F437582

General Info

Members Datasets Scaffolds Average Seq Length
411 212 822 194

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_0172919|Ga0451833_0172919_10_681
Length 223
Sequence MQKNLPKYTPEWVPRTAVWAEASHREVQYALCNDRRTLLWFGNQRAIEYHPTLMTIDDRDHPTHLIMDLDPPEGGGFDLVVQATGDLHVDGNHTVEDTGILIGEVFREALGDKAGVRRFASGSFPLDEALVEVALDLSGRPFVVYDVPFGEVLPLGEPPFNPEMVEHFWQSFATSAGLTLHVTKKAGTNTHHVIEATFKGVARCLRDAVRVEGTAVPSTKGSL

Samples

Sample ID Description Type Environment
1 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
106 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.73
Nodule 0
Rhizoplane 6.57
Rhizosphere 81.51
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451833_0172919 3300041491 Bacteria 704
2 JGI25407J50210_10002289 3300003373 Bacteria 4494
3 Ga0070683_100578577 3300005329 Bacteria 1074
4 Ga0070668_100079472 3300005347 Bacteria 2568
5 Ga0070669_100323441 3300005353 Bacteria 1246
6 Ga0070671_100033359 3300005355 Bacteria 4257
7 Ga0070709_10023218 3300005434 Bacteria 3639
8 Ga0070710_10068163 3300005437 Bacteria 2043
9 Ga0070711_100134463 3300005439 Bacteria 1846
10 Ga0070678_100970738 3300005456 Bacteria 780
11 Ga0068867_100019892 3300005459 Bacteria 4785
12 Ga0070685_10241816 3300005466 Bacteria 1192
13 Ga0070706_100532198 3300005467 Bacteria 1093
14 Ga0070686_100190390 3300005544 Bacteria 1464
15 Ga0070665_100899299 3300005548 Bacteria 898
16 Ga0070702_100434959 3300005615 Bacteria 948
17 Ga0068852_101514777 3300005616 Bacteria 693
18 Ga0068859_100377588 3300005617 Bacteria 1513
19 Ga0068864_100838706 3300005618 Bacteria 905
20 Ga0068866_10006390 3300005718 Bacteria 4908
21 Ga0068863_100496260 3300005841 Bacteria 1202
22 Ga0068858_100865426 3300005842 Bacteria 883
23 Ga0068860_100007451 3300005843 Bacteria 10941
24 Ga0068860_100189132 3300005843 Bacteria 1992
25 Ga0068860_100878500 3300005843 Bacteria 912
26 Ga0068862_100804179 3300005844 Bacteria 918
27 Ga0081455_10106029 3300005937 Bacteria 2244
28 Ga0081455_10514880 3300005937 Bacteria 800
29 Ga0081538_10000131 3300005981 Bacteria 77253
30 Ga0081538_10025446 3300005981 Bacteria 4172
31 Ga0070717_10454473 3300006028 Bacteria 1155
32 Ga0075365_10013322 3300006038 Bacteria 4912
33 Ga0075365_10129058 3300006038 Bacteria 1749
34 Ga0075365_10217217 3300006038 Unclassified 1341
35 Ga0075365_10236920 3300006038 Bacteria 1282
36 Ga0075365_10379669 3300006038 Bacteria 997
37 Ga0075363_100017330 3300006048 Bacteria 3571
38 Ga0075364_10010188 3300006051 Bacteria 5669
39 Ga0075364_10011843 3300006051 Bacteria 5310
40 Ga0075364_10016746 3300006051 Bacteria 4566
41 Ga0075364_10124262 3300006051 Bacteria 1729
42 Ga0075364_10172164 3300006051 Bacteria 1464
43 Ga0075362_10065028 3300006177 Bacteria 1656
44 Ga0075362_10083363 3300006177 Bacteria 1476
45 Ga0075367_10037801 3300006178 Bacteria 2807
46 Ga0075367_10066116 3300006178 Bacteria 2166
47 Ga0075367_10506442 3300006178 Bacteria 766
48 Ga0075367_10548147 3300006178 Bacteria 734
49 Ga0075428_100000247 3300006844 Bacteria 52987
50 Ga0075428_100015292 3300006844 Bacteria 8510
51 Ga0075428_100268551 3300006844 Bacteria 1836
52 Ga0075430_100000590 3300006846 Bacteria 27564
53 Ga0075430_100025653 3300006846 Bacteria 5016
54 Ga0075430_100157353 3300006846 Bacteria 1891
55 Ga0075431_100002015 3300006847 Bacteria 19394
56 Ga0075431_100002898 3300006847 Bacteria 16590
57 Ga0075431_100748877 3300006847 Bacteria 952
58 Ga0075433_10474546 3300006852 Bacteria 1102
59 Ga0075429_100000279 3300006880 Bacteria 36024
60 Ga0075429_100001235 3300006880 Bacteria 20728
61 Ga0075429_100032067 3300006880 Bacteria 4567
62 Ga0097620_100377618 3300006931 Bacteria 1513
63 Ga0111539_10075176 3300009094 Bacteria 3980
64 Ga0111539_10094035 3300009094 Bacteria 3521
65 Ga0111539_10794968 3300009094 Bacteria 1101
66 Ga0111539_11563740 3300009094 Bacteria 765
67 Ga0105245_10008048 3300009098 Bacteria 9218
68 Ga0105245_10553657 3300009098 Bacteria 1172
69 Ga0105245_11361087 3300009098 Bacteria 759
70 Ga0114129_10000179 3300009147 Bacteria 70108
71 Ga0114129_10012055 3300009147 Bacteria 12299
72 Ga0114129_10097178 3300009147 Bacteria 4077
73 Ga0114129_10231278 3300009147 Bacteria 2490
74 Ga0105243_10022906 3300009148 Bacteria 4748
75 Ga0105243_10195256 3300009148 Bacteria 1771
76 Ga0105243_11436228 3300009148 Bacteria 712
77 Ga0105241_10074569 3300009174 Bacteria 2642
78 Ga0105241_10369848 3300009174 Bacteria 1250
79 Ga0105248_10300760 3300009177 Bacteria 1807
80 Ga0105248_10457319 3300009177 Bacteria 1439
81 Ga0105248_11538556 3300009177 Bacteria 753
82 Ga0105249_10699983 3300009553 Bacteria 1073
83 Ga0105239_10173664 3300010375 Bacteria 2410
84 Ga0105239_11465662 3300010375 Bacteria 788
85 Ga0105246_10729629 3300011119 Bacteria 871
86 Ga0105246_10768773 3300011119 Bacteria 851
87 Ga0157378_10463730 3300013297 Bacteria 1259
88 Ga0163162_10170435 3300013306 Bacteria 2301
89 Ga0163162_10657237 3300013306 Bacteria 1172
90 Ga0163162_11243387 3300013306 Bacteria 845
91 Ga0157375_10073064 3300013308 Bacteria 3448
92 Ga0163163_11040728 3300014325 Bacteria 882
93 Ga0157380_10435802 3300014326 Bacteria 1254
94 Ga0157380_11258112 3300014326 Bacteria 786
95 Ga0157379_10109733 3300014968 Bacteria 2478
96 Ga0163161_10637837 3300017792 Bacteria 882
97 Ga0213876_10023878 3300021384 Bacteria 3228
98 Ga0207692_10179738 3300025898 Bacteria 1232
99 Ga0207643_10807754 3300025908 Bacteria 608
100 Ga0207684_10551011 3300025910 Bacteria 986
101 Ga0207663_10144283 3300025916 Bacteria 1662
102 Ga0207662_10028695 3300025918 Bacteria 3219
103 Ga0207657_10515821 3300025919 Bacteria 936
104 Ga0207681_10072208 3300025923 Bacteria 2410
105 Ga0207681_10175816 3300025923 Bacteria 1627
106 Ga0207681_10431255 3300025923 Bacteria 1070
107 Ga0207700_10192950 3300025928 Bacteria 1712
108 Ga0207706_10497926 3300025933 Bacteria 1052
109 Ga0207686_10267359 3300025934 Bacteria 1256
110 Ga0207709_10662625 3300025935 Bacteria 832
111 Ga0207670_10063636 3300025936 Bacteria 2525
112 Ga0207691_10098710 3300025940 Bacteria 2608
113 Ga0207711_11305545 3300025941 Bacteria 668
114 Ga0207661_10109494 3300025944 Bacteria 2334
115 Ga0207679_10639285 3300025945 Bacteria 962
116 Ga0207651_10641137 3300025960 Bacteria 932
117 Ga0207668_10156605 3300025972 Bacteria 1770
118 Ga0207668_10793953 3300025972 Bacteria 838
119 Ga0207640_10364286 3300025981 Bacteria 1166
120 Ga0207677_10270355 3300026023 Bacteria 1390
121 Ga0207677_10693639 3300026023 Bacteria 903
122 Ga0207708_10324763 3300026075 Bacteria 1257
123 Ga0207641_10665447 3300026088 Bacteria 1024
124 Ga0207641_10997303 3300026088 Bacteria 834
125 Ga0207648_10034481 3300026089 Bacteria 4461
126 Ga0207648_10516074 3300026089 Bacteria 1094
127 Ga0207676_10210179 3300026095 Bacteria 1726
128 Ga0207676_10863693 3300026095 Bacteria 886
129 Ga0207675_100012541 3300026118 Bacteria 7918
130 Ga0207683_10367547 3300026121 Bacteria 1321
131 Ga0207428_10025890 3300027907 Bacteria 4902
132 Ga0207428_10096504 3300027907 Bacteria 2289
133 Ga0207428_10135033 3300027907 Bacteria 1886
134 Ga0207428_10364400 3300027907 Bacteria 1062
135 Ga0268266_11048595 3300028379 Bacteria 789
136 Ga0268265_10166744 3300028380 Bacteria 1878
137 Ga0268264_10005318 3300028381 Bacteria 10904
138 Ga0268264_10111005 3300028381 Bacteria 2401
139 Ga0265327_10183500 3300031251 Bacteria 956
140 Ga0307410_10033117 3300031852 Bacteria 3334
141 Ga0307406_10624117 3300031901 Bacteria 892
142 Ga0307406_10868157 3300031901 Bacteria 766
143 Ga0307407_10007901 3300031903 Bacteria 4849
144 Ga0307412_10909396 3300031911 Bacteria 772
145 Ga0307409_100030565 3300031995 Bacteria 3872
146 Ga0307416_100879658 3300032002 Bacteria 995
147 Ga0307411_10010502 3300032005 Bacteria 4940
148 Ga0307415_100018650 3300032126 Bacteria 4196
149 Ga0373928_0000353 3300035084 Bacteria 9186
150 Ga0373932_0001031 3300035112 Bacteria 8048
151 Ga0373942_0136985 3300035207 Bacteria 777
152 Ga0316574_0600624 3300035398 Bacteria 680
153 Ga0373931_0000001 3300035691 Bacteria 634029
154 Ga0373931_0000022 3300035691 Bacteria 137028
155 Ga0373927_0317619 3300035695 Bacteria 1026
156 Ga0373937_0003642 3300036401 Bacteria 12998
157 Ga0400483_034849 3300039062 Bacteria 80050
158 Ga0400483_111982 3300039062 Bacteria 6965
159 Ga0400483_218408 3300039062 Bacteria 56101
160 Ga0436365_0238032 3300039437 Bacteria 8625
161 Ga0451791_1540764 3300041451 Bacteria 856
162 Ga0451793_0812557 3300041452 Bacteria 585
163 Ga0451797_1176678 3300041453 Bacteria 797
164 Ga0451849_1126969 3300041505 Bacteria 719
165 Ga0451853_1659573 3300041512 Bacteria 696
166 Ga0451853_2574778 3300041512 Bacteria 1437
167 Ga0439454_015863 3300042011 Bacteria 1059
168 Ga0439435_0071295 3300042436 Bacteria 1029
169 Ga0495592_0047394 3300046454 Bacteria 3201
170 Ga0495651_0015738 3300046462 Bacteria 5857
171 Ga0495653_0007023 3300046463 Bacteria 9242
172 Ga0495653_0076110 3300046463 Bacteria 2496
173 Ga0495582_0030803 3300046473 Bacteria 2947
174 Ga0495582_0275394 3300046473 Bacteria 966
175 Ga0495639_0259418 3300046475 Bacteria 861
176 Ga0495662_0132078 3300046476 Bacteria 1228
177 Ga0495584_0378381 3300046491 Bacteria 719
178 Ga0495608_0050999 3300046511 Bacteria 2744
179 Ga0495608_0095078 3300046511 Bacteria 1925
180 Ga0495618_0039436 3300046514 Bacteria 2969
181 Ga0495618_0151119 3300046514 Bacteria 1483
182 Ga0495628_0011650 3300046516 Bacteria 7428
183 Ga0495630_0015722 3300046517 Bacteria 5529
184 Ga0495630_0033141 3300046517 Bacteria 3852
185 Ga0495630_0067972 3300046517 Bacteria 2679
186 Ga0495652_0235796 3300046529 Bacteria 1365
187 Ga0495640_0164387 3300046533 Bacteria 1420
188 Ga0495640_0186680 3300046533 Bacteria 1319
189 Ga0495586_0055964 3300046535 Bacteria 2138
190 Ga0495586_0145319 3300046535 Bacteria 1333
191 Ga0495586_0214801 3300046535 Bacteria 1092
192 Ga0495587_0013674 3300046536 Bacteria 5098
193 Ga0495622_0211126 3300046557 Bacteria 862
194 Ga0495667_0004320 3300046559 Bacteria 9588
195 Ga0495667_0164107 3300046559 Bacteria 1428
196 Ga0495668_0173429 3300046616 Bacteria 1182
197 Ga0495634_0087648 3300046642 Bacteria 2026
198 Ga0495611_0332241 3300046648 Bacteria 699
199 Ga0495635_0186763 3300046663 Bacteria 1408
200 Ga0495588_0129374 3300046674 Bacteria 1332
201 Ga0495657_0006564 3300046675 Bacteria 9089
202 Ga0495658_0029135 3300046683 Bacteria 2985
203 Ga0495658_0092782 3300046683 Bacteria 1791
204 Ga0495613_0000201 3300046689 Bacteria 58736
205 Ga0495613_0245123 3300046689 Bacteria 1252
206 Ga0495613_0274746 3300046689 Bacteria 1171
207 Ga0495613_0489443 3300046689 Bacteria 829
208 Ga0495670_0197483 3300046691 Bacteria 1065
209 Ga0495589_0246743 3300046794 Bacteria 835
210 Ga0495600_0178802 3300046809 Bacteria 1367
211 Ga0495604_0223183 3300047317 Bacteria 1296
212 Ga0495674_0293488 3300047319 Bacteria 1329
213 Ga0495674_0418251 3300047319 Bacteria 1080
214 Ga0495672_0287278 3300047320 Bacteria 784
215 Ga0495676_0116507 3300047321 Bacteria 1951
216 Ga0495680_0008662 3300047322 Bacteria 9232
217 Ga0495680_0043484 3300047322 Bacteria 3556
218 Ga0495680_0405265 3300047322 Bacteria 941
219 Ga0495675_0016545 3300047444 Bacteria 4666
220 Ga0495684_0082850 3300047471 Bacteria 2433
221 Ga0495602_0113767 3300048088 Bacteria 2193
222 Ga0496100_0014352 3300048903 Bacteria 4599
223 Ga0496100_0454754 3300048903 Bacteria 982
224 Ga0496101_0006919 3300048904 Bacteria 7322
225 Ga0496101_0013369 3300048904 Bacteria 5496
226 Ga0496101_0304734 3300048904 Bacteria 1248
227 Ga0496102_0069855 3300048905 Bacteria 3224
228 Ga0496103_0024474 3300048906 Bacteria 3646
229 Ga0496104_0024728 3300048907 Bacteria 5529
230 Ga0496104_0142090 3300048907 Bacteria 2306
231 Ga0496104_0398289 3300048907 Bacteria 1289
232 Ga0496105_0018900 3300048908 Bacteria 5550
233 Ga0496105_0075961 3300048908 Bacteria 2774
234 Ga0496106_0671901 3300048909 Bacteria 827
235 Ga0496107_0300342 3300048910 Bacteria 1195
236 Ga0496108_0196910 3300048911 Bacteria 1748
237 Ga0496108_0376907 3300048911 Bacteria 1239
238 Ga0496109_0084236 3300048912 Bacteria 2933
239 Ga0496110_0533949 3300048913 Bacteria 1067
240 Ga0496113_0811478 3300048916 Bacteria 743
241 Ga0496114_0130387 3300048917 Bacteria 2171
242 Ga0496114_0195006 3300048917 Bacteria 1773
243 Ga0496114_0223064 3300048917 Bacteria 1655
244 Ga0496114_0258050 3300048917 Bacteria 1534
245 Ga0496115_0039221 3300048918 Bacteria 3760
246 Ga0501031_0032830 3300049568 Bacteria 3385
247 Ga0501031_0040679 3300049568 Bacteria 3035
248 Ga0501031_0052325 3300049568 Bacteria 2661
249 Ga0501031_0079785 3300049568 Bacteria 2133
250 Ga0501031_0574080 3300049568 Bacteria 726
251 Ga0501032_0008938 3300049569 Bacteria 7286
252 Ga0501032_0065975 3300049569 Bacteria 2420
253 Ga0501033_0001530 3300049570 Bacteria 20434
254 Ga0501033_0011056 3300049570 Bacteria 6911
255 Ga0501034_0000566 3300049571 Bacteria 58602
256 Ga0501034_0015239 3300049571 Bacteria 7900
257 Ga0501034_0027022 3300049571 Bacteria 5838
258 Ga0501034_0120755 3300049571 Bacteria 2607
259 Ga0501034_0168091 3300049571 Bacteria 2161
260 Ga0501036_0100825 3300049572 Bacteria 2442
261 Ga0501036_0260676 3300049572 Bacteria 1452
262 Ga0501036_0401844 3300049572 Bacteria 1143
263 Ga0501037_0004464 3300049573 Bacteria 10164
264 Ga0501037_0071412 3300049573 Bacteria 2525
265 Ga0501038_0066003 3300049574 Bacteria 3083
266 Ga0501038_0107850 3300049574 Bacteria 2310
267 Ga0501038_0132233 3300049574 Bacteria 2047
268 Ga0501038_0312790 3300049574 Bacteria 1230
269 Ga0501039_0004326 3300049575 Bacteria 10708
270 Ga0501039_0058738 3300049575 Bacteria 2980
271 Ga0501039_0153196 3300049575 Bacteria 1811
272 Ga0501039_0428046 3300049575 Bacteria 1039
273 Ga0501040_0028465 3300049576 Bacteria 3767
274 Ga0501041_0383701 3300049577 Bacteria 889
275 Ga0501042_0006039 3300049578 Bacteria 7842
276 Ga0501042_0033463 3300049578 Bacteria 3644
277 Ga0501042_0094362 3300049578 Bacteria 2149
278 Ga0501042_0277179 3300049578 Bacteria 1211
279 Ga0501043_0034071 3300049579 Bacteria 4006
280 Ga0501043_0058483 3300049579 Bacteria 3026
281 Ga0501043_0181600 3300049579 Bacteria 1639
282 Ga0501043_0233479 3300049579 Bacteria 1420
283 Ga0501046_0113219 3300049580 Bacteria 2071
284 Ga0501047_0136924 3300049581 Bacteria 2329
285 Ga0501047_0148712 3300049581 Bacteria 2218
286 Ga0501048_0094966 3300049582 Bacteria 2103
287 Ga0501048_0181687 3300049582 Bacteria 1491
288 Ga0501048_0506435 3300049582 Bacteria 866
289 Ga0501067_0004666 3300049583 Bacteria 7583
290 Ga0501067_0066217 3300049583 Bacteria 2000
291 Ga0501067_0187601 3300049583 Bacteria 1151
292 Ga0501068_0000138 3300049584 Bacteria 33430
293 Ga0501068_0005636 3300049584 Bacteria 6858
294 Ga0501069_0000047 3300049585 Bacteria 73029
295 Ga0501069_0506275 3300049585 Bacteria 721
296 Ga0501070_0000008 3300049586 Bacteria 199963
297 Ga0501070_0062564 3300049586 Bacteria 3083
298 Ga0501070_0071179 3300049586 Bacteria 2879
299 Ga0501070_0314614 3300049586 Bacteria 1274
300 Ga0501070_0536223 3300049586 Bacteria 938
301 Ga0501071_0020747 3300049587 Bacteria 4569
302 Ga0501071_0073796 3300049587 Bacteria 2489
303 Ga0501071_0133150 3300049587 Bacteria 1848
304 Ga0501071_0287752 3300049587 Bacteria 1244
305 Ga0501071_0466444 3300049587 Bacteria 967
306 Ga0501072_0000356 3300049588 Bacteria 32647
307 Ga0501072_0021472 3300049588 Bacteria 5006
308 Ga0501072_0105460 3300049588 Bacteria 2241
309 Ga0501072_0208547 3300049588 Bacteria 1557
310 Ga0501072_0306944 3300049588 Bacteria 1261
311 Ga0501072_0357250 3300049588 Bacteria 1160
312 Ga0501073_0005263 3300049589 Bacteria 9702
313 Ga0501073_0025833 3300049589 Bacteria 4207
314 Ga0501073_0224137 3300049589 Bacteria 1299
315 Ga0501073_0234618 3300049589 Bacteria 1267
316 Ga0501073_0372799 3300049589 Bacteria 986
317 Ga0501073_0566224 3300049589 Bacteria 785
318 Ga0501074_0003010 3300049590 Bacteria 11860
319 Ga0501074_0095593 3300049590 Bacteria 2128
320 Ga0501074_0112938 3300049590 Bacteria 1944
321 Ga0501074_0202122 3300049590 Bacteria 1416
322 Ga0501075_0071486 3300049591 Bacteria 2623
323 Ga0501075_0156609 3300049591 Bacteria 1737
324 Ga0501075_0367075 3300049591 Bacteria 1097
325 Ga0501076_0005731 3300049592 Bacteria 8956
326 Ga0501076_0107987 3300049592 Bacteria 2248
327 Ga0501076_0112346 3300049592 Bacteria 2203
328 Ga0501076_0635798 3300049592 Bacteria 880
329 Ga0501077_0004964 3300049593 Bacteria 8069
330 Ga0501077_0371128 3300049593 Bacteria 914
331 Ga0501079_0027203 3300049741 Bacteria 4384
332 Ga0501079_0035533 3300049741 Bacteria 3836
333 Ga0501080_0000737 3300049742 Bacteria 26441
334 Ga0501080_0003814 3300049742 Bacteria 13321
335 Ga0501080_0004296 3300049742 Bacteria 12649
336 Ga0501080_0027413 3300049742 Bacteria 5296
337 Ga0501080_0163162 3300049742 Bacteria 2057
338 Ga0501080_0425508 3300049742 Bacteria 1192
339 Ga0501080_0555149 3300049742 Bacteria 1023
340 Ga0501081_0010174 3300049743 Bacteria 6138
341 Ga0501081_0035539 3300049743 Bacteria 3392
342 Ga0501081_0187801 3300049743 Bacteria 1496
343 Ga0501083_0002079 3300049744 Bacteria 13778
344 Ga0501083_0019602 3300049744 Bacteria 4711
345 Ga0501083_0135034 3300049744 Bacteria 1617
346 Ga0501035_0022255 3300049822 Bacteria 5821
347 Ga0501035_0248095 3300049822 Bacteria 1513
348 Ga0501035_0424735 3300049822 Bacteria 1103
349 Ga0501035_0539367 3300049822 Bacteria 957
350 Ga0501044_0011816 3300049823 Bacteria 9460
351 Ga0501044_0047104 3300049823 Bacteria 4460
352 Ga0501045_0162466 3300049824 Bacteria 1663
353 Ga0501045_0178797 3300049824 Bacteria 1581
354 nmdc:mga03683_25828_c1 3300050489 Bacteria 2311
355 nmdc:mga03683_38902_c1 3300050489 Bacteria 1945
356 nmdc:mga03n38_66480_c1 3300050490 Bacteria 1656
357 nmdc:mga00v17_140680_c1 3300050491 Bacteria 1547
358 nmdc:mga00v17_14632_c1 3300050491 Bacteria 4385
359 nmdc:mga00v17_250857_c1 3300050491 Bacteria 1147
360 nmdc:mga00v17_38802_c1 3300050491 Bacteria 2850
361 nmdc:mga00v17_40518_c1 3300050491 Bacteria 2794
362 nmdc:mga00v17_454707_c1 3300050491 Bacteria 831
363 nmdc:mga00v17_83687_c2 3300050491 Bacteria 1295
364 nmdc:mga0yw44_117593_c1 3300050492 Bacteria 1709
365 nmdc:mga0yw44_127677_c1 3300050492 Bacteria 1643
366 nmdc:mga0yw44_211705_c1 3300050492 Bacteria 1282
367 nmdc:mga0yw44_217775_c1 3300050492 Bacteria 1264
368 nmdc:mga0yw44_316338_c1 3300050492 Bacteria 1048
369 nmdc:mga0yw44_362261_c1 3300050492 Bacteria 977
370 nmdc:mga0yw44_56380_c1 3300050492 Bacteria 2394
371 nmdc:mga0yw44_597_c1 3300050492 Bacteria 13058
372 nmdc:mga06z11_111096_c1 3300050494 Bacteria 1518
373 nmdc:mga06z11_429711_c1 3300050494 Bacteria 797
374 nmdc:mga05p37_10953_c1 3300050507 Bacteria 10768
375 nmdc:mga05p37_1101843_c1 3300050507 Bacteria 831
376 nmdc:mga05p37_18429_c1 3300050507 Bacteria 8433
377 nmdc:mga05p37_296640_c1 3300050507 Bacteria 1922
378 nmdc:mga09592_16421_c1 3300050508 Bacteria 6056
379 nmdc:mga09592_349881_c1 3300050508 Bacteria 1279
380 nmdc:mga09592_625_c1 3300050508 Bacteria 27036
381 nmdc:mga09592_67740_c1 3300050508 Bacteria 3028
382 nmdc:mga0qj67_170925_c1 3300050509 Bacteria 1765
383 nmdc:mga0qj67_18328_c1 3300050509 Bacteria 5335
384 nmdc:mga0qj67_273783_c1 3300050509 Bacteria 1369
385 nmdc:mga0qj67_36568_c1 3300050509 Bacteria 3842
386 nmdc:mga06r32_1235_c1 3300050510 Bacteria 23010
387 nmdc:mga06r32_266732_c1 3300050510 Bacteria 1700
388 nmdc:mga06r32_4414_c1 3300050510 Bacteria 12585
389 nmdc:mga06r32_70671_c1 3300050510 Bacteria 3377
390 nmdc:mga08y16_127151_c1 3300050511 Bacteria 2651
391 nmdc:mga08y16_314810_c1 3300050511 Bacteria 1612
392 nmdc:mga08y16_7246_c1 3300050511 Bacteria 11639
393 nmdc:mga0n895_1341516_c1 3300050512 Bacteria 685
394 Ga0495595_0107658 3300053084 Bacteria 1349
395 Ga0495595_0138260 3300053084 Bacteria 1194
396 Ga0495619_0679610 3300053085 Bacteria 701
397 Ga0495619_0692506 3300053085 Bacteria 693
398 Ga0500566_0000200 3300053094 Bacteria 31433
399 Ga0500568_0000081 3300053139 Bacteria 92418
400 Ga0500616_0000303 3300053153 Bacteria 71156
401 Ga0501084_0001770 3300054114 Bacteria 17191
402 Ga0501084_0030649 3300054114 Bacteria 4497
403 Ga0501084_0056760 3300054114 Bacteria 3276
404 Ga0501084_0061712 3300054114 Bacteria 3139
405 Ga0501084_0064602 3300054114 Bacteria 3062
406 Ga0501082_0018859 3300060353 Bacteria 5943
407 Ga0501082_0143396 3300060353 Bacteria 2073
408 Ga0501082_0306996 3300060353 Bacteria 1382
409 Ga0501082_0570003 3300060353 Bacteria 990
410 Ga0530510_0064119 3300061734 Bacteria 2661
411 Ga0530510_0423842 3300061734 Bacteria 1004
412 Ga0451833_0172919
413 JGI25407J50210_10002289
414 Ga0070683_100578577
415 Ga0070668_100079472
416 Ga0070669_100323441
417 Ga0070671_100033359
418 Ga0070709_10023218
419 Ga0070710_10068163
420 Ga0070711_100134463
421 Ga0070678_100970738
422 Ga0068867_100019892
423 Ga0070685_10241816
424 Ga0070706_100532198
425 Ga0070686_100190390
426 Ga0070665_100899299
427 Ga0070702_100434959
428 Ga0068852_101514777
429 Ga0068859_100377588
430 Ga0068864_100838706
431 Ga0068866_10006390
432 Ga0068863_100496260
433 Ga0068858_100865426
434 Ga0068860_100007451
435 Ga0068860_100189132
436 Ga0068860_100878500
437 Ga0068862_100804179
438 Ga0081455_10106029
439 Ga0081455_10514880
440 Ga0081538_10000131
441 Ga0081538_10025446
442 Ga0070717_10454473
443 Ga0075365_10013322
444 Ga0075365_10129058
445 Ga0075365_10217217
446 Ga0075365_10236920
447 Ga0075365_10379669
448 Ga0075363_100017330
449 Ga0075364_10010188
450 Ga0075364_10011843
451 Ga0075364_10016746
452 Ga0075364_10124262
453 Ga0075364_10172164
454 Ga0075362_10065028
455 Ga0075362_10083363
456 Ga0075367_10037801
457 Ga0075367_10066116
458 Ga0075367_10506442
459 Ga0075367_10548147
460 Ga0075428_100000247
461 Ga0075428_100015292
462 Ga0075428_100268551
463 Ga0075430_100000590
464 Ga0075430_100025653
465 Ga0075430_100157353
466 Ga0075431_100002015
467 Ga0075431_100002898
468 Ga0075431_100748877
469 Ga0075433_10474546
470 Ga0075429_100000279
471 Ga0075429_100001235
472 Ga0075429_100032067
473 Ga0097620_100377618
474 Ga0111539_10075176
475 Ga0111539_10094035
476 Ga0111539_10794968
477 Ga0111539_11563740
478 Ga0105245_10008048
479 Ga0105245_10553657
480 Ga0105245_11361087
481 Ga0114129_10000179
482 Ga0114129_10012055
483 Ga0114129_10097178
484 Ga0114129_10231278
485 Ga0105243_10022906
486 Ga0105243_10195256
487 Ga0105243_11436228
488 Ga0105241_10074569
489 Ga0105241_10369848
490 Ga0105248_10300760
491 Ga0105248_10457319
492 Ga0105248_11538556
493 Ga0105249_10699983
494 Ga0105239_10173664
495 Ga0105239_11465662
496 Ga0105246_10729629
497 Ga0105246_10768773
498 Ga0157378_10463730
499 Ga0163162_10170435
500 Ga0163162_10657237
501 Ga0163162_11243387
502 Ga0157375_10073064
503 Ga0163163_11040728
504 Ga0157380_10435802
505 Ga0157380_11258112
506 Ga0157379_10109733
507 Ga0163161_10637837
508 Ga0213876_10023878
509 Ga0207692_10179738
510 Ga0207643_10807754
511 Ga0207684_10551011
512 Ga0207663_10144283
513 Ga0207662_10028695
514 Ga0207657_10515821
515 Ga0207681_10072208
516 Ga0207681_10175816
517 Ga0207681_10431255
518 Ga0207700_10192950
519 Ga0207706_10497926
520 Ga0207686_10267359
521 Ga0207709_10662625
522 Ga0207670_10063636
523 Ga0207691_10098710
524 Ga0207711_11305545
525 Ga0207661_10109494
526 Ga0207679_10639285
527 Ga0207651_10641137
528 Ga0207668_10156605
529 Ga0207668_10793953
530 Ga0207640_10364286
531 Ga0207677_10270355
532 Ga0207677_10693639
533 Ga0207708_10324763
534 Ga0207641_10665447
535 Ga0207641_10997303
536 Ga0207648_10034481
537 Ga0207648_10516074
538 Ga0207676_10210179
539 Ga0207676_10863693
540 Ga0207675_100012541
541 Ga0207683_10367547
542 Ga0207428_10025890
543 Ga0207428_10096504
544 Ga0207428_10135033
545 Ga0207428_10364400
546 Ga0268266_11048595
547 Ga0268265_10166744
548 Ga0268264_10005318
549 Ga0268264_10111005
550 Ga0265327_10183500
551 Ga0307410_10033117
552 Ga0307406_10624117
553 Ga0307406_10868157
554 Ga0307407_10007901
555 Ga0307412_10909396
556 Ga0307409_100030565
557 Ga0307416_100879658
558 Ga0307411_10010502
559 Ga0307415_100018650
560 Ga0373928_0000353
561 Ga0373932_0001031
562 Ga0373942_0136985
563 Ga0316574_0600624
564 Ga0373931_0000001
565 Ga0373931_0000022
566 Ga0373927_0317619
567 Ga0373937_0003642
568 Ga0400483_034849
569 Ga0400483_111982
570 Ga0400483_218408
571 Ga0436365_0238032
572 Ga0451791_1540764
573 Ga0451793_0812557
574 Ga0451797_1176678
575 Ga0451849_1126969
576 Ga0451853_1659573
577 Ga0451853_2574778
578 Ga0439454_015863
579 Ga0439435_0071295
580 Ga0495592_0047394
581 Ga0495651_0015738
582 Ga0495653_0007023
583 Ga0495653_0076110
584 Ga0495582_0030803
585 Ga0495582_0275394
586 Ga0495639_0259418
587 Ga0495662_0132078
588 Ga0495584_0378381
589 Ga0495608_0050999
590 Ga0495608_0095078
591 Ga0495618_0039436
592 Ga0495618_0151119
593 Ga0495628_0011650
594 Ga0495630_0015722
595 Ga0495630_0033141
596 Ga0495630_0067972
597 Ga0495652_0235796
598 Ga0495640_0164387
599 Ga0495640_0186680
600 Ga0495586_0055964
601 Ga0495586_0145319
602 Ga0495586_0214801
603 Ga0495587_0013674
604 Ga0495622_0211126
605 Ga0495667_0004320
606 Ga0495667_0164107
607 Ga0495668_0173429
608 Ga0495634_0087648
609 Ga0495611_0332241
610 Ga0495635_0186763
611 Ga0495588_0129374
612 Ga0495657_0006564
613 Ga0495658_0029135
614 Ga0495658_0092782
615 Ga0495613_0000201
616 Ga0495613_0245123
617 Ga0495613_0274746
618 Ga0495613_0489443
619 Ga0495670_0197483
620 Ga0495589_0246743
621 Ga0495600_0178802
622 Ga0495604_0223183
623 Ga0495674_0293488
624 Ga0495674_0418251
625 Ga0495672_0287278
626 Ga0495676_0116507
627 Ga0495680_0008662
628 Ga0495680_0043484
629 Ga0495680_0405265
630 Ga0495675_0016545
631 Ga0495684_0082850
632 Ga0495602_0113767
633 Ga0496100_0014352
634 Ga0496100_0454754
635 Ga0496101_0006919
636 Ga0496101_0013369
637 Ga0496101_0304734
638 Ga0496102_0069855
639 Ga0496103_0024474
640 Ga0496104_0024728
641 Ga0496104_0142090
642 Ga0496104_0398289
643 Ga0496105_0018900
644 Ga0496105_0075961
645 Ga0496106_0671901
646 Ga0496107_0300342
647 Ga0496108_0196910
648 Ga0496108_0376907
649 Ga0496109_0084236
650 Ga0496110_0533949
651 Ga0496113_0811478
652 Ga0496114_0130387
653 Ga0496114_0195006
654 Ga0496114_0223064
655 Ga0496114_0258050
656 Ga0496115_0039221
657 Ga0501031_0032830
658 Ga0501031_0040679
659 Ga0501031_0052325
660 Ga0501031_0079785
661 Ga0501031_0574080
662 Ga0501032_0008938
663 Ga0501032_0065975
664 Ga0501033_0001530
665 Ga0501033_0011056
666 Ga0501034_0000566
667 Ga0501034_0015239
668 Ga0501034_0027022
669 Ga0501034_0120755
670 Ga0501034_0168091
671 Ga0501036_0100825
672 Ga0501036_0260676
673 Ga0501036_0401844
674 Ga0501037_0004464
675 Ga0501037_0071412
676 Ga0501038_0066003
677 Ga0501038_0107850
678 Ga0501038_0132233
679 Ga0501038_0312790
680 Ga0501039_0004326
681 Ga0501039_0058738
682 Ga0501039_0153196
683 Ga0501039_0428046
684 Ga0501040_0028465
685 Ga0501041_0383701
686 Ga0501042_0006039
687 Ga0501042_0033463
688 Ga0501042_0094362
689 Ga0501042_0277179
690 Ga0501043_0034071
691 Ga0501043_0058483
692 Ga0501043_0181600
693 Ga0501043_0233479
694 Ga0501046_0113219
695 Ga0501047_0136924
696 Ga0501047_0148712
697 Ga0501048_0094966
698 Ga0501048_0181687
699 Ga0501048_0506435
700 Ga0501067_0004666
701 Ga0501067_0066217
702 Ga0501067_0187601
703 Ga0501068_0000138
704 Ga0501068_0005636
705 Ga0501069_0000047
706 Ga0501069_0506275
707 Ga0501070_0000008
708 Ga0501070_0062564
709 Ga0501070_0071179
710 Ga0501070_0314614
711 Ga0501070_0536223
712 Ga0501071_0020747
713 Ga0501071_0073796
714 Ga0501071_0133150
715 Ga0501071_0287752
716 Ga0501071_0466444
717 Ga0501072_0000356
718 Ga0501072_0021472
719 Ga0501072_0105460
720 Ga0501072_0208547
721 Ga0501072_0306944
722 Ga0501072_0357250
723 Ga0501073_0005263
724 Ga0501073_0025833
725 Ga0501073_0224137
726 Ga0501073_0234618
727 Ga0501073_0372799
728 Ga0501073_0566224
729 Ga0501074_0003010
730 Ga0501074_0095593
731 Ga0501074_0112938
732 Ga0501074_0202122
733 Ga0501075_0071486
734 Ga0501075_0156609
735 Ga0501075_0367075
736 Ga0501076_0005731
737 Ga0501076_0107987
738 Ga0501076_0112346
739 Ga0501076_0635798
740 Ga0501077_0004964
741 Ga0501077_0371128
742 Ga0501079_0027203
743 Ga0501079_0035533
744 Ga0501080_0000737
745 Ga0501080_0003814
746 Ga0501080_0004296
747 Ga0501080_0027413
748 Ga0501080_0163162
749 Ga0501080_0425508
750 Ga0501080_0555149
751 Ga0501081_0010174
752 Ga0501081_0035539
753 Ga0501081_0187801
754 Ga0501083_0002079
755 Ga0501083_0019602
756 Ga0501083_0135034
757 Ga0501035_0022255
758 Ga0501035_0248095
759 Ga0501035_0424735
760 Ga0501035_0539367
761 Ga0501044_0011816
762 Ga0501044_0047104
763 Ga0501045_0162466
764 Ga0501045_0178797
765 nmdc:mga03683_25828_c1
766 nmdc:mga03683_38902_c1
767 nmdc:mga03n38_66480_c1
768 nmdc:mga00v17_140680_c1
769 nmdc:mga00v17_14632_c1
770 nmdc:mga00v17_250857_c1
771 nmdc:mga00v17_38802_c1
772 nmdc:mga00v17_40518_c1
773 nmdc:mga00v17_454707_c1
774 nmdc:mga00v17_83687_c2
775 nmdc:mga0yw44_117593_c1
776 nmdc:mga0yw44_127677_c1
777 nmdc:mga0yw44_211705_c1
778 nmdc:mga0yw44_217775_c1
779 nmdc:mga0yw44_316338_c1
780 nmdc:mga0yw44_362261_c1
781 nmdc:mga0yw44_56380_c1
782 nmdc:mga0yw44_597_c1
783 nmdc:mga06z11_111096_c1
784 nmdc:mga06z11_429711_c1
785 nmdc:mga05p37_10953_c1
786 nmdc:mga05p37_1101843_c1
787 nmdc:mga05p37_18429_c1
788 nmdc:mga05p37_296640_c1
789 nmdc:mga09592_16421_c1
790 nmdc:mga09592_349881_c1
791 nmdc:mga09592_625_c1
792 nmdc:mga09592_67740_c1
793 nmdc:mga0qj67_170925_c1
794 nmdc:mga0qj67_18328_c1
795 nmdc:mga0qj67_273783_c1
796 nmdc:mga0qj67_36568_c1
797 nmdc:mga06r32_1235_c1
798 nmdc:mga06r32_266732_c1
799 nmdc:mga06r32_4414_c1
800 nmdc:mga06r32_70671_c1
801 nmdc:mga08y16_127151_c1
802 nmdc:mga08y16_314810_c1
803 nmdc:mga08y16_7246_c1
804 nmdc:mga0n895_1341516_c1
805 Ga0495595_0107658
806 Ga0495595_0138260
807 Ga0495619_0679610
808 Ga0495619_0692506
809 Ga0500566_0000200
810 Ga0500568_0000081
811 Ga0500616_0000303
812 Ga0501084_0001770
813 Ga0501084_0030649
814 Ga0501084_0056760
815 Ga0501084_0061712
816 Ga0501084_0064602
817 Ga0501082_0018859
818 Ga0501082_0143396
819 Ga0501082_0306996
820 Ga0501082_0570003
821 Ga0530510_0064119
822 Ga0530510_0423842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

1

90

0.96

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

64

205

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9306 1 179
6khh-assembly1.cif.gz_A crystal structure of hisb from mycobacterium tuberculosis 0.9298 3 175
4lom-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis hisb in complex with its substrate 0.9294 3 180
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9266 1 179
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9241 3 179
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9753 2 79 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9695 1 79 3.30.230.40
af_Q2FUU0_1_87_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9606 4 78 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9227 84 177 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9215 84 179 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A5C9E231-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (IGPD) (EC 4.2.1.19) 0.9436 1 179 GO:0000105
GO:0004424
GO:0005737
AF-A0A844ENP1-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9363 3 171 GO:0000105
GO:0004424
GO:0005737
AF-A0A855X6J0-F1-model_v4 deleted 0.9359 3 179
AF-A0A1V5B776-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9358 4 175 GO:0000105
GO:0004424
AF-X0YIA7-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9356 7 177 GO:0000105
GO:0004424

Map