0157980 3300048904 Bacteria 1738
323 Ga0496102_0023597 3300048905 Bacteria 5465
324 Ga0496102_0061557 3300048905 Bacteria 3435
325 Ga0496102_0142544 3300048905 Bacteria 2247
326 Ga0496102_1154268 3300048905 Bacteria 694
327 Ga0496103_0077944 3300048906 Bacteria 2081
328 Ga0496104_0062940 3300048907 Bacteria 3518
329 Ga0496104_0120587 3300048907 Bacteria 2518
330 Ga0496104_0584989 3300048907 Bacteria 1027
331 Ga0496105_0019862 3300048908 Bacteria 5421
332 Ga0496105_0020755 3300048908 Bacteria 5310
333 Ga0496106_0164098 3300048909 Bacteria 1758
334 Ga0496106_0837763 3300048909 Bacteria 728
335 Ga0496107_0025973 3300048910 Bacteria 4150
336 Ga0496107_0207909 3300048910 Bacteria 1455
337 Ga0496108_0020319 3300048911 Bacteria 5458
338 Ga0496108_0039987 3300048911 Bacteria 3908
339 Ga0496108_0109044 3300048911 Bacteria 2365
340 Ga0496108_0429340 3300048911 Bacteria 1154
341 Ga0496109_0012685 3300048912 Bacteria 7282
342 Ga0496109_0127853 3300048912 Bacteria 2370
343 Ga0496109_0259794 3300048912 Bacteria 1636
344 Ga0496109_0553827 3300048912 Bacteria 1085
345 Ga0496110_0047519 3300048913 Bacteria 3759
346 Ga0496110_0231226 3300048913 Bacteria 1682
347 Ga0496110_1452757 3300048913 Bacteria 595
348 Ga0496111_0042338 3300048914 Bacteria 3270
349 Ga0496111_0155764 3300048914 Bacteria 1695
350 Ga0496112_0001265 3300048915 Bacteria 19181
351 Ga0496112_0029248 3300048915 Bacteria 5327
352 Ga0496113_0040748 3300048916 Bacteria 3424
353 Ga0496113_0986638 3300048916 Bacteria 664
354 Ga0496114_0146741 3300048917 Bacteria 2045
355 Ga0496114_0372697 3300048917 Bacteria 1264
356 Ga0496115_0076961 3300048918 Bacteria 2712
357 Ga0501032_0009639 3300049569 Bacteria 6996
358 Ga0501033_0008474 3300049570 Bacteria 7959
359 Ga0501034_0024088 3300049571 Bacteria 6193
360 Ga0501036_0167881 3300049572 Bacteria 1849
361 Ga0501037_0007645 3300049573 Bacteria 7912
362 Ga0501042_0133449 3300049578 Bacteria 1790
363 Ga0501043_0032822 3300049579 Bacteria 4083
364 Ga0501043_0774819 3300049579 Bacteria 696
365 Ga0501046_0001150 3300049580 Bacteria 25719
366 Ga0501047_0031575 3300049581 Bacteria 5108
367 Ga0501048_0175787 3300049582 Bacteria 1517
368 Ga0501048_0246531 3300049582 Unclassified 1268
369 Ga0501069_0007704 3300049585 Bacteria 5650
370 Ga0501070_0001935 3300049586 Bacteria 18290
371 Ga0501070_0386850 3300049586 Bacteria 1133
372 Ga0501073_0104602 3300049589 Bacteria 1965
373 Ga0501080_0026335 3300049742 Bacteria 5404
374 Ga0501083_0183885 3300049744 Bacteria 1364
375 Ga0501035_0034628 3300049822 Bacteria 4587
376 Ga0501035_0786883 3300049822 Bacteria 761
377 Ga0501044_0004131 3300049823 Bacteria 16298
378 nmdc:mga03683_154397_c1 3300050489 Bacteria 1037
379 nmdc:mga03683_418874_c1 3300050489 Bacteria 641
380 nmdc:mga03683_70956_c1 3300050489 Bacteria 1489
381 nmdc:mga03n38_80133_c1 3300050490 Bacteria 1533
382 nmdc:mga03n38_90296_c1 3300050490 Bacteria 1457
383 nmdc:mga00v17_11752_c1 3300050491 Bacteria 4816
384 nmdc:mga00v17_292927_c1 3300050491 Bacteria 1057
385 nmdc:mga00v17_6113_c1 3300050491 Bacteria 6375
386 nmdc:mga00v17_72929_c1 3300050491 Bacteria 2131
387 nmdc:mga00v17_7881_c1 3300050491 Bacteria 5713
388 nmdc:mga0yw44_5928_c1 3300050492 Bacteria 5842
389 nmdc:mga06z11_321772_c1 3300050494 Bacteria 923
390 nmdc:mga06z11_376103_c1 3300050494 Bacteria 853
391 nmdc:mga06z11_392753_c1 3300050494 Bacteria 834
392 nmdc:mga04h51_12084_c1 3300050495 Bacteria 2414
393 nmdc:mga04h51_37643_c1 3300050495 Bacteria 1562
394 nmdc:mga07m45_169756_c1 3300050496 Bacteria 1268
395 nmdc:mga07m45_24969_c1 3300050496 Bacteria 3276
396 nmdc:mga07m45_35715_c1 3300050496 Bacteria 2765
397 nmdc:mga07m45_36468_c2 3300050496 Bacteria 2119
398 nmdc:mga05p37_176075_c1 3300050507 Bacteria 2606
399 nmdc:mga0qj67_356927_c1 3300050509 Bacteria 1181
400 nmdc:mga0qj67_371400_c1 3300050509 Bacteria 1155
401 nmdc:mga0qj67_4684_c1 3300050509 Bacteria 9928
402 nmdc:mga0n895_812945_c1 3300050512 Bacteria 924
403 nmdc:mga0sz30_22602_c1 3300050516 Bacteria 2554
404 nmdc:mga0sz30_232108_c1 3300050516 Bacteria 821
405 nmdc:mga0sz30_44563_c3 3300050516 Bacteria 984
406 Ga0500641_0038032 3300053096 Bacteria 1932
407 Ga0500556_0005047 3300053104 Bacteria 3734
408 Ga0500616_0101011 3300053153 Bacteria 1410
409 Ga0466962_0050108 3300061719 Bacteria 1996
410 Ga0466962_0310508 3300061719 Bacteria 781
411 2744956497 2744054611 Bacteria 5611514
412 2902816343 2902810491 Bacteria 6794147
413 2929216673 2929212328 Bacteria 7708288
414 Ga0207675_100223154
415 JGI24737J22298_10018871
416 JGI24744J21845_10004848
417 JGI24751J29686_10030257
418 Ga0070676_10034255
419 Ga0070690_100141819
420 Ga0070670_100553440
421 Ga0070680_100054533
422 Ga0070682_100165966
423 Ga0068868_100085154
424 Ga0068868_100194880
425 Ga0068868_101031113
426 Ga0070660_100805873
427 Ga0070689_100353831
428 Ga0070689_100490216
429 Ga0070691_10007153
430 Ga0070691_10046118
431 Ga0070687_100058984
432 Ga0070692_10224383
433 Ga0070668_100042708
434 Ga0070668_100043174
435 Ga0070668_100750083
436 Ga0070669_100245630
437 Ga0070671_100312229
438 Ga0070671_100334124
439 Ga0070674_100557468
440 Ga0070673_100033466
441 Ga0070667_100058335
442 Ga0070667_100198345
443 Ga0070667_100288347
444 Ga0070667_100386679
445 Ga0070709_10236764
446 Ga0070714_100443725
447 Ga0070714_100654141
448 Ga0070710_10046781
449 Ga0070710_10105229
450 Ga0070701_10065416
451 Ga0070711_100012523
452 Ga0070711_100502731
453 Ga0070705_100199466
454 Ga0070705_100788781
455 Ga0070700_100009057
456 Ga0070694_100079052
457 Ga0070678_100019023
458 Ga0070662_100010742
459 Ga0070662_100013685
460 Ga0068867_100008040
461 Ga0070685_10099622
462 Ga0070679_100610092
463 Ga0070679_100846680
464 Ga0068853_100055999
465 Ga0070672_100138032
466 Ga0070686_100066988
467 Ga0070695_100081387
468 Ga0070696_100025549
469 Ga0070696_100035326
470 Ga0070696_100470383
471 Ga0070693_100058742
472 Ga0070693_100345803
473 Ga0070665_100177793
474 Ga0070704_100092083
475 Ga0068855_100461576
476 Ga0070702_100025633
477 Ga0070702_100527907
478 Ga0068852_100366090
479 Ga0068859_100522887
480 Ga0068859_101295617
481 Ga0068864_101434705
482 Ga0068861_100176354
483 Ga0068861_100706823
484 Ga0068870_10903305
485 Ga0068863_100062875
486 Ga0068863_100108155
487 Ga0068858_100361873
488 Ga0068858_100677552
489 Ga0068860_100307373
490 Ga0068860_100562688
491 Ga0068862_100040379
492 Ga0068862_100052755
493 Ga0068862_100406414
494 Ga0068862_101814187
495 Ga0070717_10968565
496 Ga0075365_10007241
497 Ga0075365_10028281
498 Ga0075368_10213947
499 Ga0075363_100000026
500 Ga0075363_100002955
501 Ga0075363_100033183
502 Ga0075363_100041433
503 Ga0075363_100123911
504 Ga0075363_100443759
505 Ga0075364_10006840
506 Ga0075364_10006903
507 Ga0075364_10054403
508 Ga0075364_10082609
509 Ga0075364_10272392
510 Ga0075364_10695017
511 Ga0070715_10019725
512 Ga0070716_100026616
513 Ga0070716_100125309
514 Ga0070712_100013125
515 Ga0070712_100086967
516 Ga0070712_100454399
517 Ga0075362_10593041
518 Ga0075367_10028586
519 Ga0075367_10033025
520 Ga0075367_10325971
521 Ga0075367_10432292
522 Ga0075367_10459394
523 Ga0075369_10010543
524 Ga0075369_10022709
525 Ga0075369_10126826
526 Ga0075369_10152762
527 Ga0075369_10303170
528 Ga0097621_100158867
529 Ga0075370_10041612
530 Ga0075370_10075775
531 Ga0068871_100073590
532 Ga0075428_100085918
533 Ga0075430_100007642
534 Ga0075430_100081268
535 Ga0075430_100372952
536 Ga0075431_100094951
537 Ga0075434_100677177
538 Ga0075429_100674860
539 Ga0068865_100248701
540 Ga0097620_100522877
541 Ga0097620_101295716
542 Ga0105250_10026290
543 Ga0105240_10212233
544 Ga0105245_10136830
545 Ga0105245_10140193
546 Ga0105245_10142640
547 Ga0105247_10010694
548 Ga0105247_10014578
549 Ga0114129_10080950
550 Ga0105243_10035359
551 Ga0105243_10118428
552 Ga0105241_10038093
553 Ga0105242_10029051
554 Ga0105242_10416287
555 Ga0105248_10026589
556 Ga0105248_11219674
557 Ga0105237_10111589
558 Ga0105249_10006495
559 Ga0105249_10042961
560 Ga0105239_11108030
561 Ga0105246_10323451
562 Ga0105246_11460031
563 Ga0157374_10006683
564 Ga0157374_10555508
565 Ga0157378_10013379
566 Ga0157378_10363301
567 Ga0163162_10231755
568 Ga0163162_12391074
569 Ga0157372_10089858
570 Ga0157375_10070570
571 Ga0157375_11044163
572 Ga0163163_10029072
573 Ga0163163_10662174
574 Ga0157380_10038897
575 Ga0157380_10298687
576 Ga0157377_10048276
577 Ga0157377_10101125
578 Ga0157379_10069881
579 Ga0157379_10120331
580 Ga0157376_10071854
581 Ga0157376_10231281
582 Ga0163161_10138886
583 Ga0163161_10156843
584 Ga0213874_10077550
585 Ga0207653_10033109
586 Ga0207692_10012497
587 Ga0207692_10115671
588 Ga0207642_10001320
589 Ga0207642_10026004
590 Ga0207710_10023584
591 Ga0207710_10086163
592 Ga0207688_10001401
593 Ga0207688_10003181
594 Ga0207680_10317062
595 Ga0207645_10060973
596 Ga0207645_10093343
597 Ga0207654_10067036
598 Ga0207671_10058481
599 Ga0207671_10254878
600 Ga0207693_10001138
601 Ga0207693_10015321
602 Ga0207693_10442101
603 Ga0207660_10047754
604 Ga0207662_10407811
605 Ga0207657_10122990
606 Ga0207652_10398066
607 Ga0207652_10463521
608 Ga0207652_10915624
609 Ga0207650_10678843
610 Ga0207687_10049623
611 Ga0207687_10081579
612 Ga0207664_10378177
613 Ga0207644_10009339
614 Ga0207644_10313929
615 Ga0207644_10329479
616 Ga0207690_10283214
617 Ga0207690_10368421
618 Ga0207706_10024657
619 Ga0207706_10049238
620 Ga0207686_11024820
621 Ga0207709_10173143
622 Ga0207670_10317576
623 Ga0207669_10092937
624 Ga0207669_10228780
625 Ga0207704_10001134
626 Ga0207665_10012379
627 Ga0207665_10052834
628 Ga0207665_10229192
629 Ga0207691_10188601
630 Ga0207689_10202471
631 Ga0207667_11312419
632 Ga0207651_10049142
633 Ga0207712_10056558
634 Ga0207712_10067450
635 Ga0207712_10082972
636 Ga0207668_10124543
637 Ga0207668_10711530
638 Ga0207668_10902292
639 Ga0207668_10902472
640 Ga0207640_10063790
641 Ga0207658_10030636
642 Ga0207658_10100538
643 Ga0207658_10235331
644 Ga0207658_10539255
645 Ga0207677_10023172
646 Ga0207677_10049815
647 Ga0207703_10040512
648 Ga0207703_10083929
649 Ga0207678_10053720
650 Ga0207678_10231930
651 Ga0207708_10000968
652 Ga0207708_10024716
653 Ga0207641_10032945
654 Ga0207641_11366079
655 Ga0207648_10028936
656 Ga0207648_10089528
657 Ga0207676_10313668
658 Ga0207675_100000092
659 Ga0207675_100015244
660 Ga0207675_100407485
661 Ga0207683_10040953
662 Ga0207683_10042224
663 Ga0207698_10146362
664 Ga0209813_10116056
665 Ga0209813_10159748
666 Ga0207428_10405789
667 Ga0268266_10001787
668 Ga0268266_10105575
669 Ga0268265_10146327
670 Ga0268265_11192837
671 Ga0268264_10313306
672 Ga0268264_10318686
673 Ga0307413_10032821
674 Ga0307410_10331081
675 Ga0307410_10712633
676 Ga0307407_10208203
677 Ga0373962_0088777
678 Ga0373931_0092836
679 Ga0436364_1110548
680 Ga0436365_0350974
681 Ga0436365_1265129
682 Ga0436363_0895048
683 Ga0436363_1461726
684 Ga0439461_0005504
685 Ga0439461_0006666
686 Ga0439466_0010327
687 Ga0439466_0042609
688 Ga0439466_0081884
689 Ga0439465_0011141
690 Ga0439465_0016303
691 Ga0439465_0016934
692 Ga0451797_0853914
693 Ga0439431_0000965
694 Ga0439431_0013380
695 Ga0439442_079045
696 Ga0439445_0006007
697 Ga0439445_0042384
698 Ga0439448_0197429
699 Ga0439434_0017819
700 Ga0466969_0240250
701 Ga0466972_0052220
702 Ga0466972_0295479
703 Ga0466972_0521558
704 Ga0466965_0006044
705 Ga0466965_0015445
706 Ga0466961_0086978
707 Ga0466963_0042265
708 Ga0466963_0196529
709 Ga0466964_0082219
710 Ga0466968_0002052
711 Ga0466970_0194521
712 Ga0466957_0012299
713 Ga0466957_0381311
714 Ga0466960_0036297
715 Ga0466960_0075683
716 Ga0466960_0122193
717 Ga0466959_0010136
718 Ga0466959_0124245
719 Ga0466959_0457473
720 Ga0466958_0210038
721 Ga0466958_0231679
722 Ga0466958_0383509
723 Ga0466967_0006974
724 Ga0466967_0060239
725 Ga0466967_0070684
726 Ga0466967_0172720
727 Ga0466967_0246275
728 Ga0466967_0543919
729 Ga0466967_0710623
730 Ga0466967_0740253
731 Ga0495649_0263822
732 Ga0495672_0094612
733 Ga0495672_0381403
734 Ga0496100_0030433
735 Ga0496101_0157980
736 Ga0496102_0023597
737 Ga0496102_0061557
738 Ga0496102_0142544
739 Ga0496102_1154268
740 Ga0496103_0077944
741 Ga0496104_0062940
742 Ga0496104_0120587
743 Ga0496104_0584989
744 Ga0496105_0019862
745 Ga0496105_0020755
746 Ga0496106_0164098
747 Ga0496106_0837763
748 Ga0496107_0025973
749 Ga0496107_0207909
750 Ga0496108_0020319
751 Ga0496108_0039987
752 Ga0496108_0109044
753 Ga0496108_0429340
754 Ga0496109_0012685
755 Ga0496109_0127853
756 Ga0496109_0259794
757 Ga0496109_0553827
758 Ga0496110_0047519
759 Ga0496110_0231226
760 Ga0496110_1452757
761 Ga0496111_0042338
762 Ga0496111_0155764
763 Ga0496112_0001265
764 Ga0496112_0029248
765 Ga0496113_0040748
766 Ga0496113_0986638
767 Ga0496114_0146741
768 Ga0496114_0372697
769 Ga0496115_0076961
770 Ga0501032_0009639
771 Ga0501033_0008474
772 Ga0501034_0024088
773 Ga0501036_0167881
774 Ga0501037_0007645
775 Ga0501042_0133449
776 Ga0501043_0032822
777 Ga0501043_0774819
778 Ga0501046_0001150
779 Ga0501047_0031575
780 Ga0501048_0175787
781 Ga0501048_0246531
782 Ga0501069_0007704
783 Ga0501070_0001935
784 Ga0501070_0386850
785 Ga0501073_0104602
786 Ga0501080_0026335
787 Ga0501083_0183885
788 Ga0501035_0034628
789 Ga0501035_0786883
790 Ga0501044_0004131
791 nmdc:mga03683_154397_c1
792 nmdc:mga03683_418874_c1
793 nmdc:mga03683_70956_c1
794 nmdc:mga03n38_80133_c1
795 nmdc:mga03n38_90296_c1
796 nmdc:mga00v17_11752_c1
797 nmdc:mga00v17_292927_c1
798 nmdc:mga00v17_6113_c1
799 nmdc:mga00v17_72929_c1
800 nmdc:mga00v17_7881_c1
801 nmdc:mga0yw44_5928_c1
802 nmdc:mga06z11_321772_c1
803 nmdc:mga06z11_376103_c1
804 nmdc:mga06z11_392753_c1
805 nmdc:mga04h51_12084_c1
806 nmdc:mga04h51_37643_c1
807 nmdc:mga07m45_169756_c1
808 nmdc:mga07m45_24969_c1
809 nmdc:mga07m45_35715_c1
810 nmdc:mga07m45_36468_c2
811 nmdc:mga05p37_176075_c1
812 nmdc:mga0qj67_356927_c1
813 nmdc:mga0qj67_371400_c1
814 nmdc:mga0qj67_4684_c1
815 nmdc:mga0n895_812945_c1
816 nmdc:mga0sz30_22602_c1
817 nmdc:mga0sz30_232108_c1
818 nmdc:mga0sz30_44563_c3
819 Ga0500641_0038032
820 Ga0500556_0005047
821 Ga0500616_0101011
822 Ga0466962_0050108
823 Ga0466962_0310508
824 2744956497
825 2902816343
826 2929216673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

9

156

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zoe-assembly1.cif.gz_A crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.9304 14 139
3zoh-assembly1.cif.gz_D crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound 1-cyclohex-2-enone 0.9277 14 141
3zoe-assembly1.cif.gz_B crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.9258 14 141
2r0x-assembly1.cif.gz_A-2 crystal structure of a putative flavin reductase (ycdh, hs_1225) from haemophilus somnus 129pt at 1.06 a resolution 0.8956 1 141
1i0s-assembly1.cif.gz_A archaeoglobus fulgidus ferric reductase complex with nadp+ 0.8939 1 153
ID Description Score Start End Superfamily
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9294 1 156 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9258 14 141 2.30.110.10
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8939 1 153 2.30.110.10
2r6vA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8884 11 141 2.30.110.10
2r0xA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8829 1 141 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7K2MP36-F1-model_v4 Flavin reductase 0.9842 16 126 GO:0010181
GO:0042602
AF-A0A5A7ZF82-F1-model_v4 Flavin reductase 0.9831 17 161 GO:0010181
GO:0042602
AF-A0A1X1V787-F1-model_v4 Oxidoreductase 0.9821 13 161 GO:0010181
GO:0042602
AF-A0A1X1SG14-F1-model_v4 deleted 0.9764 17 161
AF-A0A0J8U7K3-F1-model_v4 Oxidoreductase 0.9751 17 161 GO:0010181
GO:0042602

Map