F437615

General Info

Members Datasets Scaffolds Average Seq Length
411 161 396 168

Family's Representative Sequence

Representative Sequence 3300046680|Ga0495646_0003302|Ga0495646_0003302_6966_7589
Length 207
Sequence MKTLKQAGPIHAISPKTVTPWYAQRWPWLLMLGPMTVVLAGLFTAWLAFTYQDALVVDDYYKAGKAINQDLRRDHEAVRRGINGSLHYDAAQGVLSGVLHNLRQPVNERNAXXXXAESLEEQGAAALGAGLLQLRLIHSTLPAKDILLNLHADPQGNFSVALPLLDAARWQVLVEDRQGQWRLHGNWIWPQQAAIDLRPETITPAQP

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2738541300 Massilia sp. GV016 Isolate Unclassified
5 2738543018 Massilia sp. GV045 Isolate Unclassified
6 2738543030 Massilia sp. GV097 Isolate Unclassified
7 2818991436 Collimonas arenae 515 Isolate Unclassified
8 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
9 2842711865 Duganella sp. R-73148 Isolate Unclassified
10 2857558681 Duganella sp. R-74565 Isolate Unclassified
11 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
12 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
13 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
14 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
15 2904424332 Duganella sp. 1411 Isolate Rhizosphere
16 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
36 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
37 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
38 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
58 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
59 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
60 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
61 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
68 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
69 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
70 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
92 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
154 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
155 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
160 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
161 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0
Isolates 3.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 0.97
Rhizoplane 0.97
Rhizosphere 84.18
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000256 3300002704 Bacteria 20230
2 JGI25156J39149_1008863 3300002705 Bacteria 2494
3 JGI25154J39366_1000474 3300002738 Bacteria 20990
4 JGI25154J39366_1001206 3300002738 Bacteria 9789
5 JGI25153J46596_10032656 3300003215 Bacteria 1731
6 rootL2_10023899 3300003322 Bacteria 2867
7 rootL2_10033398 3300003322 Bacteria 6905
8 Ga0055529_1000015 3300003763 Bacteria 366950
9 Ga0055526_1000007 3300003771 Bacteria 321998
10 Ga0055524_1000038 3300003775 Bacteria 162683
11 Ga0070670_100267408 3300005331 Bacteria 1491
12 Ga0068855_100169709 3300005563 Bacteria 2471
13 Ga0068855_100589920 3300005563 Bacteria 1199
14 Ga0068856_100059033 3300005614 Bacteria 3789
15 Ga0068852_100077869 3300005616 Bacteria 2932
16 Ga0099826_10000008 3300006948 Bacteria 380974
17 Ga0105244_10001568 3300009036 Bacteria 18161
18 Ga0105240_10002667 3300009093 Bacteria 28399
19 Ga0105240_10038896 3300009093 Bacteria 6098
20 Ga0105238_10390730 3300009551 Bacteria 1383
21 Ga0105239_10404757 3300010375 Bacteria 1544
22 Ga0182008_10025278 3300014497 Bacteria 3016
23 Ga0182008_10112828 3300014497 Bacteria 1347
24 Ga0182008_10181198 3300014497 Bacteria 1066
25 Ga0157376_10100701 3300014969 Bacteria 2523
26 Ga0182007_10008626 3300015262 Bacteria 4172
27 Ga0182005_1000327 3300015265 Bacteria 28182
28 Ga0209435_100074 3300025206 Bacteria 55837
29 Ga0209672_106567 3300025228 Bacteria 1876
30 Ga0209437_100072 3300025233 Bacteria 305152
31 Ga0209437_103908 3300025233 Bacteria 2650
32 Ga0207425_1001550 3300025245 Bacteria 9376
33 Ga0209646_1000042 3300025246 Bacteria 343923
34 Ga0209646_1000057 3300025246 Bacteria 266384
35 Ga0209026_1002546 3300025250 Bacteria 6736
36 Ga0209026_1007015 3300025250 Bacteria 2626
37 Ga0209759_1000112 3300025256 Bacteria 143361
38 Ga0209565_1005640 3300025263 Bacteria 3618
39 Ga0209455_1000031 3300025272 Bacteria 519952
40 Ga0209025_1004319 3300025294 Bacteria 12434
41 Ga0209564_1000010 3300025295 Bacteria 885399
42 Ga0209564_1016727 3300025295 Bacteria 2899
43 Ga0209758_1000379 3300025297 Bacteria 77337
44 Ga0209256_1000018 3300025299 Bacteria 568467
45 Ga0207655_1002256 3300025728 Bacteria 15935
46 Ga0207695_10005170 3300025913 Bacteria 17468
47 Ga0207695_10019098 3300025913 Bacteria 7905
48 Ga0207694_10131578 3300025924 Bacteria 2006
49 Ga0207650_10270684 3300025925 Bacteria 1380
50 Ga0207667_10006737 3300025949 Bacteria 13872
51 Ga0207702_10070416 3300026078 Bacteria 3008
52 Ga0207698_10139652 3300026142 Bacteria 2085
53 Ga0209282_1000005 3300027666 Bacteria 380858
54 Ga0316178_1120006 3300030735 Bacteria 841
55 Ga0316180_1101610 3300030736 Bacteria 1772
56 Ga0316181_1247568 3300030744 Bacteria 1005
57 Ga0316182_1126418 3300030745 Bacteria 731
58 Ga0265314_10016398 3300031711 Bacteria 5853
59 Ga0307406_10806364 3300031901 Bacteria 793
60 Ga0307415_100685472 3300032126 Bacteria 923
61 Ga0395899_0247105 3300037312 Bacteria 1226
62 Ga0395905_0000955 3300037471 Bacteria 37080
63 Ga0395905_0409745 3300037471 Bacteria 1251
64 Ga0450904_000694 3300042139 Bacteria 5972
65 Ga0495617_000809 3300046452 Bacteria 15126
66 Ga0495617_023422 3300046452 Bacteria 2086
67 Ga0495617_077718 3300046452 Bacteria 1088
68 Ga0495627_127283 3300046453 Bacteria 717
69 Ga0495603_0031409 3300046455 Bacteria 3197
70 Ga0495590_0000012 3300046457 Bacteria 303377
71 Ga0495590_0003852 3300046457 Bacteria 6105
72 Ga0495638_0000047 3300046460 Bacteria 216004
73 Ga0495638_0002024 3300046460 Bacteria 17261
74 Ga0495638_0009661 3300046460 Bacteria 6746
75 Ga0495638_0011670 3300046460 Bacteria 6051
76 Ga0495638_0083695 3300046460 Bacteria 1932
77 Ga0495651_0015447 3300046462 Bacteria 5906
78 Ga0495653_0022531 3300046463 Bacteria 5095
79 Ga0495653_0069387 3300046463 Bacteria 2641
80 Ga0495650_0000226 3300046471 Bacteria 115930
81 Ga0495650_0000462 3300046471 Bacteria 63149
82 Ga0495650_0001202 3300046471 Bacteria 27277
83 Ga0495605_0000018 3300046474 Bacteria 270187
84 Ga0495605_0005369 3300046474 Bacteria 7466
85 Ga0495605_0311616 3300046474 Bacteria 664
86 Ga0495639_0026300 3300046475 Bacteria 2571
87 Ga0495584_0000006 3300046491 Bacteria 301775
88 Ga0495584_0000570 3300046491 Bacteria 24884
89 Ga0495584_0002193 3300046491 Bacteria 11129
90 Ga0495584_0002419 3300046491 Bacteria 10590
91 Ga0495584_0002756 3300046491 Bacteria 9828
92 Ga0495584_0012591 3300046491 Bacteria 4319
93 Ga0495584_0022479 3300046491 Bacteria 3200
94 Ga0495584_0108992 3300046491 Bacteria 1400
95 Ga0495584_0136704 3300046491 Bacteria 1244
96 Ga0495584_0199363 3300046491 Bacteria 1017
97 Ga0495584_0213608 3300046491 Bacteria 980
98 Ga0495585_0000005 3300046492 Bacteria 328103
99 Ga0495585_0000049 3300046492 Bacteria 119546
100 Ga0495585_0000162 3300046492 Bacteria 71606
101 Ga0495585_0003133 3300046492 Bacteria 11336
102 Ga0495585_0008309 3300046492 Bacteria 6299
103 Ga0495585_0009264 3300046492 Bacteria 5915
104 Ga0495585_0013680 3300046492 Bacteria 4744
105 Ga0495585_0018650 3300046492 Bacteria 4001
106 Ga0495585_0020793 3300046492 Bacteria 3772
107 Ga0495585_0021295 3300046492 Bacteria 3723
108 Ga0495585_0022255 3300046492 Bacteria 3638
109 Ga0495585_0025442 3300046492 Bacteria 3390
110 Ga0495585_0029686 3300046492 Bacteria 3112
111 Ga0495585_0103212 3300046492 Bacteria 1523
112 Ga0495585_0286568 3300046492 Bacteria 813
113 Ga0495594_0013825 3300046499 Bacteria 4220
114 Ga0495594_0183411 3300046499 Bacteria 1191
115 Ga0495596_0000013 3300046500 Bacteria 125228
116 Ga0495596_0006790 3300046500 Bacteria 5226
117 Ga0495607_0000447 3300046501 Bacteria 41522
118 Ga0495607_0001792 3300046501 Bacteria 18328
119 Ga0495607_0004897 3300046501 Bacteria 9739
120 Ga0495607_0015793 3300046501 Bacteria 4884
121 Ga0495607_0023285 3300046501 Bacteria 3877
122 Ga0495607_0100069 3300046501 Bacteria 1554
123 Ga0495607_0229118 3300046501 Bacteria 904
124 Ga0495607_0232661 3300046501 Bacteria 895
125 Ga0495583_0000092 3300046506 Bacteria 158865
126 Ga0495583_0000316 3300046506 Bacteria 76314
127 Ga0495583_0000480 3300046506 Bacteria 58370
128 Ga0495583_0001098 3300046506 Bacteria 29951
129 Ga0495583_0024067 3300046506 Bacteria 3067
130 Ga0495583_0038753 3300046506 Bacteria 2250
131 Ga0495583_0101509 3300046506 Bacteria 1227
132 Ga0495583_0103257 3300046506 Bacteria 1214
133 Ga0495583_0116895 3300046506 Bacteria 1125
134 Ga0495583_0172017 3300046506 Bacteria 889
135 Ga0495606_0000066 3300046507 Bacteria 181028
136 Ga0495606_0000101 3300046507 Bacteria 146752
137 Ga0495606_0000409 3300046507 Bacteria 72543
138 Ga0495606_0000814 3300046507 Bacteria 47442
139 Ga0495606_0005089 3300046507 Bacteria 12789
140 Ga0495606_0018361 3300046507 Bacteria 5247
141 Ga0495606_0025163 3300046507 Bacteria 4270
142 Ga0495606_0046273 3300046507 Bacteria 2877
143 Ga0495606_0052903 3300046507 Bacteria 2637
144 Ga0495606_0248745 3300046507 Bacteria 987
145 Ga0495608_0038035 3300046511 Bacteria 3234
146 Ga0495610_0000014 3300046512 Bacteria 444708
147 Ga0495610_0005660 3300046512 Bacteria 8810
148 Ga0495610_0007220 3300046512 Bacteria 7454
149 Ga0495610_0009501 3300046512 Bacteria 6139
150 Ga0495610_0012253 3300046512 Bacteria 5175
151 Ga0495610_0048017 3300046512 Bacteria 2097
152 Ga0495610_0175579 3300046512 Bacteria 895
153 Ga0495616_0001133 3300046513 Bacteria 18867
154 Ga0495616_0001323 3300046513 Bacteria 17297
155 Ga0495616_0019529 3300046513 Bacteria 3696
156 Ga0495616_0114034 3300046513 Bacteria 1253
157 Ga0495616_0126029 3300046513 Bacteria 1177
158 Ga0495620_0017241 3300046515 Bacteria 3606
159 Ga0495628_0000315 3300046516 Bacteria 43763
160 Ga0495628_0007175 3300046516 Bacteria 9650
161 Ga0495628_0202342 3300046516 Bacteria 1496
162 Ga0495631_0011802 3300046518 Bacteria 4285
163 Ga0495631_0023840 3300046518 Bacteria 2832
164 Ga0495631_0083278 3300046518 Bacteria 1379
165 Ga0495631_0099219 3300046518 Bacteria 1253
166 Ga0495631_0179706 3300046518 Bacteria 906
167 Ga0495632_0009088 3300046519 Bacteria 6017
168 Ga0495637_0001526 3300046520 Bacteria 13538
169 Ga0495643_0000234 3300046522 Bacteria 84022
170 Ga0495643_0000388 3300046522 Bacteria 58226
171 Ga0495643_0036288 3300046522 Bacteria 2709
172 Ga0495643_0112933 3300046522 Bacteria 1379
173 Ga0495644_0000379 3300046523 Bacteria 20217
174 Ga0495644_0002875 3300046523 Bacteria 6826
175 Ga0495644_0037780 3300046523 Bacteria 1822
176 Ga0495644_0103135 3300046523 Bacteria 1080
177 Ga0495648_0000019 3300046524 Bacteria 276407
178 Ga0495648_0000033 3300046524 Bacteria 199184
179 Ga0495648_0000207 3300046524 Bacteria 68660
180 Ga0495648_0005556 3300046524 Bacteria 10456
181 Ga0495648_0007648 3300046524 Bacteria 8616
182 Ga0495648_0015834 3300046524 Bacteria 5452
183 Ga0495648_0061891 3300046524 Bacteria 2220
184 Ga0495648_0074431 3300046524 Bacteria 1956
185 Ga0495648_0074453 3300046524 Bacteria 1956
186 Ga0495648_0145586 3300046524 Bacteria 1242
187 Ga0495663_0163041 3300046525 Bacteria 765
188 Ga0495666_0025959 3300046526 Bacteria 2891
189 Ga0495666_0079858 3300046526 Bacteria 1548
190 Ga0495642_0001468 3300046528 Bacteria 10544
191 Ga0495642_0001868 3300046528 Bacteria 8991
192 Ga0495642_0002397 3300046528 Bacteria 7636
193 Ga0495642_0011294 3300046528 Bacteria 3428
194 Ga0495642_0014849 3300046528 Bacteria 3022
195 Ga0495642_0061963 3300046528 Bacteria 1553
196 Ga0495642_0334118 3300046528 Bacteria 665
197 Ga0495652_0011880 3300046529 Bacteria 7871
198 Ga0495652_0085612 3300046529 Bacteria 2589
199 Ga0495652_0127019 3300046529 Bacteria 2024
200 Ga0495654_0009835 3300046530 Bacteria 5226
201 Ga0495654_0045702 3300046530 Bacteria 2159
202 Ga0495654_0124876 3300046530 Bacteria 1161
203 Ga0495609_0000127 3300046538 Bacteria 82467
204 Ga0495609_0000421 3300046538 Bacteria 35331
205 Ga0495609_0012434 3300046538 Bacteria 4038
206 Ga0495609_0031689 3300046538 Bacteria 2402
207 Ga0495609_0048656 3300046538 Bacteria 1894
208 Ga0495609_0186013 3300046538 Bacteria 873
209 Ga0495597_0000075 3300046542 Bacteria 86570
210 Ga0495597_0000378 3300046542 Bacteria 38615
211 Ga0495597_0001275 3300046542 Bacteria 18575
212 Ga0495597_0004218 3300046542 Bacteria 7953
213 Ga0495597_0004294 3300046542 Bacteria 7873
214 Ga0495597_0027208 3300046542 Bacteria 2623
215 Ga0495597_0030599 3300046542 Bacteria 2453
216 Ga0495597_0073915 3300046542 Bacteria 1464
217 Ga0495597_0081612 3300046542 Bacteria 1382
218 Ga0495597_0339428 3300046542 Bacteria 578
219 Ga0495622_0000037 3300046557 Bacteria 119690
220 Ga0495622_0000155 3300046557 Bacteria 58297
221 Ga0495622_0031845 3300046557 Bacteria 2463
222 Ga0495622_0032916 3300046557 Bacteria 2420
223 Ga0495622_0211332 3300046557 Bacteria 862
224 Ga0495633_0000086 3300046558 Bacteria 124357
225 Ga0495633_0000297 3300046558 Bacteria 56662
226 Ga0495633_0002917 3300046558 Bacteria 11736
227 Ga0495633_0003169 3300046558 Bacteria 11120
228 Ga0495633_0005227 3300046558 Bacteria 8007
229 Ga0495633_0008436 3300046558 Bacteria 5800
230 Ga0495633_0012297 3300046558 Bacteria 4562
231 Ga0495633_0025457 3300046558 Bacteria 2913
232 Ga0495633_0031449 3300046558 Bacteria 2572
233 Ga0495633_0033862 3300046558 Bacteria 2460
234 Ga0495633_0183286 3300046558 Bacteria 963
235 Ga0495633_0551690 3300046558 Bacteria 519
236 Ga0495656_0003025 3300046615 Bacteria 5652
237 Ga0495656_0006282 3300046615 Bacteria 4162
238 Ga0495656_0089422 3300046615 Bacteria 1405
239 Ga0495656_0551325 3300046615 Bacteria 614
240 Ga0495668_0000579 3300046616 Bacteria 44604
241 Ga0495668_0000712 3300046616 Bacteria 40090
242 Ga0495668_0001514 3300046616 Bacteria 22099
243 Ga0495668_0005034 3300046616 Bacteria 9106
244 Ga0495668_0006539 3300046616 Bacteria 7615
245 Ga0495668_0011972 3300046616 Bacteria 5165
246 Ga0495668_0014164 3300046616 Bacteria 4685
247 Ga0495668_0024190 3300046616 Bacteria 3455
248 Ga0495668_0281360 3300046616 Bacteria 911
249 Ga0495634_0271631 3300046642 Bacteria 1032
250 Ga0495611_0002764 3300046648 Bacteria 7871
251 Ga0495611_0003057 3300046648 Bacteria 7438
252 Ga0495611_0005095 3300046648 Bacteria 5631
253 Ga0495611_0009847 3300046648 Bacteria 4043
254 Ga0495611_0010718 3300046648 Bacteria 3881
255 Ga0495611_0048111 3300046648 Bacteria 1915
256 Ga0495611_0153061 3300046648 Bacteria 1077
257 Ga0495611_0284056 3300046648 Bacteria 764
258 Ga0495625_0000432 3300046660 Bacteria 63013
259 Ga0495625_0001069 3300046660 Bacteria 35654
260 Ga0495625_0002528 3300046660 Bacteria 19665
261 Ga0495625_0002580 3300046660 Bacteria 19464
262 Ga0495625_0007654 3300046660 Bacteria 9364
263 Ga0495625_0014160 3300046660 Bacteria 6380
264 Ga0495625_0024019 3300046660 Bacteria 4647
265 Ga0495625_0117572 3300046660 Bacteria 1812
266 Ga0495625_0129242 3300046660 Bacteria 1712
267 Ga0495659_0000074 3300046664 Bacteria 42753
268 Ga0495659_0000083 3300046664 Bacteria 40822
269 Ga0495659_0000368 3300046664 Bacteria 17465
270 Ga0495661_0001765 3300046665 Bacteria 17381
271 Ga0495661_0018067 3300046665 Bacteria 4644
272 Ga0495661_0018226 3300046665 Bacteria 4621
273 Ga0495661_0021666 3300046665 Bacteria 4186
274 Ga0495661_0072941 3300046665 Bacteria 2001
275 Ga0495661_0100244 3300046665 Bacteria 1631
276 Ga0495661_0129617 3300046665 Bacteria 1383
277 Ga0495661_0202934 3300046665 Bacteria 1037
278 Ga0495588_0422650 3300046674 Bacteria 699
279 Ga0495657_0030526 3300046675 Bacteria 3774
280 Ga0495599_0004724 3300046678 Bacteria 8091
281 Ga0495623_0015586 3300046679 Bacteria 4914
282 Ga0495623_0051832 3300046679 Bacteria 2595
283 Ga0495646_0003302 3300046680 Bacteria 10043
284 Ga0495646_0043597 3300046680 Bacteria 2745
285 Ga0495658_0049212 3300046683 Bacteria 2380
286 Ga0495669_0143300 3300046684 Bacteria 1128
287 Ga0495669_0308161 3300046684 Bacteria 764
288 Ga0495624_0266230 3300046690 Unclassified 1035
289 Ga0495670_0003303 3300046691 Bacteria 7948
290 Ga0495670_0003637 3300046691 Bacteria 7574
291 Ga0495670_0007293 3300046691 Bacteria 5434
292 Ga0495670_0015097 3300046691 Bacteria 3799
293 Ga0495670_0029539 3300046691 Bacteria 2721
294 Ga0495670_0041500 3300046691 Bacteria 2295
295 Ga0495670_0041935 3300046691 Bacteria 2283
296 Ga0495670_0180294 3300046691 Bacteria 1115
297 Ga0495670_0188796 3300046691 Bacteria 1089
298 Ga0495670_0233139 3300046691 Bacteria 979
299 Ga0495671_0000005 3300046692 Bacteria 509397
300 Ga0495671_0000493 3300046692 Bacteria 30406
301 Ga0495671_0005314 3300046692 Bacteria 7560
302 Ga0495649_0001632 3300046694 Bacteria 16686
303 Ga0495649_0002914 3300046694 Bacteria 11836
304 Ga0495649_0068232 3300046694 Bacteria 1908
305 Ga0495649_0069156 3300046694 Bacteria 1894
306 Ga0495649_0103828 3300046694 Bacteria 1509
307 Ga0495589_0068100 3300046794 Bacteria 1742
308 Ga0495600_0003375 3300046809 Bacteria 9393
309 Ga0495660_0002961 3300046810 Bacteria 10619
310 Ga0495660_0005657 3300046810 Bacteria 7474
311 Ga0495660_0011538 3300046810 Bacteria 5126
312 Ga0495660_0012541 3300046810 Bacteria 4921
313 Ga0495660_0024157 3300046810 Bacteria 3463
314 Ga0495660_0228250 3300046810 Bacteria 874
315 Ga0495604_0011517 3300047317 Bacteria 7026
316 Ga0495636_0000591 3300047318 Bacteria 13316
317 Ga0495636_0001424 3300047318 Bacteria 9048
318 Ga0495636_0005274 3300047318 Bacteria 5074
319 Ga0495672_0000026 3300047320 Bacteria 340319
320 Ga0495672_0000226 3300047320 Bacteria 80307
321 Ga0495672_0023423 3300047320 Bacteria 3996
322 Ga0495672_0089645 3300047320 Bacteria 1692
323 Ga0495672_0089717 3300047320 Bacteria 1691
324 Ga0495676_0037513 3300047321 Bacteria 4033
325 Ga0495676_0071809 3300047321 Bacteria 2660
326 Ga0495676_0227603 3300047321 Bacteria 1282
327 Ga0495683_0000072 3300047323 Bacteria 104027
328 Ga0495683_0063109 3300047323 Bacteria 1831
329 Ga0495683_0066650 3300047323 Bacteria 1773
330 Ga0495683_0110145 3300047323 Bacteria 1315
331 Ga0495683_0183522 3300047323 Bacteria 954
332 Ga0495687_000213 3300047443 Bacteria 83235
333 Ga0495687_002360 3300047443 Bacteria 15291
334 Ga0495677_0002240 3300047445 Bacteria 7641
335 Ga0495677_0005383 3300047445 Bacteria 4856
336 Ga0495677_0007617 3300047445 Bacteria 4040
337 Ga0495677_0012714 3300047445 Bacteria 3067
338 Ga0495677_0018021 3300047445 Bacteria 2560
339 Ga0495677_0030965 3300047445 Bacteria 1948
340 Ga0495677_0162067 3300047445 Bacteria 863
341 Ga0495679_016395 3300047446 Bacteria 2681
342 Ga0495679_034933 3300047446 Bacteria 1596
343 Ga0495685_000263 3300047447 Bacteria 18095
344 Ga0495685_093120 3300047447 Bacteria 997
345 Ga0495673_0000008 3300047469 Bacteria 752462
346 Ga0495673_0000009 3300047469 Bacteria 731993
347 Ga0495673_0007222 3300047469 Bacteria 6419
348 Ga0495681_0001743 3300047470 Bacteria 16073
349 Ga0495681_0057139 3300047470 Bacteria 1813
350 Ga0495681_0111598 3300047470 Bacteria 1183
351 Ga0495681_0160597 3300047470 Bacteria 936
352 Ga0495681_0175133 3300047470 Bacteria 885
353 Ga0495686_0041775 3300047472 Bacteria 2918
354 Ga0495686_0191448 3300047472 Bacteria 1179
355 Ga0495602_0065989 3300048088 Bacteria 3120
356 Ga0495602_0312708 3300048088 Bacteria 1145
357 Ga0495626_0003131 3300048091 Bacteria 10834
358 Ga0495626_0054729 3300048091 Bacteria 1831
359 Ga0495626_0094023 3300048091 Bacteria 1315
360 Ga0496103_0006209 3300048906 Bacteria 7137
361 Ga0496104_0039563 3300048907 Bacteria 4415
362 Ga0496111_0589714 3300048914 Bacteria 814
363 Ga0496114_0147326 3300048917 Bacteria 2041
364 Ga0496116_0002196 3300048919 Bacteria 20783
365 Ga0496121_0006051 3300048924 Bacteria 15233
366 Ga0496121_0061060 3300048924 Bacteria 3096
367 Ga0496121_0215461 3300048924 Bacteria 1357
368 Ga0496122_0000121 3300048925 Bacteria 181589
369 Ga0496123_0000040 3300048926 Bacteria 258569
370 Ga0496124_0005845 3300048927 Bacteria 13655
371 Ga0496124_0386341 3300048927 Bacteria 977
372 Ga0496125_0000720 3300048928 Bacteria 54770
373 Ga0496125_0000995 3300048928 Bacteria 44209
374 Ga0496125_0045888 3300048928 Bacteria 3672
375 Ga0496126_0269508 3300048929 Bacteria 1413
376 Ga0495678_000130 3300049459 Bacteria 88909
377 Ga0495678_000782 3300049459 Bacteria 28498
378 Ga0495678_038950 3300049459 Bacteria 1919
379 Ga0495678_057497 3300049459 Bacteria 1473
380 Ga0495678_076523 3300049459 Bacteria 1212
381 Ga0495682_0001754 3300049460 Bacteria 10995
382 Ga0495682_0031783 3300049460 Bacteria 1950
383 Ga0495682_0034135 3300049460 Bacteria 1876
384 Ga0495682_0048076 3300049460 Bacteria 1556
385 Ga0495682_0144849 3300049460 Bacteria 848
386 Ga0501238_001041 3300049671 Bacteria 3163
387 Ga0501249_001082 3300049679 Bacteria 5782
388 Ga0501269_000461 3300049766 Bacteria 8895
389 nmdc:mga07m45_295450_c1 3300050496 Bacteria 942
390 Ga0495601_0008185 3300053077 Bacteria 6167
391 Ga0495601_0326889 3300053077 Bacteria 998
392 Ga0500595_003105 3300053119 Bacteria 7864
393 Ga0500574_002003 3300053141 Bacteria 3224
394 Ga0500586_001756 3300053145 Bacteria 4691
395 Ga0500586_012166 3300053145 Bacteria 2494
396 Ga0500619_002584 3300053154 Bacteria 3522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0069387 Ga0495653_0069387_1712_2215 139
2 3300046471 Ga0495650_0000462 Ga0495650_0000462_16055_16558 139
3 3300046492 Ga0495585_0009264 Ga0495585_0009264_3696_4199 139
4 3300046512 Ga0495610_0000014 Ga0495610_0000014_67479_67982 139
5 3300046524 Ga0495648_0005556 Ga0495648_0005556_5234_5737 139
6 3300046524 Ga0495648_0007648 Ga0495648_0007648_3626_4129 139
7 3300046558 Ga0495633_0183286 Ga0495633_0183286_437_940 139
8 3300046616 Ga0495668_0000579 Ga0495668_0000579_3581_4084 139
9 3300046665 Ga0495661_0072941 Ga0495661_0072941_1247_1750 139
10 3300046692 Ga0495671_0000005 Ga0495671_0000005_380134_380637 139
11 3300046810 Ga0495660_0002961 Ga0495660_0002961_9910_10413 139
12 3300047323 Ga0495683_0063109 Ga0495683_0063109_1311_1814 139
13 3300047446 Ga0495679_034933 Ga0495679_034933_293_796 139
14 3300047469 Ga0495673_0000009 Ga0495673_0000009_412329_412832 139
15 3300053145 Ga0500586_012166 Ga0500586_012166_1920_2423 139
16 3300046538 Ga0495609_0186013 Ga0495609_0186013_16_438 140
17 3300046691 Ga0495670_0180294 Ga0495670_0180294_682_1104 140
18 3300046506 Ga0495583_0172017 Ga0495583_0172017_450_878 142
19 3300046491 Ga0495584_0002419 Ga0495584_0002419_3273_3806 143
20 3300046492 Ga0495585_0018650 Ga0495585_0018650_2760_3293 143
21 3300046518 Ga0495631_0011802 Ga0495631_0011802_1457_1990 143
22 3300046558 Ga0495633_0025457 Ga0495633_0025457_1575_2108 143
23 3300046691 Ga0495670_0015097 Ga0495670_0015097_1080_1613 143
24 3300047318 Ga0495636_0005274 Ga0495636_0005274_836_1369 143
25 3300047445 Ga0495677_0018021 Ga0495677_0018021_1095_1628 143
26 3300046452 Ga0495617_023422 Ga0495617_023422_26_469 147
27 3300046474 Ga0495605_0005369 Ga0495605_0005369_3892_4335 147
28 3300046491 Ga0495584_0012591 Ga0495584_0012591_3664_4107 147
29 3300046491 Ga0495584_0136704 Ga0495584_0136704_395_838 147
30 3300046492 Ga0495585_0286568 Ga0495585_0286568_343_786 147
31 3300046506 Ga0495583_0000316 Ga0495583_0000316_33497_33940 147
32 3300046506 Ga0495583_0000480 Ga0495583_0000480_5495_5938 147
33 3300046513 Ga0495616_0126029 Ga0495616_0126029_102_545 147
34 3300046523 Ga0495644_0002875 Ga0495644_0002875_1810_2253 147
35 3300046524 Ga0495648_0000207 Ga0495648_0000207_4829_5272 147
36 3300046538 Ga0495609_0000421 Ga0495609_0000421_1392_1835 147
37 3300046558 Ga0495633_0551690 Ga0495633_0551690_47_490 147
38 3300046615 Ga0495656_0003025 Ga0495656_0003025_3535_3978 147
39 3300046648 Ga0495611_0010718 Ga0495611_0010718_435_878 147
40 3300046664 Ga0495659_0000083 Ga0495659_0000083_386_829 147
41 3300046665 Ga0495661_0202934 Ga0495661_0202934_52_495 147
42 3300046691 Ga0495670_0003637 Ga0495670_0003637_3500_3943 147
43 3300046691 Ga0495670_0188796 Ga0495670_0188796_109_552 147
44 3300046794 Ga0495589_0068100 Ga0495589_0068100_964_1407 147
45 3300046810 Ga0495660_0228250 Ga0495660_0228250_13_456 147
46 3300047443 Ga0495687_000213 Ga0495687_000213_19726_20169 147
47 3300047445 Ga0495677_0012714 Ga0495677_0012714_761_1204 147
48 3300047447 Ga0495685_000263 Ga0495685_000263_661_1104 147
49 3300048091 Ga0495626_0003131 Ga0495626_0003131_3932_4375 147
50 3300049459 Ga0495678_000782 Ga0495678_000782_4968_5411 147
51 3300049460 Ga0495682_0001754 Ga0495682_0001754_1010_1453 147
52 3300049460 Ga0495682_0034135 Ga0495682_0034135_1392_1835 147
53 3300046507 Ga0495606_0025163 Ga0495606_0025163_329_784 148
54 3300046542 Ga0495597_0004218 Ga0495597_0004218_6706_7161 148
55 3300046616 Ga0495668_0281360 Ga0495668_0281360_199_654 148
56 3300046660 Ga0495625_0001069 Ga0495625_0001069_3600_4055 148
57 3300046810 Ga0495660_0005657 Ga0495660_0005657_4986_5441 148
58 3300046460 Ga0495638_0011670 Ga0495638_0011670_1676_2197 151
59 3300046507 Ga0495606_0052903 Ga0495606_0052903_1379_1900 151
60 3300046523 Ga0495644_0103135 Ga0495644_0103135_111_632 151
61 3300046648 Ga0495611_0002764 Ga0495611_0002764_4919_5440 151
62 3300046491 Ga0495584_0108992 Ga0495584_0108992_682_1203 152
63 3300046492 Ga0495585_0029686 Ga0495585_0029686_1223_1744 152
64 3300046501 Ga0495607_0229118 Ga0495607_0229118_276_800 152
65 3300046506 Ga0495583_0103257 Ga0495583_0103257_12_533 152
66 3300046518 Ga0495631_0179706 Ga0495631_0179706_285_806 152
67 3300046519 Ga0495632_0009088 Ga0495632_0009088_1690_2211 152
68 3300046522 Ga0495643_0112933 Ga0495643_0112933_754_1275 152
69 3300046528 Ga0495642_0011294 Ga0495642_0011294_923_1444 152
70 3300046538 Ga0495609_0012434 Ga0495609_0012434_1400_1921 152
71 3300046542 Ga0495597_0081612 Ga0495597_0081612_118_639 152
72 3300046616 Ga0495668_0024190 Ga0495668_0024190_407_928 152
73 3300046665 Ga0495661_0129617 Ga0495661_0129617_605_1126 152
74 3300047320 Ga0495672_0023423 Ga0495672_0023423_3182_3706 152
75 3300047323 Ga0495683_0110145 Ga0495683_0110145_72_593 152
76 3300047470 Ga0495681_0175133 Ga0495681_0175133_160_681 152
77 3300048091 Ga0495626_0054729 Ga0495626_0054729_339_860 152
78 3300049460 Ga0495682_0031783 Ga0495682_0031783_78_599 152
79 3300046491 Ga0495584_0002756 Ga0495584_0002756_5484_6002 153
80 3300046492 Ga0495585_0000005 Ga0495585_0000005_289807_290325 153
81 3300046492 Ga0495585_0000162 Ga0495585_0000162_3631_4149 153
82 3300046500 Ga0495596_0006790 Ga0495596_0006790_1400_1918 153
83 3300046513 Ga0495616_0019529 Ga0495616_0019529_96_614 153
84 3300046524 Ga0495648_0000033 Ga0495648_0000033_160892_161410 153
85 3300046530 Ga0495654_0045702 Ga0495654_0045702_1177_1710 153
86 3300046538 Ga0495609_0031689 Ga0495609_0031689_947_1465 153
87 3300046542 Ga0495597_0027208 Ga0495597_0027208_328_861 153
88 3300046558 Ga0495633_0012297 Ga0495633_0012297_146_664 153
89 3300046664 Ga0495659_0000074 Ga0495659_0000074_10055_10588 153
90 3300046691 Ga0495670_0233139 Ga0495670_0233139_182_700 153
91 3300046692 Ga0495671_0000493 Ga0495671_0000493_3868_4401 153
92 3300047320 Ga0495672_0000026 Ga0495672_0000026_159631_160164 153
93 3300047323 Ga0495683_0000072 Ga0495683_0000072_97035_97553 153
94 3300048924 Ga0496121_0006051 Ga0496121_0006051_14154_14615 153
95 3300048928 Ga0496125_0000720 Ga0496125_0000720_32846_33307 153
96 3300046491 Ga0495584_0000006 Ga0495584_0000006_281210_281728 154
97 3300046491 Ga0495584_0199363 Ga0495584_0199363_47_562 154
98 3300046492 Ga0495585_0022255 Ga0495585_0022255_1183_1698 154
99 3300046507 Ga0495606_0018361 Ga0495606_0018361_1124_1642 154
100 3300046518 Ga0495631_0099219 Ga0495631_0099219_556_1071 154
101 3300046525 Ga0495663_0163041 Ga0495663_0163041_200_715 154
102 3300046528 Ga0495642_0014849 Ga0495642_0014849_391_906 154
103 3300046542 Ga0495597_0073915 Ga0495597_0073915_351_866 154
104 3300046615 Ga0495656_0006282 Ga0495656_0006282_15_530 154
105 3300046616 Ga0495668_0014164 Ga0495668_0014164_3814_4329 154
106 3300046648 Ga0495611_0048111 Ga0495611_0048111_441_956 154
107 3300046665 Ga0495661_0100244 Ga0495661_0100244_37_552 154
108 3300046691 Ga0495670_0041935 Ga0495670_0041935_1058_1573 154
109 3300047445 Ga0495677_0162067 Ga0495677_0162067_209_724 154
110 3300047470 Ga0495681_0111598 Ga0495681_0111598_560_1075 154
111 3300042139 Ga0450904_000694 Ga0450904_000694_2248_2772 156
112 3300003215 JGI25153J46596_10032656 JGI25153J46596_100326562 159
113 3300025245 Ga0207425_1001550 Ga0207425_10015506 159
114 3300025294 Ga0209025_1004319 Ga0209025_10043196 159
115 3300025297 Ga0209758_1000379 Ga0209758_100037957 159
116 3300046453 Ga0495627_127283 Ga0495627_127283_70_567 159
117 3300046474 Ga0495605_0000018 Ga0495605_0000018_200636_201133 159
118 3300046501 Ga0495607_0004897 Ga0495607_0004897_8420_8917 159
119 3300046507 Ga0495606_0000101 Ga0495606_0000101_57424_57921 159
120 3300046512 Ga0495610_0007220 Ga0495610_0007220_1731_2228 159
121 3300046512 Ga0495610_0175579 Ga0495610_0175579_240_722 159
122 3300046542 Ga0495597_0339428 Ga0495597_0339428_64_561 159
123 3300046558 Ga0495633_0000297 Ga0495633_0000297_31689_32186 159
124 3300046558 Ga0495633_0008436 Ga0495633_0008436_4357_4854 159
125 3300046558 Ga0495633_0031449 Ga0495633_0031449_518_1015 159
126 3300046616 Ga0495668_0000712 Ga0495668_0000712_35055_35552 159
127 3300047472 Ga0495686_0041775 Ga0495686_0041775_1914_2411 159
128 3300014497 Ga0182008_10025278 Ga0182008_100252782 161
129 3300046492 Ga0495585_0020793 Ga0495585_0020793_692_1210 161
130 3300046501 Ga0495607_0000447 Ga0495607_0000447_15049_15546 161
131 3300046506 Ga0495583_0101509 Ga0495583_0101509_587_1105 161
132 3300046507 Ga0495606_0000814 Ga0495606_0000814_12685_13182 161
133 3300046507 Ga0495606_0046273 Ga0495606_0046273_2235_2753 161
134 3300046507 Ga0495606_0248745 Ga0495606_0248745_117_635 161
135 3300046515 Ga0495620_0017241 Ga0495620_0017241_2467_2985 161
136 3300046518 Ga0495631_0023840 Ga0495631_0023840_2000_2518 161
137 3300046524 Ga0495648_0061891 Ga0495648_0061891_1557_2075 161
138 3300046528 Ga0495642_0001868 Ga0495642_0001868_5672_6190 161
139 3300046648 Ga0495611_0009847 Ga0495611_0009847_2227_2745 161
140 3300046684 Ga0495669_0308161 Ga0495669_0308161_199_717 161
141 3300046810 Ga0495660_0024157 Ga0495660_0024157_2580_3098 161
142 3300047323 Ga0495683_0183522 Ga0495683_0183522_174_692 161
143 3300047470 Ga0495681_0160597 Ga0495681_0160597_190_708 161
144 3300048924 Ga0496121_0061060 Ga0496121_0061060_2587_3072 161
145 3300046457 Ga0495590_0003852 Ga0495590_0003852_1944_2468 162
146 3300046460 Ga0495638_0002024 Ga0495638_0002024_3587_4111 162
147 3300046491 Ga0495584_0002193 Ga0495584_0002193_656_1180 162
148 3300046501 Ga0495607_0001792 Ga0495607_0001792_3778_4302 162
149 3300046506 Ga0495583_0116895 Ga0495583_0116895_337_861 162
150 3300046513 Ga0495616_0001133 Ga0495616_0001133_3472_3996 162
151 3300046522 Ga0495643_0036288 Ga0495643_0036288_624_1148 162
152 3300046524 Ga0495648_0015834 Ga0495648_0015834_2415_2924 162
153 3300046524 Ga0495648_0074453 Ga0495648_0074453_423_947 162
154 3300046528 Ga0495642_0001468 Ga0495642_0001468_1681_2205 162
155 3300046538 Ga0495609_0000127 Ga0495609_0000127_78066_78590 162
156 3300046542 Ga0495597_0030599 Ga0495597_0030599_960_1484 162
157 3300046616 Ga0495668_0001514 Ga0495668_0001514_10949_11473 162
158 3300046648 Ga0495611_0284056 Ga0495611_0284056_178_702 162
159 3300046660 Ga0495625_0002580 Ga0495625_0002580_6640_7164 162
160 3300046664 Ga0495659_0000368 Ga0495659_0000368_6640_7164 162
161 3300046665 Ga0495661_0001765 Ga0495661_0001765_2967_3491 162
162 3300046684 Ga0495669_0143300 Ga0495669_0143300_531_1055 162
163 3300046692 Ga0495671_0005314 Ga0495671_0005314_2061_2558 162
164 3300046694 Ga0495649_0001632 Ga0495649_0001632_9701_10225 162
165 3300046694 Ga0495649_0103828 Ga0495649_0103828_816_1313 162
166 3300046810 Ga0495660_0012541 Ga0495660_0012541_3554_4078 162
167 3300047318 Ga0495636_0000591 Ga0495636_0000591_12137_12661 162
168 3300047443 Ga0495687_002360 Ga0495687_002360_14503_15027 162
169 3300047445 Ga0495677_0002240 Ga0495677_0002240_656_1180 162
170 3300047446 Ga0495679_016395 Ga0495679_016395_1830_2354 162
171 3300047447 Ga0495685_093120 Ga0495685_093120_209_733 162
172 3300047470 Ga0495681_0001743 Ga0495681_0001743_14894_15418 162
173 3300048914 Ga0496111_0589714 Ga0496111_0589714_58_567 162
174 3300048924 Ga0496121_0215461 Ga0496121_0215461_227_733 162
175 3300049459 Ga0495678_076523 Ga0495678_076523_435_959 162
176 3300049460 Ga0495682_0048076 Ga0495682_0048076_874_1398 162
177 3300003775 Ga0055524_1000038 Ga0055524_100003890 163
178 3300006948 Ga0099826_10000008 Ga0099826_10000008159 163
179 3300025263 Ga0209565_1005640 Ga0209565_10056405 163
180 3300025295 Ga0209564_1016727 Ga0209564_10167271 163
181 3300025299 Ga0209256_1000018 Ga0209256_1000018164 163
182 3300027666 Ga0209282_1000005 Ga0209282_1000005159 163
183 3300046512 Ga0495610_0009501 Ga0495610_0009501_3307_3816 163
184 3300046558 Ga0495633_0005227 Ga0495633_0005227_3566_4075 163
185 3300046694 Ga0495649_0068232 Ga0495649_0068232_392_889 163
186 3300049671 Ga0501238_001041 Ga0501238_001041_572_1075 163
187 3300053145 Ga0500586_001756 Ga0500586_001756_2812_3321 163
188 3300003322 rootL2_10023899 rootL2_100238994 164
189 3300037312 Ga0395899_0247105 Ga0395899_0247105_132_644 164
190 3300046452 Ga0495617_000809 Ga0495617_000809_11114_11629 164
191 3300046457 Ga0495590_0000012 Ga0495590_0000012_164113_164619 164
192 3300046460 Ga0495638_0000047 Ga0495638_0000047_153603_154109 164
193 3300046460 Ga0495638_0083695 Ga0495638_0083695_896_1408 164
194 3300046471 Ga0495650_0001202 Ga0495650_0001202_24546_25052 164
195 3300046475 Ga0495639_0026300 Ga0495639_0026300_1109_1615 164
196 3300046506 Ga0495583_0000092 Ga0495583_0000092_59503_60009 164
197 3300046507 Ga0495606_0000409 Ga0495606_0000409_3720_4238 164
198 3300046507 Ga0495606_0005089 Ga0495606_0005089_11088_11600 164
199 3300046512 Ga0495610_0005660 Ga0495610_0005660_4424_4936 164
200 3300046512 Ga0495610_0012253 Ga0495610_0012253_1856_2368 164
201 3300046520 Ga0495637_0001526 Ga0495637_0001526_9554_10069 164
202 3300046522 Ga0495643_0000234 Ga0495643_0000234_60224_60736 164
203 3300046522 Ga0495643_0000388 Ga0495643_0000388_54067_54567 164
204 3300046524 Ga0495648_0000019 Ga0495648_0000019_211766_212272 164
205 3300046524 Ga0495648_0074431 Ga0495648_0074431_1208_1720 164
206 3300046524 Ga0495648_0145586 Ga0495648_0145586_546_1058 164
207 3300046528 Ga0495642_0002397 Ga0495642_0002397_2807_3313 164
208 3300046528 Ga0495642_0061963 Ga0495642_0061963_344_877 164
209 3300046530 Ga0495654_0009835 Ga0495654_0009835_988_1521 164
210 3300046538 Ga0495609_0048656 Ga0495609_0048656_975_1487 164
211 3300046542 Ga0495597_0000075 Ga0495597_0000075_47727_48227 164
212 3300046542 Ga0495597_0000378 Ga0495597_0000378_34351_34863 164
213 3300046542 Ga0495597_0001275 Ga0495597_0001275_14734_15267 164
214 3300046557 Ga0495622_0000037 Ga0495622_0000037_64775_65281 164
215 3300046558 Ga0495633_0000086 Ga0495633_0000086_5792_6298 164
216 3300046616 Ga0495668_0006539 Ga0495668_0006539_3750_4256 164
217 3300046616 Ga0495668_0011972 Ga0495668_0011972_4246_4779 164
218 3300046660 Ga0495625_0000432 Ga0495625_0000432_3915_4421 164
219 3300046660 Ga0495625_0007654 Ga0495625_0007654_5541_6053 164
220 3300046660 Ga0495625_0129242 Ga0495625_0129242_909_1421 164
221 3300046691 Ga0495670_0029539 Ga0495670_0029539_1396_1902 164
222 3300046694 Ga0495649_0002914 Ga0495649_0002914_7466_7978 164
223 3300046694 Ga0495649_0069156 Ga0495649_0069156_728_1228 164
224 3300046810 Ga0495660_0011538 Ga0495660_0011538_1360_1860 164
225 3300047320 Ga0495672_0000226 Ga0495672_0000226_22812_23324 164
226 3300047320 Ga0495672_0089645 Ga0495672_0089645_693_1226 164
227 3300047445 Ga0495677_0005383 Ga0495677_0005383_3981_4493 164
228 3300047445 Ga0495677_0030965 Ga0495677_0030965_1180_1686 164
229 3300047469 Ga0495673_0000008 Ga0495673_0000008_466563_467078 164
230 3300049459 Ga0495678_000130 Ga0495678_000130_3855_4367 164
231 3300049459 Ga0495678_038950 Ga0495678_038950_1059_1565 164
232 3300049459 Ga0495678_057497 Ga0495678_057497_537_1043 164
233 3300049460 Ga0495682_0144849 Ga0495682_0144849_218_730 164
234 3300050496 nmdc:mga07m45_295450_c1 nmdc:mga07m45_295450_c1_318_824 164
235 iso_pu_bacteria 2842711865 2842715714 164
236 3300014969 Ga0157376_10100701 Ga0157376_101007012 165
237 3300046648 Ga0495611_0003057 Ga0495611_0003057_6926_7423 165
238 iso_pu_bacteria 2643221645 2644250651 165
239 iso_pu_bacteria 2738541280 2738738590 165
240 iso_pu_bacteria 2738541300 2738842601 165
241 iso_pu_bacteria 2738543018 2739273348 165
242 iso_pu_bacteria 2738543030 2739342392 165
243 3300003771 Ga0055526_1000007 Ga0055526_1000007224 166
244 3300009036 Ga0105244_10001568 Ga0105244_100015689 166
245 3300009093 Ga0105240_10002667 Ga0105240_100026677 166
246 3300009551 Ga0105238_10390730 Ga0105238_103907301 166
247 3300014497 Ga0182008_10181198 Ga0182008_101811982 166
248 3300025295 Ga0209564_1000010 Ga0209564_1000010451 166
249 3300025728 Ga0207655_1002256 Ga0207655_10022567 166
250 3300030744 Ga0316181_1247568 Ga0316181_12475682 166
251 3300037471 Ga0395905_0409745 Ga0395905_0409745_444_959 166
252 3300046452 Ga0495617_077718 Ga0495617_077718_132_656 166
253 3300046455 Ga0495603_0031409 Ga0495603_0031409_175_708 166
254 3300046460 Ga0495638_0009661 Ga0495638_0009661_3709_4215 166
255 3300046491 Ga0495584_0000570 Ga0495584_0000570_7186_7692 166
256 3300046491 Ga0495584_0022479 Ga0495584_0022479_2488_3012 166
257 3300046492 Ga0495585_0000049 Ga0495585_0000049_42093_42611 166
258 3300046492 Ga0495585_0003133 Ga0495585_0003133_7173_7691 166
259 3300046492 Ga0495585_0008309 Ga0495585_0008309_4576_5082 166
260 3300046492 Ga0495585_0013680 Ga0495585_0013680_4097_4603 166
261 3300046492 Ga0495585_0021295 Ga0495585_0021295_2143_2667 166
262 3300046492 Ga0495585_0025442 Ga0495585_0025442_2653_3171 166
263 3300046492 Ga0495585_0103212 Ga0495585_0103212_821_1354 166
264 3300046499 Ga0495594_0013825 Ga0495594_0013825_1698_2231 166
265 3300046499 Ga0495594_0183411 Ga0495594_0183411_283_813 166
266 3300046500 Ga0495596_0000013 Ga0495596_0000013_3709_4224 166
267 3300046501 Ga0495607_0015793 Ga0495607_0015793_1269_1793 166
268 3300046501 Ga0495607_0023285 Ga0495607_0023285_2206_2730 166
269 3300046501 Ga0495607_0100069 Ga0495607_0100069_352_858 166
270 3300046501 Ga0495607_0232661 Ga0495607_0232661_44_559 166
271 3300046506 Ga0495583_0001098 Ga0495583_0001098_24939_25457 166
272 3300046506 Ga0495583_0024067 Ga0495583_0024067_584_1102 166
273 3300046506 Ga0495583_0038753 Ga0495583_0038753_1686_2204 166
274 3300046512 Ga0495610_0048017 Ga0495610_0048017_841_1347 166
275 3300046513 Ga0495616_0001323 Ga0495616_0001323_6907_7413 166
276 3300046513 Ga0495616_0114034 Ga0495616_0114034_29_544 166
277 3300046518 Ga0495631_0083278 Ga0495631_0083278_636_1151 166
278 3300046523 Ga0495644_0000379 Ga0495644_0000379_3372_3896 166
279 3300046523 Ga0495644_0037780 Ga0495644_0037780_804_1319 166
280 3300046526 Ga0495666_0025959 Ga0495666_0025959_1490_2023 166
281 3300046526 Ga0495666_0079858 Ga0495666_0079858_849_1382 166
282 3300046542 Ga0495597_0004294 Ga0495597_0004294_3930_4448 166
283 3300046557 Ga0495622_0031845 Ga0495622_0031845_222_728 166
284 3300046557 Ga0495622_0211332 Ga0495622_0211332_83_616 166
285 3300046558 Ga0495633_0002917 Ga0495633_0002917_4895_5401 166
286 3300046558 Ga0495633_0003169 Ga0495633_0003169_3707_4231 166
287 3300046558 Ga0495633_0033862 Ga0495633_0033862_1271_1786 166
288 3300046615 Ga0495656_0089422 Ga0495656_0089422_12_536 166
289 3300046615 Ga0495656_0551325 Ga0495656_0551325_28_534 166
290 3300046616 Ga0495668_0005034 Ga0495668_0005034_3016_3534 166
291 3300046648 Ga0495611_0005095 Ga0495611_0005095_3809_4333 166
292 3300046648 Ga0495611_0153061 Ga0495611_0153061_430_945 166
293 3300046660 Ga0495625_0014160 Ga0495625_0014160_2630_3169 166
294 3300046660 Ga0495625_0024019 Ga0495625_0024019_82_588 166
295 3300046660 Ga0495625_0117572 Ga0495625_0117572_249_755 166
296 3300046665 Ga0495661_0018067 Ga0495661_0018067_3078_3584 166
297 3300046665 Ga0495661_0018226 Ga0495661_0018226_2059_2577 166
298 3300046665 Ga0495661_0021666 Ga0495661_0021666_2970_3485 166
299 3300046674 Ga0495588_0422650 Ga0495588_0422650_74_604 166
300 3300046691 Ga0495670_0003303 Ga0495670_0003303_3829_4347 166
301 3300046691 Ga0495670_0007293 Ga0495670_0007293_1857_2375 166
302 3300046691 Ga0495670_0041500 Ga0495670_0041500_1315_1821 166
303 3300047318 Ga0495636_0001424 Ga0495636_0001424_3078_3584 166
304 3300047320 Ga0495672_0089717 Ga0495672_0089717_616_1122 166
305 3300047321 Ga0495676_0037513 Ga0495676_0037513_1882_2415 166
306 3300047323 Ga0495683_0066650 Ga0495683_0066650_524_1030 166
307 3300047445 Ga0495677_0007617 Ga0495677_0007617_191_715 166
308 3300047469 Ga0495673_0007222 Ga0495673_0007222_3475_3981 166
309 3300047470 Ga0495681_0057139 Ga0495681_0057139_268_801 166
310 3300047472 Ga0495686_0191448 Ga0495686_0191448_628_1134 166
311 3300048091 Ga0495626_0094023 Ga0495626_0094023_254_772 166
312 3300048906 Ga0496103_0006209 Ga0496103_0006209_4055_4573 166
313 3300048917 Ga0496114_0147326 Ga0496114_0147326_212_730 166
314 3300048919 Ga0496116_0002196 Ga0496116_0002196_1861_2361 166
315 3300048925 Ga0496122_0000121 Ga0496122_0000121_46482_46982 166
316 3300048926 Ga0496123_0000040 Ga0496123_0000040_46782_47282 166
317 3300048927 Ga0496124_0386341 Ga0496124_0386341_83_583 166
318 3300048928 Ga0496125_0045888 Ga0496125_0045888_1824_2324 166
319 3300049679 Ga0501249_001082 Ga0501249_001082_1601_2119 166
320 3300049766 Ga0501269_000461 Ga0501269_000461_5605_6123 166
321 iso_pu_bacteria 2904424332 2904428249 166
322 3300003322 rootL2_10033398 rootL2_100333982 167
323 3300003763 Ga0055529_1000015 Ga0055529_1000015189 167
324 3300025272 Ga0209455_1000031 Ga0209455_1000031190 167
325 3300037471 Ga0395905_0000955 Ga0395905_0000955_10607_11143 167
326 3300046528 Ga0495642_0334118 Ga0495642_0334118_91_612 167
327 3300046530 Ga0495654_0124876 Ga0495654_0124876_360_881 167
328 iso_pu_bacteria 2857558681 2857558882 167
329 3300015262 Ga0182007_10008626 Ga0182007_100086264 168
330 3300015265 Ga0182005_1000327 Ga0182005_100032724 168
331 3300031711 Ga0265314_10016398 Ga0265314_100163982 168
332 3300046462 Ga0495651_0015447 Ga0495651_0015447_1823_2404 168
333 3300046463 Ga0495653_0022531 Ga0495653_0022531_1899_2474 168
334 3300046471 Ga0495650_0000226 Ga0495650_0000226_115188_115733 168
335 3300046507 Ga0495606_0000066 Ga0495606_0000066_125324_125869 168
336 3300046511 Ga0495608_0038035 Ga0495608_0038035_817_1392 168
337 3300046516 Ga0495628_0000315 Ga0495628_0000315_23383_23964 168
338 3300046516 Ga0495628_0007175 Ga0495628_0007175_5225_5800 168
339 3300046529 Ga0495652_0085612 Ga0495652_0085612_1899_2474 168
340 3300046529 Ga0495652_0127019 Ga0495652_0127019_1297_1878 168
341 3300046557 Ga0495622_0032916 Ga0495622_0032916_261_836 168
342 3300046642 Ga0495634_0271631 Ga0495634_0271631_101_676 168
343 3300046675 Ga0495657_0030526 Ga0495657_0030526_317_892 168
344 3300046678 Ga0495599_0004724 Ga0495599_0004724_2463_3038 168
345 3300046679 Ga0495623_0015586 Ga0495623_0015586_4060_4641 168
346 3300046679 Ga0495623_0051832 Ga0495623_0051832_229_804 168
347 3300046680 Ga0495646_0043597 Ga0495646_0043597_2152_2733 168
348 3300046683 Ga0495658_0049212 Ga0495658_0049212_1081_1656 168
349 3300046809 Ga0495600_0003375 Ga0495600_0003375_3733_4308 168
350 3300047317 Ga0495604_0011517 Ga0495604_0011517_3990_4565 168
351 3300047321 Ga0495676_0227603 Ga0495676_0227603_160_735 168
352 3300048088 Ga0495602_0065989 Ga0495602_0065989_275_850 168
353 3300048088 Ga0495602_0312708 Ga0495602_0312708_215_790 168
354 3300053077 Ga0495601_0008185 Ga0495601_0008185_3937_4512 168
355 3300053077 Ga0495601_0326889 Ga0495601_0326889_68_649 168
356 3300053119 Ga0500595_003105 Ga0500595_003105_3819_4394 168
357 3300053141 Ga0500574_002003 Ga0500574_002003_291_866 168
358 3300053154 Ga0500619_002584 Ga0500619_002584_2484_3059 168
359 iso_pu_bacteria 2548876994 2550692770 168
360 iso_pu_bacteria 2818991436 2819541437 168
361 iso_pu_bacteria 2818991445 2819593678 168
362 iso_pu_bacteria 2884811622 2884815854 168
363 iso_pu_bacteria 2884836552 2884837879 168
364 iso_pu_bacteria 2884852848 2884854171 168
365 iso_pu_bacteria 2896154374 2896154712 168
366 3300031901 Ga0307406_10806364 Ga0307406_108063641 169
367 3300048927 Ga0496124_0005845 Ga0496124_0005845_7836_8417 169
368 3300010375 Ga0105239_10404757 Ga0105239_104047572 170
369 3300046474 Ga0495605_0311616 Ga0495605_0311616_20_550 170
370 3300046491 Ga0495584_0213608 Ga0495584_0213608_211_738 170
371 3300047321 Ga0495676_0071809 Ga0495676_0071809_729_1256 170
372 3300002738 JGI25154J39366_1001206 JGI25154J39366_10012068 171
373 3300025233 Ga0209437_103908 Ga0209437_1039084 171
374 3300025246 Ga0209646_1000042 Ga0209646_1000042274 171
375 3300025250 Ga0209026_1007015 Ga0209026_10070152 171
376 3300046557 Ga0495622_0000155 Ga0495622_0000155_3788_4333 171
377 3300002704 JGI25155J39150_1000256 JGI25155J39150_10002566 172
378 3300002705 JGI25156J39149_1008863 JGI25156J39149_10088632 172
379 3300002738 JGI25154J39366_1000474 JGI25154J39366_10004747 172
380 3300005331 Ga0070670_100267408 Ga0070670_1002674083 172
381 3300005563 Ga0068855_100169709 Ga0068855_1001697093 172
382 3300005563 Ga0068855_100589920 Ga0068855_1005899202 172
383 3300005614 Ga0068856_100059033 Ga0068856_1000590333 172
384 3300005616 Ga0068852_100077869 Ga0068852_1000778694 172
385 3300009093 Ga0105240_10038896 Ga0105240_100388966 172
386 3300014497 Ga0182008_10112828 Ga0182008_101128282 172
387 3300025206 Ga0209435_100074 Ga0209435_10007444 172
388 3300025228 Ga0209672_106567 Ga0209672_1065672 172
389 3300025233 Ga0209437_100072 Ga0209437_100072196 172
390 3300025246 Ga0209646_1000057 Ga0209646_1000057163 172
391 3300025250 Ga0209026_1002546 Ga0209026_10025462 172
392 3300025256 Ga0209759_1000112 Ga0209759_100011274 172
393 3300025913 Ga0207695_10005170 Ga0207695_100051707 172
394 3300025913 Ga0207695_10019098 Ga0207695_100190986 172
395 3300025924 Ga0207694_10131578 Ga0207694_101315781 172
396 3300025925 Ga0207650_10270684 Ga0207650_102706843 172
397 3300025949 Ga0207667_10006737 Ga0207667_1000673715 172
398 3300026078 Ga0207702_10070416 Ga0207702_100704162 172
399 3300026142 Ga0207698_10139652 Ga0207698_101396521 172
400 3300030735 Ga0316178_1120006 Ga0316178_11200062 172
401 3300030736 Ga0316180_1101610 Ga0316180_11016102 172
402 3300030745 Ga0316182_1126418 Ga0316182_11264182 172
403 3300032126 Ga0307415_100685472 Ga0307415_1006854722 172
404 3300046516 Ga0495628_0202342 Ga0495628_0202342_493_1092 172
405 3300046529 Ga0495652_0011880 Ga0495652_0011880_349_948 172
406 3300046660 Ga0495625_0002528 Ga0495625_0002528_5018_5557 172
407 3300046680 Ga0495646_0003302 Ga0495646_0003302_6966_7589 172
408 3300046690 Ga0495624_0266230 Ga0495624_0266230_104_703 172
409 3300048907 Ga0496104_0039563 Ga0496104_0039563_1567_2136 172
410 3300048928 Ga0496125_0000995 Ga0496125_0000995_42523_43062 172
411 3300048929 Ga0496126_0269508 Ga0496126_0269508_217_756 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05751

FixH

FixH

23

188

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g5a-assembly1.cif.gz_B crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution 0.7477 73 155
3wih-assembly2.cif.gz_B crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a. 0.6779 75 155
1fnh-assembly1.cif.gz_A crystal structure of heparin and integrin binding segment of human fibronectin 0.6702 81 155
6sws-assembly2.cif.gz_C-3 the dbb dimerization domain of b-cell adaptor for pi3k (bcap) is required for down regulation of inflammatory signalling through the toll-like receptor pathway 0.659 83 155
6mfa-assembly1.cif.gz_A fragment of human fibronectin containing the 4th-7th type iii domains 0.6582 73 154
ID Description Score Start End Superfamily
4g5aB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7428 73 155 2.60.40.3080
5m5eC01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6964 74 159 2.60.40.10
af_Q54QK8_440_1064_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6839 70 162 2.60.40.10
af_Q54GQ4_54_135_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6817 75 154 2.60.40.10
3wihB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6779 75 155 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3D3PNZ7-F1-model_v4 Cytochrome oxidase assembly protein 0.9533 98 169
AF-A0A3D3PNZ7-F1-model_v4 Cytochrome oxidase assembly protein 0.9168 98 169
AF-A0A351SDB5-F1-model_v4 Uncharacterized protein 0.8982 52 164
AF-A0A090SCY2-F1-model_v4 deleted 0.8792 54 164
AF-A0A2T4CW58-F1-model_v4 deleted 0.8764 98 166

Feature Viewer

pLDDT pTM Quality
84.42 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map