F438039

General Info

Members Datasets Scaffolds Average Seq Length
413 219 826 333

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10053964|Ga0075433_100539644
Length 329
Sequence MTNQRVVLASRPVGPVSESNFRVEDAPVAKPADGEVLVRNLWLSLDPYMRGRMSDAKSYVKGVDIGEVMVGQTVGEVVESRHPKLNVGDTVLTQLGWQLYGATREAMKVDTSRAPASYYLGLLGMPGLTAYFGLKELGQPKPGETVVVSAASGAVGSVVGQLAKLWGCRAVGIAGGREKCAYVKDELGFDACIDYKGGALRDDLKAACPKGVDVYFDNVGGEILDLLLTRLNLFGRIVVCGSISDYNSTEPYRVRNWRAILVNRLRVQGMIVFDWKDRYGEALKALGGYFAEGKLNYRESVVQGLENAPRGLIDLLGGRNFGKQLVKLG

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.94
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10053964 3300006852 Bacteria 3505
2 Ga0065707_10180930 3300005295 Bacteria 1419
3 Ga0070676_10009870 3300005328 Bacteria 5167
4 Ga0070676_10053250 3300005328 Bacteria 2383
5 Ga0070683_100053335 3300005329 Bacteria 3747
6 Ga0070690_100001731 3300005330 Bacteria 11527
7 Ga0070690_100123247 3300005330 Bacteria 1742
8 Ga0070670_100007600 3300005331 Bacteria 9204
9 Ga0070677_10000311 3300005333 Bacteria 16974
10 Ga0068869_100047392 3300005334 Bacteria 3103
11 Ga0070666_10003528 3300005335 Bacteria 9486
12 Ga0070666_10164443 3300005335 Bacteria 1552
13 Ga0070680_100091908 3300005336 Bacteria 2512
14 Ga0068868_100004906 3300005338 Bacteria 9395
15 Ga0068868_100012817 3300005338 Bacteria 6133
16 Ga0068868_100056461 3300005338 Bacteria 3100
17 Ga0068868_100195558 3300005338 Bacteria 1683
18 Ga0070660_100050566 3300005339 Bacteria 3198
19 Ga0070689_100022029 3300005340 Bacteria 4753
20 Ga0070687_100033083 3300005343 Bacteria 2549
21 Ga0070661_100026489 3300005344 Bacteria 4170
22 Ga0070692_10079674 3300005345 Bacteria 1761
23 Ga0070668_100005135 3300005347 Bacteria 9706
24 Ga0070668_100015813 3300005347 Bacteria 5644
25 Ga0070668_100187185 3300005347 Bacteria 1694
26 Ga0070669_100010858 3300005353 Bacteria 6464
27 Ga0070675_100017130 3300005354 Bacteria 5758
28 Ga0070671_100026398 3300005355 Bacteria 4772
29 Ga0070671_100127473 3300005355 Bacteria 2143
30 Ga0070671_100441017 3300005355 Bacteria 1116
31 Ga0070674_100000539 3300005356 Bacteria 19016
32 Ga0070674_100046458 3300005356 Bacteria 2970
33 Ga0070673_100000769 3300005364 Bacteria 17828
34 Ga0070673_100001790 3300005364 Bacteria 12806
35 Ga0070673_100016610 3300005364 Bacteria 5210
36 Ga0070673_100090024 3300005364 Bacteria 2506
37 Ga0070673_100177189 3300005364 Bacteria 1823
38 Ga0070673_100298933 3300005364 Bacteria 1417
39 Ga0070688_100007735 3300005365 Bacteria 5803
40 Ga0070688_100218866 3300005365 Bacteria 1341
41 Ga0070667_100013289 3300005367 Bacteria 6800
42 Ga0070667_100014852 3300005367 Bacteria 6434
43 Ga0070667_100093262 3300005367 Bacteria 2593
44 Ga0070667_100150370 3300005367 Bacteria 2045
45 Ga0070667_100185194 3300005367 Bacteria 1842
46 Ga0070709_10031538 3300005434 Bacteria 3188
47 Ga0070713_100036300 3300005436 Bacteria 3976
48 Ga0070713_100052376 3300005436 Bacteria 3379
49 Ga0070710_10023182 3300005437 Bacteria 3258
50 Ga0070710_10048448 3300005437 Bacteria 2373
51 Ga0070701_10029659 3300005438 Bacteria 2700
52 Ga0070711_100218695 3300005439 Bacteria 1479
53 Ga0070705_100004762 3300005440 Bacteria 6606
54 Ga0070705_100045984 3300005440 Bacteria 2514
55 Ga0070705_100187018 3300005440 Bacteria 1408
56 Ga0070700_100004167 3300005441 Bacteria 7537
57 Ga0070694_100060221 3300005444 Bacteria 2589
58 Ga0070663_100005315 3300005455 Bacteria 7641
59 Ga0070678_100001570 3300005456 Bacteria 12243
60 Ga0070678_100031110 3300005456 Bacteria 3677
61 Ga0068867_100001532 3300005459 Bacteria 16033
62 Ga0068867_100007667 3300005459 Bacteria 7638
63 Ga0070685_10001314 3300005466 Bacteria 13075
64 Ga0070685_10159897 3300005466 Bacteria 1435
65 Ga0070706_100023536 3300005467 Bacteria 5673
66 Ga0070707_100181884 3300005468 Bacteria 2049
67 Ga0070698_100255616 3300005471 Bacteria 1684
68 Ga0070698_100421671 3300005471 Bacteria 1269
69 Ga0070699_100074736 3300005518 Bacteria 2949
70 Ga0070699_100397277 3300005518 Bacteria 1246
71 Ga0070679_100063303 3300005530 Bacteria 3687
72 Ga0070684_100076844 3300005535 Bacteria 2948
73 Ga0070697_100186460 3300005536 Bacteria 1759
74 Ga0068853_100011083 3300005539 Bacteria 7312
75 Ga0068853_100070171 3300005539 Bacteria 3049
76 Ga0070672_100000794 3300005543 Bacteria 18801
77 Ga0070672_100005211 3300005543 Bacteria 8599
78 Ga0070672_100086434 3300005543 Bacteria 2522
79 Ga0070686_100006024 3300005544 Bacteria 6728
80 Ga0070686_100011459 3300005544 Bacteria 5030
81 Ga0070686_100123919 3300005544 Bacteria 1778
82 Ga0070695_100035449 3300005545 Bacteria 3134
83 Ga0070695_100050343 3300005545 Bacteria 2669
84 Ga0070695_100204778 3300005545 Bacteria 1412
85 Ga0070696_100013942 3300005546 Bacteria 5396
86 Ga0070696_100217021 3300005546 Bacteria 1434
87 Ga0070693_100004069 3300005547 Bacteria 6883
88 Ga0070665_100001532 3300005548 Bacteria 26721
89 Ga0070665_100014168 3300005548 Bacteria 8011
90 Ga0070665_100037489 3300005548 Bacteria 4876
91 Ga0070665_100472247 3300005548 Bacteria 1265
92 Ga0070665_100530408 3300005548 Bacteria 1189
93 Ga0070704_100052141 3300005549 Bacteria 2885
94 Ga0070704_100382205 3300005549 Bacteria 1197
95 Ga0070704_100443692 3300005549 Bacteria 1116
96 Ga0068855_100248341 3300005563 Bacteria 1985
97 Ga0070664_100208374 3300005564 Bacteria 1746
98 Ga0070664_100281693 3300005564 Bacteria 1499
99 Ga0068854_100005571 3300005578 Bacteria 7954
100 Ga0068854_100072046 3300005578 Bacteria 2529
101 Ga0068854_100301756 3300005578 Bacteria 1296
102 Ga0068856_100026265 3300005614 Bacteria 5678
103 Ga0068856_100041295 3300005614 Bacteria 4533
104 Ga0070702_100010377 3300005615 Bacteria 4585
105 Ga0070702_100049022 3300005615 Bacteria 2406
106 Ga0070702_100107748 3300005615 Bacteria 1721
107 Ga0068852_100031170 3300005616 Bacteria 4396
108 Ga0068859_100012636 3300005617 Bacteria 8488
109 Ga0068859_100243039 3300005617 Bacteria 1890
110 Ga0068864_100000386 3300005618 Bacteria 38472
111 Ga0068864_100010020 3300005618 Bacteria 7823
112 Ga0068864_100015375 3300005618 Bacteria 6363
113 Ga0068864_100039841 3300005618 Bacteria 4016
114 Ga0068864_100054671 3300005618 Bacteria 3446
115 Ga0068864_100163993 3300005618 Bacteria 2022
116 Ga0068864_100370247 3300005618 Bacteria 1356
117 Ga0068866_10003430 3300005718 Bacteria 6494
118 Ga0068861_100007257 3300005719 Bacteria 7595
119 Ga0068861_100029509 3300005719 Bacteria 4013
120 Ga0068861_100099093 3300005719 Bacteria 2314
121 Ga0068851_10051907 3300005834 Bacteria 2084
122 Ga0068863_100000458 3300005841 Bacteria 41585
123 Ga0068863_100008080 3300005841 Bacteria 10275
124 Ga0068863_100016305 3300005841 Bacteria 7131
125 Ga0068863_100052864 3300005841 Bacteria 3849
126 Ga0068858_100001613 3300005842 Bacteria 22993
127 Ga0068858_100010871 3300005842 Bacteria 8604
128 Ga0068858_100077324 3300005842 Bacteria 3092
129 Ga0068858_100115717 3300005842 Bacteria 2506
130 Ga0068860_100018013 3300005843 Bacteria 6878
131 Ga0068860_100036687 3300005843 Bacteria 4695
132 Ga0068860_100115485 3300005843 Bacteria 2567
133 Ga0068860_100342902 3300005843 Bacteria 1469
134 Ga0068860_100352439 3300005843 Bacteria 1449
135 Ga0068862_100434096 3300005844 Bacteria 1235
136 Ga0081539_10002623 3300005985 Bacteria 24577
137 Ga0070712_100003878 3300006175 Bacteria 9210
138 Ga0097621_100007870 3300006237 Bacteria 7644
139 Ga0097621_100021582 3300006237 Bacteria 4985
140 Ga0097621_100027961 3300006237 Bacteria 4440
141 Ga0097621_100040110 3300006237 Bacteria 3763
142 Ga0068871_100002870 3300006358 Bacteria 11813
143 Ga0068871_100010298 3300006358 Bacteria 6815
144 Ga0068871_100017141 3300006358 Bacteria 5474
145 Ga0068871_100027613 3300006358 Bacteria 4440
146 Ga0068871_100065705 3300006358 Bacteria 2971
147 Ga0075434_100014140 3300006871 Bacteria 7623
148 Ga0075434_100213406 3300006871 Bacteria 1950
149 Ga0068865_100007546 3300006881 Bacteria 6694
150 Ga0068865_100045177 3300006881 Bacteria 3019
151 Ga0068865_100173179 3300006881 Bacteria 1656
152 Ga0075436_100032037 3300006914 Bacteria 3622
153 Ga0075436_100052399 3300006914 Bacteria 2816
154 Ga0097620_100012636 3300006931 Bacteria 8488
155 Ga0097620_100243037 3300006931 Bacteria 1890
156 Ga0097620_100395539 3300006931 Bacteria 1478
157 Ga0075435_100004886 3300007076 Bacteria 9283
158 Ga0075435_100012279 3300007076 Bacteria 6335
159 Ga0075435_100061731 3300007076 Bacteria 3041
160 Ga0099794_10045255 3300007265 Bacteria 2106
161 Ga0105240_10238662 3300009093 Bacteria 2109
162 Ga0105245_10003221 3300009098 Bacteria 14623
163 Ga0105245_10023811 3300009098 Bacteria 5376
164 Ga0105245_10091303 3300009098 Bacteria 2802
165 Ga0105243_10077320 3300009148 Bacteria 2706
166 Ga0105243_10102190 3300009148 Bacteria 2381
167 Ga0105243_10188831 3300009148 Bacteria 1798
168 Ga0105243_10332643 3300009148 Bacteria 1388
169 Ga0105241_10066519 3300009174 Bacteria 2787
170 Ga0105242_10003433 3300009176 Bacteria 12318
171 Ga0105248_10035415 3300009177 Bacteria 5584
172 Ga0105248_10174704 3300009177 Bacteria 2421
173 Ga0105248_10505271 3300009177 Bacteria 1363
174 Ga0105248_10679974 3300009177 Bacteria 1161
175 Ga0105238_10147134 3300009551 Bacteria 2332
176 Ga0105249_10067930 3300009553 Bacteria 3286
177 Ga0105239_10091066 3300010375 Bacteria 3365
178 Ga0157370_10305021 3300013104 Bacteria 1469
179 Ga0157374_10000534 3300013296 Bacteria 34050
180 Ga0157378_10101442 3300013297 Bacteria 2628
181 Ga0157378_10206848 3300013297 Bacteria 1859
182 Ga0163162_10026988 3300013306 Bacteria 5678
183 Ga0163162_10230258 3300013306 Bacteria 1983
184 Ga0163162_10422348 3300013306 Bacteria 1465
185 Ga0157372_10414020 3300013307 Bacteria 1571
186 Ga0157375_10001469 3300013308 Bacteria 20277
187 Ga0157375_10012441 3300013308 Bacteria 7552
188 Ga0157375_10077826 3300013308 Bacteria 3348
189 Ga0157375_10236315 3300013308 Bacteria 1987
190 Ga0157375_10609096 3300013308 Bacteria 1251
191 Ga0163163_10001717 3300014325 Bacteria 18483
192 Ga0163163_10123416 3300014325 Bacteria 2626
193 Ga0157380_10125028 3300014326 Bacteria 2184
194 Ga0157380_10163239 3300014326 Bacteria 1939
195 Ga0157379_10005101 3300014968 Bacteria 11265
196 Ga0157379_10049358 3300014968 Bacteria 3758
197 Ga0157376_10020430 3300014969 Bacteria 5122
198 Ga0157376_10058812 3300014969 Bacteria 3221
199 Ga0157376_10099734 3300014969 Bacteria 2534
200 Ga0157376_10262592 3300014969 Bacteria 1618
201 Ga0157376_10275456 3300014969 Bacteria 1582
202 Ga0163161_10053796 3300017792 Bacteria 2920
203 Ga0163161_10076748 3300017792 Bacteria 2453
204 Ga0207697_10078930 3300025315 Bacteria 1386
205 Ga0207682_10000061 3300025893 Bacteria 46850
206 Ga0207692_10066078 3300025898 Bacteria 1889
207 Ga0207642_10033075 3300025899 Bacteria 2184
208 Ga0207680_10182606 3300025903 Bacteria 1419
209 Ga0207645_10000143 3300025907 Bacteria 55663
210 Ga0207645_10028244 3300025907 Bacteria 3623
211 Ga0207645_10082923 3300025907 Bacteria 2055
212 Ga0207643_10037392 3300025908 Bacteria 2724
213 Ga0207705_10033325 3300025909 Bacteria 3679
214 Ga0207684_10034891 3300025910 Bacteria 4273
215 Ga0207671_10108807 3300025914 Bacteria 2107
216 Ga0207693_10000166 3300025915 Bacteria 59607
217 Ga0207693_10005572 3300025915 Bacteria 10477
218 Ga0207662_10031814 3300025918 Bacteria 3067
219 Ga0207662_10049128 3300025918 Bacteria 2502
220 Ga0207657_10005203 3300025919 Bacteria 13636
221 Ga0207649_10055723 3300025920 Bacteria 2466
222 Ga0207646_10181770 3300025922 Bacteria 1899
223 Ga0207681_10023225 3300025923 Bacteria 3964
224 Ga0207681_10107509 3300025923 Bacteria 2023
225 Ga0207681_10113560 3300025923 Bacteria 1975
226 Ga0207681_10205834 3300025923 Bacteria 1513
227 Ga0207694_10044246 3300025924 Bacteria 3438
228 Ga0207650_10012440 3300025925 Bacteria 5876
229 Ga0207650_10013380 3300025925 Bacteria 5680
230 Ga0207650_10126194 3300025925 Bacteria 1998
231 Ga0207650_10174879 3300025925 Bacteria 1708
232 Ga0207659_10001702 3300025926 Bacteria 13047
233 Ga0207659_10023083 3300025926 Bacteria 4148
234 Ga0207659_10025832 3300025926 Bacteria 3953
235 Ga0207687_10008292 3300025927 Bacteria 6797
236 Ga0207700_10020792 3300025928 Bacteria 4467
237 Ga0207664_10016866 3300025929 Bacteria 5340
238 Ga0207644_10011874 3300025931 Bacteria 5772
239 Ga0207706_10005391 3300025933 Bacteria 11923
240 Ga0207706_10143571 3300025933 Bacteria 2100
241 Ga0207686_10001057 3300025934 Bacteria 16287
242 Ga0207709_10034386 3300025935 Bacteria 2987
243 Ga0207709_10040185 3300025935 Bacteria 2799
244 Ga0207670_10006439 3300025936 Bacteria 6509
245 Ga0207669_10116171 3300025937 Bacteria 1805
246 Ga0207704_10011017 3300025938 Bacteria 4436
247 Ga0207704_10247790 3300025938 Bacteria 1335
248 Ga0207691_10000016 3300025940 Bacteria 141024
249 Ga0207691_10000111 3300025940 Bacteria 72961
250 Ga0207691_10017615 3300025940 Bacteria 6769
251 Ga0207711_10001025 3300025941 Bacteria 26732
252 Ga0207711_10028760 3300025941 Bacteria 4681
253 Ga0207711_10228309 3300025941 Bacteria 1704
254 Ga0207711_10368959 3300025941 Bacteria 1331
255 Ga0207689_10007636 3300025942 Bacteria 9468
256 Ga0207689_10031626 3300025942 Bacteria 4404
257 Ga0207661_10486626 3300025944 Bacteria 1127
258 Ga0207661_10565616 3300025944 Bacteria 1042
259 Ga0207679_10130566 3300025945 Bacteria 2015
260 Ga0207667_10105323 3300025949 Bacteria 2910
261 Ga0207667_10449141 3300025949 Bacteria 1310
262 Ga0207651_10006574 3300025960 Bacteria 6106
263 Ga0207651_10023308 3300025960 Bacteria 3804
264 Ga0207651_10052116 3300025960 Bacteria 2788
265 Ga0207651_10156326 3300025960 Bacteria 1782
266 Ga0207651_10185398 3300025960 Bacteria 1655
267 Ga0207712_10092167 3300025961 Bacteria 2233
268 Ga0207712_10243049 3300025961 Bacteria 1451
269 Ga0207668_10017446 3300025972 Bacteria 4498
270 Ga0207668_10031331 3300025972 Bacteria 3501
271 Ga0207668_10198906 3300025972 Bacteria 1594
272 Ga0207668_10224212 3300025972 Bacteria 1511
273 Ga0207658_10001061 3300025986 Bacteria 22224
274 Ga0207658_10010311 3300025986 Bacteria 6351
275 Ga0207658_10250818 3300025986 Bacteria 1504
276 Ga0207677_10000157 3300026023 Bacteria 53946
277 Ga0207677_10020109 3300026023 Bacteria 4047
278 Ga0207677_10036054 3300026023 Bacteria 3219
279 Ga0207677_10052923 3300026023 Bacteria 2761
280 Ga0207703_10001001 3300026035 Bacteria 27171
281 Ga0207703_10057192 3300026035 Bacteria 3179
282 Ga0207703_10102529 3300026035 Bacteria 2428
283 Ga0207703_10398551 3300026035 Bacteria 1276
284 Ga0207678_10013650 3300026067 Bacteria 7134
285 Ga0207678_10043834 3300026067 Bacteria 3870
286 Ga0207708_10001313 3300026075 Bacteria 18706
287 Ga0207702_10017328 3300026078 Bacteria 5960
288 Ga0207702_10137083 3300026078 Bacteria 2209
289 Ga0207641_10002130 3300026088 Bacteria 18722
290 Ga0207641_10006316 3300026088 Bacteria 10019
291 Ga0207641_10040010 3300026088 Bacteria 3922
292 Ga0207641_10095445 3300026088 Bacteria 2610
293 Ga0207648_10012005 3300026089 Bacteria 8129
294 Ga0207648_10018543 3300026089 Bacteria 6299
295 Ga0207648_10287483 3300026089 Bacteria 1471
296 Ga0207676_10000219 3300026095 Bacteria 49390
297 Ga0207676_10001696 3300026095 Bacteria 16247
298 Ga0207676_10024048 3300026095 Bacteria 4504
299 Ga0207676_10035317 3300026095 Bacteria 3793
300 Ga0207676_10037920 3300026095 Bacteria 3677
301 Ga0207674_10022227 3300026116 Bacteria 6816
302 Ga0207675_100001330 3300026118 Bacteria 24765
303 Ga0207675_100018589 3300026118 Bacteria 6485
304 Ga0207675_100094739 3300026118 Bacteria 2808
305 Ga0207683_10000126 3300026121 Bacteria 62598
306 Ga0207683_10000322 3300026121 Bacteria 43758
307 Ga0207683_10322090 3300026121 Bacteria 1416
308 Ga0207698_10230673 3300026142 Bacteria 1680
309 Ga0268266_10002422 3300028379 Bacteria 20084
310 Ga0268266_10009993 3300028379 Bacteria 8331
311 Ga0268265_10009357 3300028380 Bacteria 6622
312 Ga0268265_10255138 3300028380 Bacteria 1556
313 Ga0268264_10009818 3300028381 Bacteria 7921
314 Ga0268264_10036646 3300028381 Bacteria 4042
315 Ga0268264_10053695 3300028381 Bacteria 3362
316 Ga0268264_10103623 3300028381 Bacteria 2478
317 Ga0268264_10233423 3300028381 Bacteria 1700
318 Ga0316575_10041086 3300031665 Bacteria 1828
319 Ga0316579_10004247 3300031691 Bacteria 5674
320 Ga0316578_10232833 3300031728 Bacteria 1106
321 Ga0307416_100115052 3300032002 Bacteria 2381
322 Ga0307416_100231135 3300032002 Bacteria 1783
323 Ga0316583_10039655 3300032133 Bacteria 1667
324 Ga0373926_0038354 3300035083 Bacteria 1706
325 Ga0373934_0067904 3300035086 Bacteria 1424
326 Ga0373923_0013522 3300035111 Bacteria 3044
327 Ga0373941_0006744 3300035115 Bacteria 2779
328 Ga0373945_0029700 3300035116 Bacteria 1922
329 Ga0373945_0050794 3300035116 Bacteria 1525
330 Ga0373954_0000094 3300035118 Bacteria 30419
331 Ga0373954_0064009 3300035118 Bacteria 1738
332 Ga0373956_0045253 3300035119 Bacteria 1963
333 Ga0373943_0012445 3300035170 Bacteria 3831
334 Ga0373943_0014836 3300035170 Bacteria 3534
335 Ga0373955_0010842 3300035172 Bacteria 4322
336 Ga0373924_0053662 3300035410 Bacteria 1675
337 Ga0373924_0064972 3300035410 Bacteria 1532
338 Ga0373935_0037139 3300035692 Bacteria 3047
339 Ga0373927_0017045 3300035695 Bacteria 4786
340 Ga0373927_0023889 3300035695 Bacteria 3999
341 Ga0373927_0088964 3300035695 Bacteria 2005
342 Ga0373933_0004184 3300035724 Bacteria 7950
343 Ga0373933_0023202 3300035724 Bacteria 3542
344 Ga0373947_0018668 3300035725 Bacteria 3993
345 Ga0373947_0021245 3300035725 Bacteria 3756
346 Ga0373937_0000449 3300036401 Bacteria 37990
347 Ga0373937_0065787 3300036401 Bacteria 3337
348 Ga0373937_0287124 3300036401 Bacteria 1554
349 Ga0373925_0010567 3300037068 Bacteria 6694
350 Ga0373925_0070000 3300037068 Bacteria 2651
351 Ga0373925_0252613 3300037068 Bacteria 1414
352 Ga0439441_007535 3300042001 Bacteria 1756
353 Ga0451577_0086156 3300042876 Bacteria 2803
354 Ga0466972_0000160 3300044658 Bacteria 54154
355 Ga0466959_0007992 3300045049 Bacteria 7451
356 Ga0495629_0098069 3300046459 Bacteria 2044
357 Ga0495580_0061530 3300046472 Bacteria 2636
358 Ga0495580_0083836 3300046472 Bacteria 2220
359 Ga0495582_0009462 3300046473 Bacteria 5368
360 Ga0495639_0008392 3300046475 Bacteria 4430
361 Ga0495665_0006396 3300046531 Bacteria 6357
362 Ga0495645_0014372 3300046543 Bacteria 5616
363 Ga0495645_0089789 3300046543 Bacteria 2197
364 Ga0495667_0056131 3300046559 Bacteria 2590
365 Ga0495656_0028148 3300046615 Bacteria 2252
366 Ga0495635_0008002 3300046663 Bacteria 7385
367 Ga0495635_0079307 3300046663 Bacteria 2247
368 Ga0495647_0003221 3300046681 Bacteria 5224
369 Ga0495658_0022342 3300046683 Bacteria 3344
370 Ga0495658_0169102 3300046683 Bacteria 1352
371 Ga0495613_0021844 3300046689 Bacteria 4770
372 Ga0495600_0083883 3300046809 Bacteria 2079
373 Ga0495581_0002918 3300047315 Bacteria 9782
374 Ga0495684_0040064 3300047471 Bacteria 3592
375 Ga0495684_0096380 3300047471 Bacteria 2239
376 Ga0495593_0083590 3300047673 Bacteria 1649
377 Ga0495602_0307028 3300048088 Bacteria 1159
378 Ga0496100_0148294 3300048903 Bacteria 1670
379 Ga0496102_0397786 3300048905 Bacteria 1295
380 Ga0496103_0228880 3300048906 Bacteria 1196
381 Ga0496104_0002564 3300048907 Bacteria 15661
382 Ga0496109_0027175 3300048912 Bacteria 5107
383 Ga0496112_0001181 3300048915 Bacteria 19573
384 Ga0496114_0190138 3300048917 Bacteria 1796
385 Ga0496115_0119071 3300048918 Bacteria 2172
386 Ga0496122_0018373 3300048925 Bacteria 6468
387 Ga0496124_0261563 3300048927 Bacteria 1273
388 Ga0501034_0000390 3300049571 Bacteria 74693
389 Ga0501040_0045139 3300049576 Bacteria 3005
390 Ga0501071_0010225 3300049587 Bacteria 6279
391 Ga0501072_0002901 3300049588 Bacteria 12900
392 Ga0501072_0065417 3300049588 Bacteria 2867
393 Ga0501074_0000350 3300049590 Bacteria 27041
394 Ga0501075_0080578 3300049591 Bacteria 2464
395 Ga0501079_0222456 3300049741 Bacteria 1475
396 Ga0501080_0016968 3300049742 Bacteria 6723
397 Ga0501083_0000850 3300049744 Bacteria 20096
398 Ga0501045_0078583 3300049824 Bacteria 2432
399 nmdc:mga08y16_11039_c1 3300050511 Bacteria 9484
400 nmdc:mga0n895_15926_c1 3300050512 Bacteria 6879
401 nmdc:mga0n895_43952_c1 3300050512 Bacteria 4356
402 nmdc:mga0n895_95506_c1 3300050512 Bacteria 2977
403 nmdc:mga0rr50_106767_c1 3300050513 Bacteria 2210
404 nmdc:mga0rr50_5010_c1 3300050513 Bacteria 7846
405 nmdc:mga08x19_116047_c1 3300050514 Bacteria 1790
406 nmdc:mga08x19_151729_c1 3300050514 Bacteria 1569
407 nmdc:mga08x19_202919_c1 3300050514 Bacteria 1359
408 nmdc:mga08x19_42168_c1 3300050514 Bacteria 2908
409 nmdc:mga0a205_38781_c1 3300050515 Bacteria 4584
410 Ga0495601_0011607 3300053077 Bacteria 5278
411 Ga0495619_0036125 3300053085 Bacteria 3216
412 Ga0495619_0048835 3300053085 Bacteria 2789
413 Ga0495619_0444596 3300053085 Bacteria 894
414 Ga0075433_10053964
415 Ga0065707_10180930
416 Ga0070676_10009870
417 Ga0070676_10053250
418 Ga0070683_100053335
419 Ga0070690_100001731
420 Ga0070690_100123247
421 Ga0070670_100007600
422 Ga0070677_10000311
423 Ga0068869_100047392
424 Ga0070666_10003528
425 Ga0070666_10164443
426 Ga0070680_100091908
427 Ga0068868_100004906
428 Ga0068868_100012817
429 Ga0068868_100056461
430 Ga0068868_100195558
431 Ga0070660_100050566
432 Ga0070689_100022029
433 Ga0070687_100033083
434 Ga0070661_100026489
435 Ga0070692_10079674
436 Ga0070668_100005135
437 Ga0070668_100015813
438 Ga0070668_100187185
439 Ga0070669_100010858
440 Ga0070675_100017130
441 Ga0070671_100026398
442 Ga0070671_100127473
443 Ga0070671_100441017
444 Ga0070674_100000539
445 Ga0070674_100046458
446 Ga0070673_100000769
447 Ga0070673_100001790
448 Ga0070673_100016610
449 Ga0070673_100090024
450 Ga0070673_100177189
451 Ga0070673_100298933
452 Ga0070688_100007735
453 Ga0070688_100218866
454 Ga0070667_100013289
455 Ga0070667_100014852
456 Ga0070667_100093262
457 Ga0070667_100150370
458 Ga0070667_100185194
459 Ga0070709_10031538
460 Ga0070713_100036300
461 Ga0070713_100052376
462 Ga0070710_10023182
463 Ga0070710_10048448
464 Ga0070701_10029659
465 Ga0070711_100218695
466 Ga0070705_100004762
467 Ga0070705_100045984
468 Ga0070705_100187018
469 Ga0070700_100004167
470 Ga0070694_100060221
471 Ga0070663_100005315
472 Ga0070678_100001570
473 Ga0070678_100031110
474 Ga0068867_100001532
475 Ga0068867_100007667
476 Ga0070685_10001314
477 Ga0070685_10159897
478 Ga0070706_100023536
479 Ga0070707_100181884
480 Ga0070698_100255616
481 Ga0070698_100421671
482 Ga0070699_100074736
483 Ga0070699_100397277
484 Ga0070679_100063303
485 Ga0070684_100076844
486 Ga0070697_100186460
487 Ga0068853_100011083
488 Ga0068853_100070171
489 Ga0070672_100000794
490 Ga0070672_100005211
491 Ga0070672_100086434
492 Ga0070686_100006024
493 Ga0070686_100011459
494 Ga0070686_100123919
495 Ga0070695_100035449
496 Ga0070695_100050343
497 Ga0070695_100204778
498 Ga0070696_100013942
499 Ga0070696_100217021
500 Ga0070693_100004069
501 Ga0070665_100001532
502 Ga0070665_100014168
503 Ga0070665_100037489
504 Ga0070665_100472247
505 Ga0070665_100530408
506 Ga0070704_100052141
507 Ga0070704_100382205
508 Ga0070704_100443692
509 Ga0068855_100248341
510 Ga0070664_100208374
511 Ga0070664_100281693
512 Ga0068854_100005571
513 Ga0068854_100072046
514 Ga0068854_100301756
515 Ga0068856_100026265
516 Ga0068856_100041295
517 Ga0070702_100010377
518 Ga0070702_100049022
519 Ga0070702_100107748
520 Ga0068852_100031170
521 Ga0068859_100012636
522 Ga0068859_100243039
523 Ga0068864_100000386
524 Ga0068864_100010020
525 Ga0068864_100015375
526 Ga0068864_100039841
527 Ga0068864_100054671
528 Ga0068864_100163993
529 Ga0068864_100370247
530 Ga0068866_10003430
531 Ga0068861_100007257
532 Ga0068861_100029509
533 Ga0068861_100099093
534 Ga0068851_10051907
535 Ga0068863_100000458
536 Ga0068863_100008080
537 Ga0068863_100016305
538 Ga0068863_100052864
539 Ga0068858_100001613
540 Ga0068858_100010871
541 Ga0068858_100077324
542 Ga0068858_100115717
543 Ga0068860_100018013
544 Ga0068860_100036687
545 Ga0068860_100115485
546 Ga0068860_100342902
547 Ga0068860_100352439
548 Ga0068862_100434096
549 Ga0081539_10002623
550 Ga0070712_100003878
551 Ga0097621_100007870
552 Ga0097621_100021582
553 Ga0097621_100027961
554 Ga0097621_100040110
555 Ga0068871_100002870
556 Ga0068871_100010298
557 Ga0068871_100017141
558 Ga0068871_100027613
559 Ga0068871_100065705
560 Ga0075434_100014140
561 Ga0075434_100213406
562 Ga0068865_100007546
563 Ga0068865_100045177
564 Ga0068865_100173179
565 Ga0075436_100032037
566 Ga0075436_100052399
567 Ga0097620_100012636
568 Ga0097620_100243037
569 Ga0097620_100395539
570 Ga0075435_100004886
571 Ga0075435_100012279
572 Ga0075435_100061731
573 Ga0099794_10045255
574 Ga0105240_10238662
575 Ga0105245_10003221
576 Ga0105245_10023811
577 Ga0105245_10091303
578 Ga0105243_10077320
579 Ga0105243_10102190
580 Ga0105243_10188831
581 Ga0105243_10332643
582 Ga0105241_10066519
583 Ga0105242_10003433
584 Ga0105248_10035415
585 Ga0105248_10174704
586 Ga0105248_10505271
587 Ga0105248_10679974
588 Ga0105238_10147134
589 Ga0105249_10067930
590 Ga0105239_10091066
591 Ga0157370_10305021
592 Ga0157374_10000534
593 Ga0157378_10101442
594 Ga0157378_10206848
595 Ga0163162_10026988
596 Ga0163162_10230258
597 Ga0163162_10422348
598 Ga0157372_10414020
599 Ga0157375_10001469
600 Ga0157375_10012441
601 Ga0157375_10077826
602 Ga0157375_10236315
603 Ga0157375_10609096
604 Ga0163163_10001717
605 Ga0163163_10123416
606 Ga0157380_10125028
607 Ga0157380_10163239
608 Ga0157379_10005101
609 Ga0157379_10049358
610 Ga0157376_10020430
611 Ga0157376_10058812
612 Ga0157376_10099734
613 Ga0157376_10262592
614 Ga0157376_10275456
615 Ga0163161_10053796
616 Ga0163161_10076748
617 Ga0207697_10078930
618 Ga0207682_10000061
619 Ga0207692_10066078
620 Ga0207642_10033075
621 Ga0207680_10182606
622 Ga0207645_10000143
623 Ga0207645_10028244
624 Ga0207645_10082923
625 Ga0207643_10037392
626 Ga0207705_10033325
627 Ga0207684_10034891
628 Ga0207671_10108807
629 Ga0207693_10000166
630 Ga0207693_10005572
631 Ga0207662_10031814
632 Ga0207662_10049128
633 Ga0207657_10005203
634 Ga0207649_10055723
635 Ga0207646_10181770
636 Ga0207681_10023225
637 Ga0207681_10107509
638 Ga0207681_10113560
639 Ga0207681_10205834
640 Ga0207694_10044246
641 Ga0207650_10012440
642 Ga0207650_10013380
643 Ga0207650_10126194
644 Ga0207650_10174879
645 Ga0207659_10001702
646 Ga0207659_10023083
647 Ga0207659_10025832
648 Ga0207687_10008292
649 Ga0207700_10020792
650 Ga0207664_10016866
651 Ga0207644_10011874
652 Ga0207706_10005391
653 Ga0207706_10143571
654 Ga0207686_10001057
655 Ga0207709_10034386
656 Ga0207709_10040185
657 Ga0207670_10006439
658 Ga0207669_10116171
659 Ga0207704_10011017
660 Ga0207704_10247790
661 Ga0207691_10000016
662 Ga0207691_10000111
663 Ga0207691_10017615
664 Ga0207711_10001025
665 Ga0207711_10028760
666 Ga0207711_10228309
667 Ga0207711_10368959
668 Ga0207689_10007636
669 Ga0207689_10031626
670 Ga0207661_10486626
671 Ga0207661_10565616
672 Ga0207679_10130566
673 Ga0207667_10105323
674 Ga0207667_10449141
675 Ga0207651_10006574
676 Ga0207651_10023308
677 Ga0207651_10052116
678 Ga0207651_10156326
679 Ga0207651_10185398
680 Ga0207712_10092167
681 Ga0207712_10243049
682 Ga0207668_10017446
683 Ga0207668_10031331
684 Ga0207668_10198906
685 Ga0207668_10224212
686 Ga0207658_10001061
687 Ga0207658_10010311
688 Ga0207658_10250818
689 Ga0207677_10000157
690 Ga0207677_10020109
691 Ga0207677_10036054
692 Ga0207677_10052923
693 Ga0207703_10001001
694 Ga0207703_10057192
695 Ga0207703_10102529
696 Ga0207703_10398551
697 Ga0207678_10013650
698 Ga0207678_10043834
699 Ga0207708_10001313
700 Ga0207702_10017328
701 Ga0207702_10137083
702 Ga0207641_10002130
703 Ga0207641_10006316
704 Ga0207641_10040010
705 Ga0207641_10095445
706 Ga0207648_10012005
707 Ga0207648_10018543
708 Ga0207648_10287483
709 Ga0207676_10000219
710 Ga0207676_10001696
711 Ga0207676_10024048
712 Ga0207676_10035317
713 Ga0207676_10037920
714 Ga0207674_10022227
715 Ga0207675_100001330
716 Ga0207675_100018589
717 Ga0207675_100094739
718 Ga0207683_10000126
719 Ga0207683_10000322
720 Ga0207683_10322090
721 Ga0207698_10230673
722 Ga0268266_10002422
723 Ga0268266_10009993
724 Ga0268265_10009357
725 Ga0268265_10255138
726 Ga0268264_10009818
727 Ga0268264_10036646
728 Ga0268264_10053695
729 Ga0268264_10103623
730 Ga0268264_10233423
731 Ga0316575_10041086
732 Ga0316579_10004247
733 Ga0316578_10232833
734 Ga0307416_100115052
735 Ga0307416_100231135
736 Ga0316583_10039655
737 Ga0373926_0038354
738 Ga0373934_0067904
739 Ga0373923_0013522
740 Ga0373941_0006744
741 Ga0373945_0029700
742 Ga0373945_0050794
743 Ga0373954_0000094
744 Ga0373954_0064009
745 Ga0373956_0045253
746 Ga0373943_0012445
747 Ga0373943_0014836
748 Ga0373955_0010842
749 Ga0373924_0053662
750 Ga0373924_0064972
751 Ga0373935_0037139
752 Ga0373927_0017045
753 Ga0373927_0023889
754 Ga0373927_0088964
755 Ga0373933_0004184
756 Ga0373933_0023202
757 Ga0373947_0018668
758 Ga0373947_0021245
759 Ga0373937_0000449
760 Ga0373937_0065787
761 Ga0373937_0287124
762 Ga0373925_0010567
763 Ga0373925_0070000
764 Ga0373925_0252613
765 Ga0439441_007535
766 Ga0451577_0086156
767 Ga0466972_0000160
768 Ga0466959_0007992
769 Ga0495629_0098069
770 Ga0495580_0061530
771 Ga0495580_0083836
772 Ga0495582_0009462
773 Ga0495639_0008392
774 Ga0495665_0006396
775 Ga0495645_0014372
776 Ga0495645_0089789
777 Ga0495667_0056131
778 Ga0495656_0028148
779 Ga0495635_0008002
780 Ga0495635_0079307
781 Ga0495647_0003221
782 Ga0495658_0022342
783 Ga0495658_0169102
784 Ga0495613_0021844
785 Ga0495600_0083883
786 Ga0495581_0002918
787 Ga0495684_0040064
788 Ga0495684_0096380
789 Ga0495593_0083590
790 Ga0495602_0307028
791 Ga0496100_0148294
792 Ga0496102_0397786
793 Ga0496103_0228880
794 Ga0496104_0002564
795 Ga0496109_0027175
796 Ga0496112_0001181
797 Ga0496114_0190138
798 Ga0496115_0119071
799 Ga0496122_0018373
800 Ga0496124_0261563
801 Ga0501034_0000390
802 Ga0501040_0045139
803 Ga0501071_0010225
804 Ga0501072_0002901
805 Ga0501072_0065417
806 Ga0501074_0000350
807 Ga0501075_0080578
808 Ga0501079_0222456
809 Ga0501080_0016968
810 Ga0501083_0000850
811 Ga0501045_0078583
812 nmdc:mga08y16_11039_c1
813 nmdc:mga0n895_15926_c1
814 nmdc:mga0n895_43952_c1
815 nmdc:mga0n895_95506_c1
816 nmdc:mga0rr50_106767_c1
817 nmdc:mga0rr50_5010_c1
818 nmdc:mga08x19_116047_c1
819 nmdc:mga08x19_151729_c1
820 nmdc:mga08x19_202919_c1
821 nmdc:mga08x19_42168_c1
822 nmdc:mga0a205_38781_c1
823 Ga0495601_0011607
824 Ga0495619_0036125
825 Ga0495619_0048835
826 Ga0495619_0444596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

4

110

0.96

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

154

287

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

187

326

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b7x-assembly5.cif.gz_I crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9814 110 327
4b7x-assembly1.cif.gz_H crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9751 2 331
4b7x-assembly2.cif.gz_C crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9738 4 331
4b7c-assembly1.cif.gz_B crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9732 2 331
4b7x-assembly1.cif.gz_H crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9722 2 331
ID Description Score Start End Superfamily
4b7xB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9826 126 300 3.40.50.720
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9793 127 230 3.90.180.10
af_Q54LY2_135_306_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9774 130 299 3.40.50.720
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9748 9 230 3.40.50.2300
af_C0PGX3_170_327_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 153 307 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D2GQ20-F1-model_v4 NADP-dependent oxidoreductase 0.9856 39 332 GO:0016628
AF-A0A2P5KA35-F1-model_v4 Zinc-binding dehydrogenase 0.985 166 332 GO:0016628
AF-A0A1I4CQL0-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9849 2 332 GO:0016628
AF-A0A2N1YSZ3-F1-model_v4 deleted 0.9841 2 332
AF-A0A368EAL7-F1-model_v4 NADP-dependent oxidoreductase 0.9837 1 332 GO:0016628

Map