F437987

General Info

Members Datasets Scaffolds Average Seq Length
413 175 826 346

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100078732|Ga0070675_1000787323
Length 394
Sequence VRGLLEISNHPSDGNLFDLGNDVDGSERGERTISYGPSRTSERLATKGGHVTDIDRRTVLAGLASGLFFYGPRLEGRAQTSAARPHRIDVHHHFAPPAWVTAVRGRPLLQPANTTWTPEKSIDDMDRGGVALSLVSITNPGLWFGDAPMTRQLARACNEYGARLVHDHPTRFGVFAAMPLPDVDATLAEIAYAYDTLKVDGVGLFTSYGDKWLGHPSFRPVMEELNRRKAVVHVHPTAANCCRNLDYAPGVAPGSIEYGTDTTRAIMGVAFSGDAAKFPDVRFIWSHAGGSAPFLAARIEGASANAKDRLPNGFMAEIRKFYYDLAGASNRGAVASLLELVKSSQILFGTDFPPGGSATDYVKALSEMTLLNKNDLKAIDRDNAVRLIPRLAKT

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 2.42
Rhizosphere 96.85
Stem 0
Stem Tuber 0
Unclassified 15.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100078732 3300005354 Bacteria 2745
2 JGI24746J21847_1009946 3300001977 Unclassified 1413
3 Ga0065712_10004096 3300005290 Bacteria 4357
4 Ga0065712_10071066 3300005290 Bacteria 5508
5 Ga0065712_10132014 3300005290 Unclassified 1533
6 Ga0065715_10015778 3300005293 Bacteria 3503
7 Ga0065715_10118072 3300005293 Unclassified 2328
8 Ga0065707_10000906 3300005295 Bacteria 35720
9 Ga0070676_10009638 3300005328 Bacteria 5221
10 Ga0070676_10055833 3300005328 Bacteria 2332
11 Ga0070690_100099025 3300005330 Unclassified 1930
12 Ga0070670_100044571 3300005331 Bacteria 3814
13 Ga0070677_10006598 3300005333 Bacteria 3856
14 Ga0070677_10021405 3300005333 Bacteria 2372
15 Ga0068869_100019838 3300005334 Bacteria 4602
16 Ga0070680_100225868 3300005336 Bacteria 1581
17 Ga0068868_100030094 3300005338 Bacteria 4162
18 Ga0068868_100294942 3300005338 Bacteria 1376
19 Ga0070689_100062842 3300005340 Bacteria 2890
20 Ga0070689_100107757 3300005340 Bacteria 2212
21 Ga0070661_100085115 3300005344 Bacteria 2336
22 Ga0070661_100112112 3300005344 Bacteria 2038
23 Ga0070668_100014867 3300005347 Bacteria 5818
24 Ga0070669_100002449 3300005353 Bacteria 13430
25 Ga0070669_100008836 3300005353 Bacteria 7190
26 Ga0070669_100018770 3300005353 Bacteria 4943
27 Ga0070669_100150882 3300005353 Bacteria 1799
28 Ga0070675_100036660 3300005354 Bacteria 3992
29 Ga0070675_100085382 3300005354 Bacteria 2637
30 Ga0070675_100100998 3300005354 Bacteria 2430
31 Ga0070675_100124283 3300005354 Unclassified 2194
32 Ga0070675_100185525 3300005354 Unclassified 1800
33 Ga0070675_100203263 3300005354 Unclassified 1720
34 Ga0070671_100008541 3300005355 Bacteria 8210
35 Ga0070671_100009176 3300005355 Bacteria 7941
36 Ga0070671_100217727 3300005355 Bacteria 1620
37 Ga0070674_100007785 3300005356 Bacteria 6333
38 Ga0070674_100019093 3300005356 Bacteria 4349
39 Ga0070674_100099372 3300005356 Bacteria 2117
40 Ga0070673_100005652 3300005364 Bacteria 8032
41 Ga0070673_100016567 3300005364 Bacteria 5216
42 Ga0070673_100024138 3300005364 Bacteria 4453
43 Ga0070673_100040644 3300005364 Bacteria 3569
44 Ga0070673_100080600 3300005364 Bacteria 2638
45 Ga0070673_100136946 3300005364 Bacteria 2062
46 Ga0070688_100132115 3300005365 Unclassified 1686
47 Ga0070688_100135104 3300005365 Bacteria 1669
48 Ga0070659_100334383 3300005366 Unclassified 1268
49 Ga0070667_100001111 3300005367 Bacteria 24543
50 Ga0070667_100037373 3300005367 Bacteria 4070
51 Ga0070667_100356983 3300005367 Bacteria 1324
52 Ga0070709_10015553 3300005434 Bacteria 4332
53 Ga0070714_100065911 3300005435 Bacteria 3120
54 Ga0070701_10034663 3300005438 Bacteria 2530
55 Ga0070705_100035798 3300005440 Bacteria 2786
56 Ga0070700_100066597 3300005441 Bacteria 2286
57 Ga0070700_100141483 3300005441 Bacteria 1636
58 Ga0070700_100154339 3300005441 Bacteria 1573
59 Ga0070694_100035121 3300005444 Bacteria 3311
60 Ga0070694_100236237 3300005444 Unclassified 1377
61 Ga0070678_100003477 3300005456 Bacteria 8778
62 Ga0070678_100142491 3300005456 Bacteria 1920
63 Ga0070678_100221004 3300005456 Bacteria 1574
64 Ga0070662_100039022 3300005457 Bacteria 3376
65 Ga0068867_100014749 3300005459 Bacteria 5538
66 Ga0068867_100119373 3300005459 Bacteria 2036
67 Ga0070685_10118418 3300005466 Unclassified 1641
68 Ga0070707_100213637 3300005468 Bacteria 1880
69 Ga0070707_100370302 3300005468 Bacteria 1392
70 Ga0070698_100026431 3300005471 Bacteria 6042
71 Ga0070698_100107326 3300005471 Bacteria 2760
72 Ga0070697_100032903 3300005536 Bacteria 4174
73 Ga0070672_100029865 3300005543 Bacteria 4091
74 Ga0070672_100030940 3300005543 Bacteria 4026
75 Ga0070672_100060235 3300005543 Bacteria 2989
76 Ga0070672_100151961 3300005543 Bacteria 1916
77 Ga0070686_100095560 3300005544 Bacteria 1997
78 Ga0070686_100173536 3300005544 Bacteria 1527
79 Ga0070695_100207360 3300005545 Bacteria 1405
80 Ga0070696_100053259 3300005546 Bacteria 2816
81 Ga0070696_100155499 3300005546 Bacteria 1681
82 Ga0070665_100020412 3300005548 Bacteria 6655
83 Ga0070704_100250041 3300005549 Unclassified 1455
84 Ga0070704_100455891 3300005549 Unclassified 1102
85 Ga0070664_100005998 3300005564 Bacteria 9823
86 Ga0070664_100007088 3300005564 Bacteria 9044
87 Ga0068854_100004621 3300005578 Bacteria 8685
88 Ga0068854_100047278 3300005578 Bacteria 3066
89 Ga0068854_100323024 3300005578 Bacteria 1255
90 Ga0070702_100004659 3300005615 Bacteria 6288
91 Ga0070702_100065594 3300005615 Bacteria 2127
92 Ga0068859_100129935 3300005617 Bacteria 2590
93 Ga0068859_100134559 3300005617 Unclassified 2544
94 Ga0068859_100167113 3300005617 Bacteria 2280
95 Ga0068859_100270459 3300005617 Bacteria 1791
96 Ga0068859_100379048 3300005617 Bacteria 1510
97 Ga0068859_100598325 3300005617 Bacteria 1196
98 Ga0068866_10012151 3300005718 Bacteria 3748
99 Ga0068861_100007306 3300005719 Bacteria 7569
100 Ga0068861_100007846 3300005719 Bacteria 7341
101 Ga0068861_100018833 3300005719 Bacteria 4922
102 Ga0068861_100116748 3300005719 Bacteria 2146
103 Ga0068861_100150787 3300005719 Bacteria 1907
104 Ga0068870_10001125 3300005840 Bacteria 10667
105 Ga0068863_100012883 3300005841 Bacteria 8064
106 Ga0068863_100159183 3300005841 Bacteria 2163
107 Ga0068858_100005842 3300005842 Bacteria 12022
108 Ga0068858_100019331 3300005842 Bacteria 6370
109 Ga0068858_100030641 3300005842 Bacteria 4995
110 Ga0068858_100049880 3300005842 Bacteria 3875
111 Ga0068860_100013169 3300005843 Bacteria 8116
112 Ga0068860_100031965 3300005843 Bacteria 5060
113 Ga0068860_100065177 3300005843 Bacteria 3460
114 Ga0068860_100126485 3300005843 Bacteria 2450
115 Ga0068860_100191264 3300005843 Bacteria 1980
116 Ga0068860_100257702 3300005843 Bacteria 1700
117 Ga0068862_100007993 3300005844 Bacteria 8751
118 Ga0068862_100170762 3300005844 Unclassified 1947
119 Ga0075432_10007994 3300006058 Unclassified 3608
120 Ga0097621_100008977 3300006237 Bacteria 7231
121 Ga0068871_100012290 3300006358 Bacteria 6307
122 Ga0068871_100114348 3300006358 Bacteria 2273
123 Ga0068871_100157293 3300006358 Unclassified 1942
124 Ga0075428_100000010 3300006844 Bacteria 213631
125 Ga0075428_100450406 3300006844 Bacteria 1379
126 Ga0075430_100003568 3300006846 Bacteria 13039
127 Ga0075431_100017648 3300006847 Bacteria 7256
128 Ga0075431_100088408 3300006847 Unclassified 3197
129 Ga0075431_100174753 3300006847 Unclassified 2206
130 Ga0075433_10002959 3300006852 Bacteria 13041
131 Ga0075433_10005616 3300006852 Bacteria 9859
132 Ga0075433_10015200 3300006852 Bacteria 6308
133 Ga0075434_100008263 3300006871 Bacteria 9667
134 Ga0075434_100010218 3300006871 Bacteria 8791
135 Ga0075434_100430180 3300006871 Unclassified 1341
136 Ga0075429_100018356 3300006880 Bacteria 6058
137 Ga0068865_100008969 3300006881 Bacteria 6189
138 Ga0068865_100041534 3300006881 Bacteria 3130
139 Ga0068865_100090078 3300006881 Bacteria 2223
140 Ga0068865_100203295 3300006881 Bacteria 1539
141 Ga0075436_100002423 3300006914 Bacteria 12858
142 Ga0097620_100129935 3300006931 Bacteria 2590
143 Ga0097620_100134557 3300006931 Unclassified 2544
144 Ga0097620_100167111 3300006931 Bacteria 2280
145 Ga0097620_100270467 3300006931 Bacteria 1791
146 Ga0097620_100379017 3300006931 Bacteria 1510
147 Ga0097620_100598242 3300006931 Bacteria 1196
148 Ga0075435_100000051 3300007076 Bacteria 59038
149 Ga0075435_100006302 3300007076 Bacteria 8379
150 Ga0075435_100093881 3300007076 Bacteria 2479
151 Ga0111539_10000001 3300009094 Bacteria 1035431
152 Ga0111539_10006826 3300009094 Bacteria 14678
153 Ga0111539_10006996 3300009094 Bacteria 14470
154 Ga0111539_10012720 3300009094 Bacteria 10540
155 Ga0111539_10026937 3300009094 Bacteria 7022
156 Ga0111539_10027956 3300009094 Bacteria 6887
157 Ga0111539_10077012 3300009094 Bacteria 3926
158 Ga0111539_10095444 3300009094 Bacteria 3493
159 Ga0111539_10239107 3300009094 Bacteria 2114
160 Ga0111539_10288142 3300009094 Viruses 1911
161 Ga0111539_10349292 3300009094 Unclassified 1721
162 Ga0105245_10325583 3300009098 Bacteria 1515
163 Ga0105245_10372787 3300009098 Bacteria 1419
164 Ga0105247_10142335 3300009101 Bacteria 1573
165 Ga0114129_10005134 3300009147 Bacteria 18429
166 Ga0114129_10012603 3300009147 Bacteria 12037
167 Ga0114129_10016056 3300009147 Bacteria 10651
168 Ga0114129_10016482 3300009147 Bacteria 10518
169 Ga0114129_10174916 3300009147 Bacteria 2924
170 Ga0105243_10010517 3300009148 Bacteria 7025
171 Ga0105241_10025773 3300009174 Bacteria 4371
172 Ga0105242_10012036 3300009176 Bacteria 6659
173 Ga0105242_10114026 3300009176 Bacteria 2309
174 Ga0105248_10011934 3300009177 Bacteria 9583
175 Ga0105248_10017857 3300009177 Bacteria 7829
176 Ga0105248_10070437 3300009177 Bacteria 3927
177 Ga0105248_10172122 3300009177 Bacteria 2441
178 Ga0105248_10238395 3300009177 Bacteria 2048
179 Ga0105248_10301701 3300009177 Unclassified 1804
180 Ga0105238_10014276 3300009551 Bacteria 8028
181 Ga0105249_10310314 3300009553 Bacteria 1585
182 Ga0163162_10006792 3300013306 Bacteria 11100
183 Ga0163162_10117792 3300013306 Unclassified 2758
184 Ga0157375_10008338 3300013308 Bacteria 9077
185 Ga0157375_10106938 3300013308 Unclassified 2890
186 Ga0163163_10001162 3300014325 Bacteria 22395
187 Ga0163163_10469814 3300014325 Bacteria 1318
188 Ga0157380_10001150 3300014326 Bacteria 17085
189 Ga0157380_10003729 3300014326 Bacteria 10482
190 Ga0157380_10007303 3300014326 Bacteria 7843
191 Ga0157380_10066115 3300014326 Bacteria 2907
192 Ga0157380_10259106 3300014326 Bacteria 1579
193 Ga0157380_10262959 3300014326 Bacteria 1568
194 Ga0157377_10001921 3300014745 Bacteria 9096
195 Ga0157377_10008368 3300014745 Bacteria 5043
196 Ga0157377_10164271 3300014745 Bacteria 1383
197 Ga0157379_10036316 3300014968 Unclassified 4394
198 Ga0157379_10090672 3300014968 Bacteria 2742
199 Ga0157376_10129299 3300014969 Bacteria 2251
200 Ga0163161_10158810 3300017792 Bacteria 1723
201 Ga0213876_10023736 3300021384 Bacteria 3237
202 Ga0207697_10003717 3300025315 Bacteria 7468
203 Ga0207682_10000612 3300025893 Bacteria 16611
204 Ga0207682_10006704 3300025893 Unclassified 4624
205 Ga0207682_10036023 3300025893 Bacteria 2001
206 Ga0207688_10000544 3300025901 Bacteria 18348
207 Ga0207688_10052691 3300025901 Unclassified 2281
208 Ga0207680_10008873 3300025903 Bacteria 4957
209 Ga0207680_10181632 3300025903 Unclassified 1423
210 Ga0207699_10020965 3300025906 Bacteria 3513
211 Ga0207645_10005333 3300025907 Bacteria 9346
212 Ga0207645_10040845 3300025907 Bacteria 2971
213 Ga0207645_10049298 3300025907 Bacteria 2689
214 Ga0207645_10189893 3300025907 Unclassified 1350
215 Ga0207643_10000450 3300025908 Bacteria 26721
216 Ga0207643_10028246 3300025908 Bacteria 3114
217 Ga0207643_10033392 3300025908 Bacteria 2879
218 Ga0207662_10045298 3300025918 Bacteria 2600
219 Ga0207662_10095445 3300025918 Unclassified 1835
220 Ga0207649_10097462 3300025920 Bacteria 1939
221 Ga0207646_10286236 3300025922 Bacteria 1489
222 Ga0207681_10011515 3300025923 Bacteria 5433
223 Ga0207681_10016018 3300025923 Bacteria 4682
224 Ga0207681_10028379 3300025923 Bacteria 3624
225 Ga0207681_10037875 3300025923 Bacteria 3191
226 Ga0207681_10057016 3300025923 Bacteria 2667
227 Ga0207650_10032990 3300025925 Bacteria 3748
228 Ga0207650_10105635 3300025925 Unclassified 2174
229 Ga0207650_10173483 3300025925 Unclassified 1715
230 Ga0207659_10010250 3300025926 Bacteria 5881
231 Ga0207659_10020797 3300025926 Bacteria 4344
232 Ga0207659_10033958 3300025926 Bacteria 3515
233 Ga0207659_10092574 3300025926 Unclassified 2260
234 Ga0207659_10093558 3300025926 Bacteria 2250
235 Ga0207659_10121146 3300025926 Unclassified 2005
236 Ga0207659_10143166 3300025926 Unclassified 1858
237 Ga0207700_10076889 3300025928 Bacteria 2592
238 Ga0207664_10114445 3300025929 Bacteria 2248
239 Ga0207644_10037948 3300025931 Bacteria 3391
240 Ga0207644_10039956 3300025931 Bacteria 3313
241 Ga0207706_10008269 3300025933 Bacteria 9601
242 Ga0207706_10092922 3300025933 Bacteria 2653
243 Ga0207706_10162294 3300025933 Bacteria 1964
244 Ga0207706_10233376 3300025933 Unclassified 1609
245 Ga0207686_10030317 3300025934 Bacteria 3200
246 Ga0207686_10083195 3300025934 Bacteria 2094
247 Ga0207709_10007799 3300025935 Bacteria 5935
248 Ga0207670_10043037 3300025936 Bacteria 2980
249 Ga0207670_10080936 3300025936 Bacteria 2272
250 Ga0207670_10161192 3300025936 Bacteria 1674
251 Ga0207670_10261357 3300025936 Bacteria 1342
252 Ga0207670_10322962 3300025936 Unclassified 1215
253 Ga0207669_10010986 3300025937 Bacteria 4385
254 Ga0207704_10031348 3300025938 Bacteria 2993
255 Ga0207704_10170243 3300025938 Bacteria 1561
256 Ga0207691_10007325 3300025940 Bacteria 10643
257 Ga0207691_10019192 3300025940 Bacteria 6473
258 Ga0207691_10037038 3300025940 Bacteria 4518
259 Ga0207691_10055728 3300025940 Bacteria 3602
260 Ga0207691_10077975 3300025940 Bacteria 2983
261 Ga0207691_10152231 3300025940 Bacteria 2033
262 Ga0207711_10009194 3300025941 Bacteria 8255
263 Ga0207711_10009762 3300025941 Bacteria 7985
264 Ga0207711_10124127 3300025941 Bacteria 2308
265 Ga0207711_10152007 3300025941 Unclassified 2089
266 Ga0207711_10188107 3300025941 Unclassified 1881
267 Ga0207689_10001850 3300025942 Bacteria 20023
268 Ga0207689_10004538 3300025942 Bacteria 12567
269 Ga0207689_10076286 3300025942 Unclassified 2756
270 Ga0207689_10086039 3300025942 Unclassified 2583
271 Ga0207679_10014671 3300025945 Bacteria 5158
272 Ga0207679_10099080 3300025945 Bacteria 2275
273 Ga0207651_10043947 3300025960 Unclassified 2986
274 Ga0207651_10050737 3300025960 Bacteria 2819
275 Ga0207651_10099691 3300025960 Bacteria 2152
276 Ga0207651_10175572 3300025960 Bacteria 1694
277 Ga0207712_10004928 3300025961 Bacteria 8438
278 Ga0207712_10294914 3300025961 Unclassified 1329
279 Ga0207668_10057831 3300025972 Bacteria 2707
280 Ga0207640_10004709 3300025981 Bacteria 7409
281 Ga0207640_10039065 3300025981 Bacteria 3001
282 Ga0207640_10140601 3300025981 Bacteria 1759
283 Ga0207658_10003584 3300025986 Bacteria 10965
284 Ga0207658_10251368 3300025986 Bacteria 1502
285 Ga0207703_10111368 3300026035 Bacteria 2336
286 Ga0207703_10259334 3300026035 Bacteria 1571
287 Ga0207678_10055307 3300026067 Bacteria 3419
288 Ga0207678_10124741 3300026067 Unclassified 2197
289 Ga0207708_10016789 3300026075 Bacteria 5510
290 Ga0207708_10054299 3300026075 Unclassified 3054
291 Ga0207708_10063732 3300026075 Unclassified 2816
292 Ga0207708_10086865 3300026075 Bacteria 2407
293 Ga0207641_10005952 3300026088 Bacteria 10336
294 Ga0207641_10263331 3300026088 Bacteria 1615
295 Ga0207648_10000587 3300026089 Bacteria 40789
296 Ga0207648_10011991 3300026089 Bacteria 8135
297 Ga0207648_10074851 3300026089 Bacteria 2952
298 Ga0207648_10083494 3300026089 Unclassified 2786
299 Ga0207648_10088971 3300026089 Bacteria 2696
300 Ga0207676_10027281 3300026095 Bacteria 4253
301 Ga0207674_10152920 3300026116 Unclassified 2264
302 Ga0207675_100005152 3300026118 Bacteria 12589
303 Ga0207675_100007972 3300026118 Bacteria 9987
304 Ga0207675_100018088 3300026118 Bacteria 6571
305 Ga0207675_100044003 3300026118 Bacteria 4170
306 Ga0207675_100101807 3300026118 Unclassified 2706
307 Ga0207683_10007274 3300026121 Bacteria 9487
308 Ga0207683_10011349 3300026121 Bacteria 7602
309 Ga0207683_10028920 3300026121 Bacteria 4796
310 Ga0207428_10000002 3300027907 Bacteria 854851
311 Ga0207428_10004546 3300027907 Bacteria 13153
312 Ga0207428_10005192 3300027907 Bacteria 12179
313 Ga0207428_10010042 3300027907 Bacteria 8472
314 Ga0207428_10012794 3300027907 Bacteria 7360
315 Ga0207428_10072623 3300027907 Bacteria 2700
316 Ga0207428_10109367 3300027907 Bacteria 2128
317 Ga0207428_10223401 3300027907 Bacteria 1411
318 Ga0268265_10114163 3300028380 Bacteria 2211
319 Ga0268265_10185994 3300028380 Unclassified 1789
320 Ga0268264_10044165 3300028381 Bacteria 3696
321 Ga0268264_10096586 3300028381 Bacteria 2560
322 Ga0268264_10106076 3300028381 Bacteria 2452
323 Ga0268264_10232816 3300028381 Bacteria 1702
324 Ga0268264_10477171 3300028381 Bacteria 1212
325 Ga0265338_10019135 3300028800 Bacteria 7287
326 Ga0265760_10007227 3300031090 Bacteria 3181
327 Ga0265325_10027288 3300031241 Bacteria 3086
328 Ga0265339_10000077 3300031249 Bacteria 84288
329 Ga0265313_10002022 3300031595 Bacteria 18190
330 Ga0373959_0018650 3300034820 Bacteria 1307
331 Ga0373934_0122866 3300035086 Unclassified 1056
332 Ga0373951_0001996 3300035091 Bacteria 5223
333 Ga0373952_0014584 3300035092 Bacteria 1575
334 Ga0373939_0000138 3300035114 Bacteria 20969
335 Ga0373941_0000086 3300035115 Bacteria 15129
336 Ga0373945_0052217 3300035116 Unclassified 1506
337 Ga0373942_0001119 3300035207 Bacteria 7120
338 Ga0373931_0002913 3300035691 Bacteria 7634
339 Ga0373935_0219990 3300035692 Unclassified 1319
340 Ga0373935_0222364 3300035692 Bacteria 1312
341 Ga0373947_0043570 3300035725 Bacteria 2681
342 Ga0373937_0102438 3300036401 Bacteria 2658
343 Ga0373937_0307533 3300036401 Bacteria 1499
344 Ga0373925_0105114 3300037068 Unclassified 2175
345 Ga0373925_0348975 3300037068 Bacteria 1201
346 Ga0436365_0075922 3300039437 Bacteria 8900
347 Ga0451800_0432438 3300041459 Bacteria 1407
348 Ga0466957_0136256 3300044842 Bacteria 1578
349 Ga0466959_0051535 3300045049 Bacteria 3018
350 Ga0451576_0010342 3300045051 Bacteria 10713
351 Ga0495603_0286590 3300046455 Bacteria 946
352 Ga0495629_0302837 3300046459 Bacteria 1094
353 Ga0495618_0285296 3300046514 Bacteria 1029
354 Ga0495628_0389925 3300046516 Bacteria 1019
355 Ga0495586_0107758 3300046535 Unclassified 1550
356 Ga0495621_0075891 3300046539 Bacteria 1246
357 Ga0495656_0013621 3300046615 Bacteria 3030
358 Ga0495656_0034559 3300046615 Unclassified 2071
359 Ga0495634_0076419 3300046642 Bacteria 2198
360 Ga0495581_0183820 3300047315 Unclassified 1223
361 Ga0496104_0170476 3300048907 Bacteria 2087
362 Ga0496106_0183841 3300048909 Bacteria 1660
363 Ga0496106_0234394 3300048909 Unclassified 1466
364 Ga0496108_0121719 3300048911 Bacteria 2239
365 Ga0496109_0420013 3300048912 Unclassified 1263
366 Ga0496109_0469751 3300048912 Bacteria 1188
367 Ga0496113_0186758 3300048916 Unclassified 1644
368 Ga0496114_0061672 3300048917 Bacteria 3137
369 Ga0496114_0198501 3300048917 Bacteria 1757
370 nmdc:mga05p37_130790_c1 3300050507 Bacteria 3080
371 nmdc:mga05p37_147673_c1 3300050507 Bacteria 2878
372 nmdc:mga05p37_19261_c1 3300050507 Bacteria 8254
373 nmdc:mga05p37_2403_c1 3300050507 Bacteria 21790
374 nmdc:mga05p37_24040_c1 3300050507 Bacteria 7401
375 nmdc:mga05p37_33283_c1 3300050507 Bacteria 5490
376 nmdc:mga05p37_6100_c1 3300050507 Bacteria 14194
377 nmdc:mga05p37_87303_c1 3300050507 Bacteria 3844
378 nmdc:mga09592_10502_c1 3300050508 Bacteria 7533
379 nmdc:mga09592_193896_c1 3300050508 Bacteria 1759
380 nmdc:mga0qj67_211348_c1 3300050509 Unclassified 1576
381 nmdc:mga0qj67_41075_c1 3300050509 Unclassified 3637
382 nmdc:mga06r32_6729_c1 3300050510 Bacteria 10327
383 nmdc:mga06r32_73194_c1 3300050510 Bacteria 3319
384 nmdc:mga08y16_131460_c1 3300050511 Bacteria 2603
385 nmdc:mga08y16_139052_c1 3300050511 Bacteria 2525
386 nmdc:mga08y16_170921_c1 3300050511 Bacteria 2258
387 nmdc:mga08y16_233959_c1 3300050511 Bacteria 1900
388 nmdc:mga08y16_3415_c1 3300050511 Bacteria 16476
389 nmdc:mga08y16_374732_c1 3300050511 Bacteria 1460
390 nmdc:mga08y16_389342_c1 3300050511 Bacteria 1428
391 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
392 nmdc:mga08y16_60250_c1 3300050511 Bacteria 3965
393 nmdc:mga08y16_82119_c1 3300050511 Bacteria 3360
394 nmdc:mga0n895_100798_c1 3300050512 Bacteria 2897
395 nmdc:mga0n895_301061_c1 3300050512 Unclassified 1625
396 nmdc:mga0n895_455275_c1 3300050512 Bacteria 1292
397 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
398 nmdc:mga0n895_62639_c1 3300050512 Bacteria 3677
399 nmdc:mga0n895_67535_c1 3300050512 Bacteria 3541
400 nmdc:mga0n895_7309_c1 3300050512 Bacteria 9468
401 nmdc:mga0n895_89936_c1 3300050512 Bacteria 3071
402 nmdc:mga0rr50_140565_c1 3300050513 Bacteria 1942
403 nmdc:mga0rr50_1728_c1 3300050513 Bacteria 12046
404 nmdc:mga0rr50_42595_c1 3300050513 Bacteria 3316
405 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
406 nmdc:mga08x19_3412_c1 3300050514 Bacteria 9477
407 nmdc:mga0a205_103810_c1 3300050515 Bacteria 2741
408 nmdc:mga0a205_138443_c1 3300050515 Bacteria 2334
409 nmdc:mga0a205_14685_c1 3300050515 Bacteria 7307
410 nmdc:mga0a205_207428_c1 3300050515 Bacteria 1849
411 nmdc:mga0a205_291612_c1 3300050515 Bacteria 1506
412 nmdc:mga0a205_627_c1 3300050515 Bacteria 28069
413 Ga0500568_0019049 3300053139 Bacteria 2992
414 Ga0070675_100078732
415 JGI24746J21847_1009946
416 Ga0065712_10004096
417 Ga0065712_10071066
418 Ga0065712_10132014
419 Ga0065715_10015778
420 Ga0065715_10118072
421 Ga0065707_10000906
422 Ga0070676_10009638
423 Ga0070676_10055833
424 Ga0070690_100099025
425 Ga0070670_100044571
426 Ga0070677_10006598
427 Ga0070677_10021405
428 Ga0068869_100019838
429 Ga0070680_100225868
430 Ga0068868_100030094
431 Ga0068868_100294942
432 Ga0070689_100062842
433 Ga0070689_100107757
434 Ga0070661_100085115
435 Ga0070661_100112112
436 Ga0070668_100014867
437 Ga0070669_100002449
438 Ga0070669_100008836
439 Ga0070669_100018770
440 Ga0070669_100150882
441 Ga0070675_100036660
442 Ga0070675_100085382
443 Ga0070675_100100998
444 Ga0070675_100124283
445 Ga0070675_100185525
446 Ga0070675_100203263
447 Ga0070671_100008541
448 Ga0070671_100009176
449 Ga0070671_100217727
450 Ga0070674_100007785
451 Ga0070674_100019093
452 Ga0070674_100099372
453 Ga0070673_100005652
454 Ga0070673_100016567
455 Ga0070673_100024138
456 Ga0070673_100040644
457 Ga0070673_100080600
458 Ga0070673_100136946
459 Ga0070688_100132115
460 Ga0070688_100135104
461 Ga0070659_100334383
462 Ga0070667_100001111
463 Ga0070667_100037373
464 Ga0070667_100356983
465 Ga0070709_10015553
466 Ga0070714_100065911
467 Ga0070701_10034663
468 Ga0070705_100035798
469 Ga0070700_100066597
470 Ga0070700_100141483
471 Ga0070700_100154339
472 Ga0070694_100035121
473 Ga0070694_100236237
474 Ga0070678_100003477
475 Ga0070678_100142491
476 Ga0070678_100221004
477 Ga0070662_100039022
478 Ga0068867_100014749
479 Ga0068867_100119373
480 Ga0070685_10118418
481 Ga0070707_100213637
482 Ga0070707_100370302
483 Ga0070698_100026431
484 Ga0070698_100107326
485 Ga0070697_100032903
486 Ga0070672_100029865
487 Ga0070672_100030940
488 Ga0070672_100060235
489 Ga0070672_100151961
490 Ga0070686_100095560
491 Ga0070686_100173536
492 Ga0070695_100207360
493 Ga0070696_100053259
494 Ga0070696_100155499
495 Ga0070665_100020412
496 Ga0070704_100250041
497 Ga0070704_100455891
498 Ga0070664_100005998
499 Ga0070664_100007088
500 Ga0068854_100004621
501 Ga0068854_100047278
502 Ga0068854_100323024
503 Ga0070702_100004659
504 Ga0070702_100065594
505 Ga0068859_100129935
506 Ga0068859_100134559
507 Ga0068859_100167113
508 Ga0068859_100270459
509 Ga0068859_100379048
510 Ga0068859_100598325
511 Ga0068866_10012151
512 Ga0068861_100007306
513 Ga0068861_100007846
514 Ga0068861_100018833
515 Ga0068861_100116748
516 Ga0068861_100150787
517 Ga0068870_10001125
518 Ga0068863_100012883
519 Ga0068863_100159183
520 Ga0068858_100005842
521 Ga0068858_100019331
522 Ga0068858_100030641
523 Ga0068858_100049880
524 Ga0068860_100013169
525 Ga0068860_100031965
526 Ga0068860_100065177
527 Ga0068860_100126485
528 Ga0068860_100191264
529 Ga0068860_100257702
530 Ga0068862_100007993
531 Ga0068862_100170762
532 Ga0075432_10007994
533 Ga0097621_100008977
534 Ga0068871_100012290
535 Ga0068871_100114348
536 Ga0068871_100157293
537 Ga0075428_100000010
538 Ga0075428_100450406
539 Ga0075430_100003568
540 Ga0075431_100017648
541 Ga0075431_100088408
542 Ga0075431_100174753
543 Ga0075433_10002959
544 Ga0075433_10005616
545 Ga0075433_10015200
546 Ga0075434_100008263
547 Ga0075434_100010218
548 Ga0075434_100430180
549 Ga0075429_100018356
550 Ga0068865_100008969
551 Ga0068865_100041534
552 Ga0068865_100090078
553 Ga0068865_100203295
554 Ga0075436_100002423
555 Ga0097620_100129935
556 Ga0097620_100134557
557 Ga0097620_100167111
558 Ga0097620_100270467
559 Ga0097620_100379017
560 Ga0097620_100598242
561 Ga0075435_100000051
562 Ga0075435_100006302
563 Ga0075435_100093881
564 Ga0111539_10000001
565 Ga0111539_10006826
566 Ga0111539_10006996
567 Ga0111539_10012720
568 Ga0111539_10026937
569 Ga0111539_10027956
570 Ga0111539_10077012
571 Ga0111539_10095444
572 Ga0111539_10239107
573 Ga0111539_10288142
574 Ga0111539_10349292
575 Ga0105245_10325583
576 Ga0105245_10372787
577 Ga0105247_10142335
578 Ga0114129_10005134
579 Ga0114129_10012603
580 Ga0114129_10016056
581 Ga0114129_10016482
582 Ga0114129_10174916
583 Ga0105243_10010517
584 Ga0105241_10025773
585 Ga0105242_10012036
586 Ga0105242_10114026
587 Ga0105248_10011934
588 Ga0105248_10017857
589 Ga0105248_10070437
590 Ga0105248_10172122
591 Ga0105248_10238395
592 Ga0105248_10301701
593 Ga0105238_10014276
594 Ga0105249_10310314
595 Ga0163162_10006792
596 Ga0163162_10117792
597 Ga0157375_10008338
598 Ga0157375_10106938
599 Ga0163163_10001162
600 Ga0163163_10469814
601 Ga0157380_10001150
602 Ga0157380_10003729
603 Ga0157380_10007303
604 Ga0157380_10066115
605 Ga0157380_10259106
606 Ga0157380_10262959
607 Ga0157377_10001921
608 Ga0157377_10008368
609 Ga0157377_10164271
610 Ga0157379_10036316
611 Ga0157379_10090672
612 Ga0157376_10129299
613 Ga0163161_10158810
614 Ga0213876_10023736
615 Ga0207697_10003717
616 Ga0207682_10000612
617 Ga0207682_10006704
618 Ga0207682_10036023
619 Ga0207688_10000544
620 Ga0207688_10052691
621 Ga0207680_10008873
622 Ga0207680_10181632
623 Ga0207699_10020965
624 Ga0207645_10005333
625 Ga0207645_10040845
626 Ga0207645_10049298
627 Ga0207645_10189893
628 Ga0207643_10000450
629 Ga0207643_10028246
630 Ga0207643_10033392
631 Ga0207662_10045298
632 Ga0207662_10095445
633 Ga0207649_10097462
634 Ga0207646_10286236
635 Ga0207681_10011515
636 Ga0207681_10016018
637 Ga0207681_10028379
638 Ga0207681_10037875
639 Ga0207681_10057016
640 Ga0207650_10032990
641 Ga0207650_10105635
642 Ga0207650_10173483
643 Ga0207659_10010250
644 Ga0207659_10020797
645 Ga0207659_10033958
646 Ga0207659_10092574
647 Ga0207659_10093558
648 Ga0207659_10121146
649 Ga0207659_10143166
650 Ga0207700_10076889
651 Ga0207664_10114445
652 Ga0207644_10037948
653 Ga0207644_10039956
654 Ga0207706_10008269
655 Ga0207706_10092922
656 Ga0207706_10162294
657 Ga0207706_10233376
658 Ga0207686_10030317
659 Ga0207686_10083195
660 Ga0207709_10007799
661 Ga0207670_10043037
662 Ga0207670_10080936
663 Ga0207670_10161192
664 Ga0207670_10261357
665 Ga0207670_10322962
666 Ga0207669_10010986
667 Ga0207704_10031348
668 Ga0207704_10170243
669 Ga0207691_10007325
670 Ga0207691_10019192
671 Ga0207691_10037038
672 Ga0207691_10055728
673 Ga0207691_10077975
674 Ga0207691_10152231
675 Ga0207711_10009194
676 Ga0207711_10009762
677 Ga0207711_10124127
678 Ga0207711_10152007
679 Ga0207711_10188107
680 Ga0207689_10001850
681 Ga0207689_10004538
682 Ga0207689_10076286
683 Ga0207689_10086039
684 Ga0207679_10014671
685 Ga0207679_10099080
686 Ga0207651_10043947
687 Ga0207651_10050737
688 Ga0207651_10099691
689 Ga0207651_10175572
690 Ga0207712_10004928
691 Ga0207712_10294914
692 Ga0207668_10057831
693 Ga0207640_10004709
694 Ga0207640_10039065
695 Ga0207640_10140601
696 Ga0207658_10003584
697 Ga0207658_10251368
698 Ga0207703_10111368
699 Ga0207703_10259334
700 Ga0207678_10055307
701 Ga0207678_10124741
702 Ga0207708_10016789
703 Ga0207708_10054299
704 Ga0207708_10063732
705 Ga0207708_10086865
706 Ga0207641_10005952
707 Ga0207641_10263331
708 Ga0207648_10000587
709 Ga0207648_10011991
710 Ga0207648_10074851
711 Ga0207648_10083494
712 Ga0207648_10088971
713 Ga0207676_10027281
714 Ga0207674_10152920
715 Ga0207675_100005152
716 Ga0207675_100007972
717 Ga0207675_100018088
718 Ga0207675_100044003
719 Ga0207675_100101807
720 Ga0207683_10007274
721 Ga0207683_10011349
722 Ga0207683_10028920
723 Ga0207428_10000002
724 Ga0207428_10004546
725 Ga0207428_10005192
726 Ga0207428_10010042
727 Ga0207428_10012794
728 Ga0207428_10072623
729 Ga0207428_10109367
730 Ga0207428_10223401
731 Ga0268265_10114163
732 Ga0268265_10185994
733 Ga0268264_10044165
734 Ga0268264_10096586
735 Ga0268264_10106076
736 Ga0268264_10232816
737 Ga0268264_10477171
738 Ga0265338_10019135
739 Ga0265760_10007227
740 Ga0265325_10027288
741 Ga0265339_10000077
742 Ga0265313_10002022
743 Ga0373959_0018650
744 Ga0373934_0122866
745 Ga0373951_0001996
746 Ga0373952_0014584
747 Ga0373939_0000138
748 Ga0373941_0000086
749 Ga0373945_0052217
750 Ga0373942_0001119
751 Ga0373931_0002913
752 Ga0373935_0219990
753 Ga0373935_0222364
754 Ga0373947_0043570
755 Ga0373937_0102438
756 Ga0373937_0307533
757 Ga0373925_0105114
758 Ga0373925_0348975
759 Ga0436365_0075922
760 Ga0451800_0432438
761 Ga0466957_0136256
762 Ga0466959_0051535
763 Ga0451576_0010342
764 Ga0495603_0286590
765 Ga0495629_0302837
766 Ga0495618_0285296
767 Ga0495628_0389925
768 Ga0495586_0107758
769 Ga0495621_0075891
770 Ga0495656_0013621
771 Ga0495656_0034559
772 Ga0495634_0076419
773 Ga0495581_0183820
774 Ga0496104_0170476
775 Ga0496106_0183841
776 Ga0496106_0234394
777 Ga0496108_0121719
778 Ga0496109_0420013
779 Ga0496109_0469751
780 Ga0496113_0186758
781 Ga0496114_0061672
782 Ga0496114_0198501
783 nmdc:mga05p37_130790_c1
784 nmdc:mga05p37_147673_c1
785 nmdc:mga05p37_19261_c1
786 nmdc:mga05p37_2403_c1
787 nmdc:mga05p37_24040_c1
788 nmdc:mga05p37_33283_c1
789 nmdc:mga05p37_6100_c1
790 nmdc:mga05p37_87303_c1
791 nmdc:mga09592_10502_c1
792 nmdc:mga09592_193896_c1
793 nmdc:mga0qj67_211348_c1
794 nmdc:mga0qj67_41075_c1
795 nmdc:mga06r32_6729_c1
796 nmdc:mga06r32_73194_c1
797 nmdc:mga08y16_131460_c1
798 nmdc:mga08y16_139052_c1
799 nmdc:mga08y16_170921_c1
800 nmdc:mga08y16_233959_c1
801 nmdc:mga08y16_3415_c1
802 nmdc:mga08y16_374732_c1
803 nmdc:mga08y16_389342_c1
804 nmdc:mga08y16_3_c1
805 nmdc:mga08y16_60250_c1
806 nmdc:mga08y16_82119_c1
807 nmdc:mga0n895_100798_c1
808 nmdc:mga0n895_301061_c1
809 nmdc:mga0n895_455275_c1
810 nmdc:mga0n895_4_c1
811 nmdc:mga0n895_62639_c1
812 nmdc:mga0n895_67535_c1
813 nmdc:mga0n895_7309_c1
814 nmdc:mga0n895_89936_c1
815 nmdc:mga0rr50_140565_c1
816 nmdc:mga0rr50_1728_c1
817 nmdc:mga0rr50_42595_c1
818 nmdc:mga0rr50_4_c1
819 nmdc:mga08x19_3412_c1
820 nmdc:mga0a205_103810_c1
821 nmdc:mga0a205_138443_c1
822 nmdc:mga0a205_14685_c1
823 nmdc:mga0a205_207428_c1
824 nmdc:mga0a205_291612_c1
825 nmdc:mga0a205_627_c1
826 Ga0500568_0019049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

88

390

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.9156 44 346
2f6k-assembly1.cif.gz_A crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24 0.9041 44 346
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.8792 41 346
3nur-assembly1.cif.gz_A crystal structure of a putative amidohydrolase from staphylococcus aureus 0.8649 43 346
4qs5-assembly2.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw2 from novosphingobium aromaticivorans dsm 12444 (target efi-505250) with bound manganese and 3-methoxy-4-hydroxy-5-nitrobenzoic acid, the d314n mutant 0.8602 36 346
ID Description Score Start End Superfamily
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8989 44 346 3.20.20.140
2f6kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8903 44 346 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8791 41 346 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8713 44 346 3.20.20.140
3nurA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.863 44 346 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1Q8BAW3-F1-model_v4 Amidohydrolase-related domain-containing protein 0.978 38 349 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A537IZG3-F1-model_v4 Amidohydrolase 0.9563 83 189 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A1F3XBC2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.953 43 350 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8DJU2-F1-model_v4 Amidohydrolase 0.9494 110 350 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8MFH9-F1-model_v4 Amidohydrolase 0.9489 108 350 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map