F437541

General Info

Members Datasets Scaffolds Average Seq Length
411 182 822 189

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10696879|Ga0207677_106968792
Length 225
Sequence MALVDCTSXXXXAKEPRIILINKTDLRAKLLVANFGEGEMSRIKLLAIILISCLMAGAQTPKSVARDGLSFDYPSDWTMQDDSGGDAQQFSLGKANSDVQIKVFVHKGRIAAEKLPDAKKAFIDPYIASTEKQFVAMGAKPAQSPDTSEIGGVKADGVKISASLGGETGAAKIYWALVGQRVVVLTLFGPDKQLQQLAPAWDLVRNSLKVVDPKAAPAASPKSSP

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
158 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
159 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
167 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
168 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
169 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
170 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
174 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
177 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.7
Rhizosphere 98.3
Stem 0
Stem Tuber 0
Unclassified 20.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10696879 3300026023 Unclassified 901
2 MBSR1b_contig_3179911 2162886012 Bacteria 1210
3 JGI25406J46586_10023256 3300003203 Bacteria 2452
4 Ga0065714_10129537 3300005288 Bacteria 1264
5 Ga0065704_10276217 3300005289 Bacteria 922
6 Ga0065712_10002406 3300005290 Bacteria 8306
7 Ga0065712_10031581 3300005290 Unclassified 1070
8 Ga0065715_10023917 3300005293 Bacteria 1529
9 Ga0065715_10348832 3300005293 Bacteria 954
10 Ga0070676_10155777 3300005328 Bacteria 1466
11 Ga0070690_100009843 3300005330 Bacteria 5548
12 Ga0070670_100000043 3300005331 Bacteria 141622
13 Ga0068869_100016676 3300005334 Bacteria 4955
14 Ga0068869_100253398 3300005334 Unclassified 1407
15 Ga0068869_100261968 3300005334 Unclassified 1384
16 Ga0068869_100866301 3300005334 Bacteria 780
17 Ga0068869_100897958 3300005334 Bacteria 767
18 Ga0070680_100000123 3300005336 Bacteria 45833
19 Ga0070680_100139018 3300005336 Bacteria 2036
20 Ga0070680_100334038 3300005336 Bacteria 1287
21 Ga0068868_100023352 3300005338 Bacteria 4680
22 Ga0068868_100111729 3300005338 Bacteria 2221
23 Ga0070660_100957177 3300005339 Bacteria 723
24 Ga0070689_100215183 3300005340 Unclassified 1574
25 Ga0070689_100468033 3300005340 Bacteria 1075
26 Ga0070687_100053630 3300005343 Bacteria 2098
27 Ga0070687_100131225 3300005343 Bacteria 1447
28 Ga0070687_100236691 3300005343 Unclassified 1127
29 Ga0070661_100330405 3300005344 Bacteria 1192
30 Ga0070692_10007132 3300005345 Bacteria 4906
31 Ga0070692_10023901 3300005345 Bacteria 2999
32 Ga0070692_10385347 3300005345 Unclassified 881
33 Ga0070669_100032259 3300005353 Unclassified 3784
34 Ga0070669_100200959 3300005353 Bacteria 1568
35 Ga0070675_100011163 3300005354 Bacteria 7028
36 Ga0070671_100021940 3300005355 Bacteria 5215
37 Ga0070671_100035817 3300005355 Bacteria 4113
38 Ga0070671_100463437 3300005355 Bacteria 1088
39 Ga0070673_100105751 3300005364 Bacteria 2326
40 Ga0070673_100341201 3300005364 Bacteria 1327
41 Ga0070673_100413068 3300005364 Bacteria 1209
42 Ga0070673_100519117 3300005364 Bacteria 1079
43 Ga0070688_100098092 3300005365 Unclassified 1927
44 Ga0070659_100280439 3300005366 Bacteria 1386
45 Ga0070659_101010512 3300005366 Unclassified 730
46 Ga0070667_100344817 3300005367 Bacteria 1347
47 Ga0070667_100591294 3300005367 Unclassified 1022
48 Ga0070703_10004975 3300005406 Bacteria 3709
49 Ga0070701_10039233 3300005438 Bacteria 2401
50 Ga0070701_10147383 3300005438 Bacteria 1352
51 Ga0070701_10251347 3300005438 Bacteria 1068
52 Ga0070701_10317209 3300005438 Bacteria 963
53 Ga0070705_100039812 3300005440 Bacteria 2669
54 Ga0070705_100058194 3300005440 Bacteria 2284
55 Ga0070700_100102603 3300005441 Bacteria 1887
56 Ga0070700_100333265 3300005441 Bacteria 1119
57 Ga0070694_100019305 3300005444 Bacteria 4334
58 Ga0070694_100032448 3300005444 Bacteria 3429
59 Ga0070694_100041411 3300005444 Bacteria 3073
60 Ga0070694_100101741 3300005444 Bacteria 2033
61 Ga0070694_100174264 3300005444 Bacteria 1587
62 Ga0070708_100000343 3300005445 Bacteria 35108
63 Ga0070678_100426361 3300005456 Bacteria 1157
64 Ga0070662_100145024 3300005457 Bacteria 1844
65 Ga0070662_100197041 3300005457 Bacteria 1596
66 Ga0070681_10000128 3300005458 Bacteria 56982
67 Ga0068867_100109341 3300005459 Bacteria 2122
68 Ga0068867_100116853 3300005459 Bacteria 2056
69 Ga0068867_100175852 3300005459 Viruses 1698
70 Ga0070685_10018035 3300005466 Unclassified 3791
71 Ga0070706_100002975 3300005467 Bacteria 16802
72 Ga0070698_100016308 3300005471 Bacteria 7843
73 Ga0070698_100057641 3300005471 Bacteria 3930
74 Ga0070699_100001203 3300005518 Bacteria 23916
75 Ga0070699_100132486 3300005518 Unclassified 2198
76 Ga0070699_100550688 3300005518 Bacteria 1050
77 Ga0070699_100842518 3300005518 Unclassified 839
78 Ga0070679_100000014 3300005530 Bacteria 150481
79 Ga0070679_100376646 3300005530 Bacteria 1366
80 Ga0070697_100024726 3300005536 Bacteria 4783
81 Ga0070697_100054688 3300005536 Unclassified 3245
82 Ga0070697_100750915 3300005536 Unclassified 862
83 Ga0070672_100453704 3300005543 Bacteria 1104
84 Ga0070672_100635846 3300005543 Bacteria 931
85 Ga0070686_100036434 3300005544 Unclassified 3046
86 Ga0070686_100064396 3300005544 Bacteria 2378
87 Ga0070686_100540183 3300005544 Bacteria 910
88 Ga0070695_100163701 3300005545 Bacteria 1564
89 Ga0070695_100181632 3300005545 Bacteria 1491
90 Ga0070696_100057374 3300005546 Bacteria 2718
91 Ga0070696_100215953 3300005546 Bacteria 1437
92 Ga0070696_100223251 3300005546 Bacteria 1414
93 Ga0070696_100233128 3300005546 Bacteria 1386
94 Ga0070693_100007005 3300005547 Bacteria 5492
95 Ga0070693_100152882 3300005547 Bacteria 1463
96 Ga0070693_100216168 3300005547 Bacteria 1253
97 Ga0070693_100390825 3300005547 Bacteria 962
98 Ga0070693_100405532 3300005547 Bacteria 946
99 Ga0070704_100235154 3300005549 Bacteria 1497
100 Ga0070704_100332410 3300005549 Bacteria 1277
101 Ga0068855_100342537 3300005563 Bacteria 1648
102 Ga0070664_100104714 3300005564 Bacteria 2464
103 Ga0070664_100584901 3300005564 Bacteria 1035
104 Ga0070664_100685238 3300005564 Unclassified 954
105 Ga0070664_100762916 3300005564 Bacteria 903
106 Ga0068857_100179506 3300005577 Bacteria 1926
107 Ga0068857_100398891 3300005577 Bacteria 1280
108 Ga0068857_100578397 3300005577 Bacteria 1060
109 Ga0068857_101216499 3300005577 Unclassified 730
110 Ga0068854_100057205 3300005578 Bacteria 2813
111 Ga0068854_100689456 3300005578 Unclassified 881
112 Ga0068856_101506779 3300005614 Unclassified 686
113 Ga0070702_100059036 3300005615 Bacteria 2225
114 Ga0070702_100087465 3300005615 Bacteria 1882
115 Ga0068852_100077523 3300005616 Bacteria 2938
116 Ga0068859_100028924 3300005617 Bacteria 5559
117 Ga0068859_100033766 3300005617 Bacteria 5137
118 Ga0068859_100571017 3300005617 Bacteria 1225
119 Ga0068859_100624982 3300005617 Bacteria 1170
120 Ga0068864_100009751 3300005618 Bacteria 7921
121 Ga0068864_100023187 3300005618 Bacteria 5209
122 Ga0068864_100150984 3300005618 Bacteria 2104
123 Ga0068864_100572071 3300005618 Bacteria 1094
124 Ga0068864_100659363 3300005618 Bacteria 1019
125 Ga0068864_101183235 3300005618 Unclassified 763
126 Ga0068866_10006457 3300005718 Bacteria 4883
127 Ga0068861_100010725 3300005719 Bacteria 6367
128 Ga0068861_100142372 3300005719 Unclassified 1958
129 Ga0068861_100153900 3300005719 Bacteria 1889
130 Ga0068861_100647786 3300005719 Bacteria 975
131 Ga0068851_10015817 3300005834 Bacteria 3601
132 Ga0068870_10056806 3300005840 Bacteria 2090
133 Ga0068870_10204188 3300005840 Bacteria 1200
134 Ga0068863_100120538 3300005841 Bacteria 2501
135 Ga0068863_100757428 3300005841 Bacteria 967
136 Ga0068863_101168230 3300005841 Unclassified 775
137 Ga0068858_100012878 3300005842 Bacteria 7887
138 Ga0068858_100219940 3300005842 Bacteria 1798
139 Ga0068858_100869787 3300005842 Unclassified 881
140 Ga0068858_101254611 3300005842 Unclassified 729
141 Ga0068860_100042676 3300005843 Unclassified 4330
142 Ga0068860_100067804 3300005843 Bacteria 3389
143 Ga0068860_100103971 3300005843 Unclassified 2711
144 Ga0068860_100109247 3300005843 Bacteria 2643
145 Ga0068860_100194481 3300005843 Bacteria 1964
146 Ga0068860_100219463 3300005843 Bacteria 1846
147 Ga0068860_100273816 3300005843 Bacteria 1648
148 Ga0068860_100353399 3300005843 Unclassified 1447
149 Ga0068862_100044113 3300005844 Bacteria 3803
150 Ga0068862_100127434 3300005844 Bacteria 2249
151 Ga0068862_100221933 3300005844 Unclassified 1712
152 Ga0068862_100584932 3300005844 Unclassified 1070
153 Ga0081539_10000858 3300005985 Bacteria 58194
154 Ga0097621_100006031 3300006237 Bacteria 8563
155 Ga0097621_100076862 3300006237 Unclassified 2770
156 Ga0097621_100459850 3300006237 Bacteria 1148
157 Ga0068871_100006625 3300006358 Bacteria 8214
158 Ga0068871_100065519 3300006358 Bacteria 2975
159 Ga0075428_100097621 3300006844 Unclassified 3203
160 Ga0075430_100060021 3300006846 Bacteria 3196
161 Ga0075431_100058824 3300006847 Bacteria 3966
162 Ga0075433_10084973 3300006852 Bacteria 2794
163 Ga0075433_10141958 3300006852 Bacteria 2134
164 Ga0075433_10270327 3300006852 Bacteria 1506
165 Ga0075433_10290236 3300006852 Unclassified 1449
166 Ga0075434_100271966 3300006871 Bacteria 1713
167 Ga0075434_100347760 3300006871 Bacteria 1503
168 Ga0075429_100105750 3300006880 Bacteria 2458
169 Ga0068865_100006614 3300006881 Bacteria 7088
170 Ga0068865_100882987 3300006881 Bacteria 776
171 Ga0097620_100028923 3300006931 Bacteria 5559
172 Ga0097620_100033766 3300006931 Bacteria 5137
173 Ga0097620_100172832 3300006931 Bacteria 2242
174 Ga0097620_100409434 3300006931 Unclassified 1452
175 Ga0097620_100570918 3300006931 Bacteria 1225
176 Ga0097620_100624974 3300006931 Bacteria 1170
177 Ga0075435_100926807 3300007076 Bacteria 760
178 Ga0105250_10088825 3300009092 Bacteria 1256
179 Ga0105240_10112528 3300009093 Bacteria 3290
180 Ga0105240_10298385 3300009093 Bacteria 1844
181 Ga0105240_10375729 3300009093 Bacteria 1606
182 Ga0111539_10036366 3300009094 Bacteria 5955
183 Ga0111539_10110920 3300009094 Unclassified 3219
184 Ga0105245_10014025 3300009098 Bacteria 6978
185 Ga0105245_10602478 3300009098 Bacteria 1125
186 Ga0105247_10000394 3300009101 Bacteria 37073
187 Ga0105247_10143839 3300009101 Unclassified 1565
188 Ga0105247_10525389 3300009101 Bacteria 866
189 Ga0114129_10023200 3300009147 Bacteria 8801
190 Ga0114129_10060503 3300009147 Bacteria 5295
191 Ga0114129_10097140 3300009147 Unclassified 4078
192 Ga0105243_10018302 3300009148 Bacteria 5304
193 Ga0105243_10190615 3300009148 Bacteria 1790
194 Ga0105243_10322737 3300009148 Bacteria 1408
195 Ga0105243_10426134 3300009148 Unclassified 1239
196 Ga0105243_10454558 3300009148 Bacteria 1203
197 Ga0105241_10130086 3300009174 Bacteria 2037
198 Ga0105241_10166929 3300009174 Bacteria 1815
199 Ga0105241_10203247 3300009174 Bacteria 1656
200 Ga0105241_10369470 3300009174 Bacteria 1250
201 Ga0105242_10025123 3300009176 Bacteria 4710
202 Ga0105242_10044481 3300009176 Bacteria 3596
203 Ga0105242_10195931 3300009176 Bacteria 1792
204 Ga0105248_10073868 3300009177 Bacteria 3833
205 Ga0105248_10414038 3300009177 Bacteria 1518
206 Ga0105248_10429453 3300009177 Unclassified 1488
207 Ga0105248_10525731 3300009177 Bacteria 1334
208 Ga0105248_10856101 3300009177 Bacteria 1026
209 Ga0105248_10881240 3300009177 Bacteria 1010
210 Ga0105248_10941328 3300009177 Bacteria 976
211 Ga0105237_10001199 3300009545 Bacteria 34703
212 Ga0105237_10016529 3300009545 Bacteria 7666
213 Ga0105237_10339121 3300009545 Bacteria 1508
214 Ga0105238_10001358 3300009551 Bacteria 24558
215 Ga0105249_10288333 3300009553 Bacteria 1642
216 Ga0105249_10393083 3300009553 Bacteria 1415
217 Ga0105239_10132753 3300010375 Bacteria 2770
218 Ga0105239_10861614 3300010375 Bacteria 1039
219 Ga0105239_10992543 3300010375 Bacteria 965
220 Ga0105239_11337813 3300010375 Unclassified 826
221 Ga0105239_11625806 3300010375 Bacteria 747
222 Ga0105246_10025685 3300011119 Bacteria 3841
223 Ga0105246_10300195 3300011119 Bacteria 1296
224 Ga0105246_10403919 3300011119 Bacteria 1135
225 Ga0157373_10002374 3300013100 Bacteria 14302
226 Ga0157373_10109301 3300013100 Bacteria 1944
227 Ga0157378_10009694 3300013297 Bacteria 8390
228 Ga0157378_10611402 3300013297 Bacteria 1102
229 Ga0163162_10005564 3300013306 Bacteria 12190
230 Ga0163162_10006933 3300013306 Bacteria 10984
231 Ga0163162_10018521 3300013306 Bacteria 6823
232 Ga0163162_10037208 3300013306 Unclassified 4855
233 Ga0163162_10524000 3300013306 Bacteria 1314
234 Ga0157372_10032375 3300013307 Bacteria 5733
235 Ga0157372_10224681 3300013307 Bacteria 2177
236 Ga0157372_10278466 3300013307 Bacteria 1945
237 Ga0157375_10026557 3300013308 Bacteria 5399
238 Ga0157375_10072710 3300013308 Bacteria 3456
239 Ga0157375_10141546 3300013308 Bacteria 2533
240 Ga0157375_10548350 3300013308 Bacteria 1318
241 Ga0157375_11017387 3300013308 Unclassified 968
242 Ga0163163_10011831 3300014325 Bacteria 7934
243 Ga0163163_10013529 3300014325 Bacteria 7477
244 Ga0163163_10024786 3300014325 Bacteria 5712
245 Ga0163163_10033850 3300014325 Bacteria 4945
246 Ga0163163_10067578 3300014325 Bacteria 3554
247 Ga0163163_10197645 3300014325 Bacteria 2059
248 Ga0163163_10235401 3300014325 Bacteria 1881
249 Ga0163163_10317562 3300014325 Bacteria 1611
250 Ga0163163_11349996 3300014325 Unclassified 775
251 Ga0157380_10036503 3300014326 Bacteria 3803
252 Ga0157380_10290163 3300014326 Bacteria 1502
253 Ga0157380_10501219 3300014326 Unclassified 1179
254 Ga0157377_10394006 3300014745 Bacteria 941
255 Ga0157376_10728802 3300014969 Bacteria 999
256 Ga0157376_10835909 3300014969 Unclassified 935
257 Ga0163161_10041510 3300017792 Unclassified 3305
258 Ga0163161_11170419 3300017792 Unclassified 664
259 Ga0207656_10009629 3300025321 Bacteria 3591
260 Ga0207653_10002864 3300025885 Bacteria 5477
261 Ga0207710_10000671 3300025900 Bacteria 19274
262 Ga0207680_10446211 3300025903 Unclassified 918
263 Ga0207647_10084765 3300025904 Bacteria 1896
264 Ga0207647_10225383 3300025904 Unclassified 1079
265 Ga0207645_10088327 3300025907 Unclassified 1993
266 Ga0207645_10200530 3300025907 Bacteria 1312
267 Ga0207643_10008548 3300025908 Bacteria 5491
268 Ga0207643_10221254 3300025908 Bacteria 1159
269 Ga0207684_10024418 3300025910 Bacteria 5154
270 Ga0207654_10126259 3300025911 Unclassified 1613
271 Ga0207654_10137986 3300025911 Bacteria 1552
272 Ga0207654_10255038 3300025911 Bacteria 1177
273 Ga0207654_10296682 3300025911 Bacteria 1098
274 Ga0207707_10000016 3300025912 Bacteria 256002
275 Ga0207707_10033961 3300025912 Bacteria 4464
276 Ga0207707_10247931 3300025912 Bacteria 1547
277 Ga0207695_10279287 3300025913 Bacteria 1564
278 Ga0207671_10001638 3300025914 Bacteria 25473
279 Ga0207660_10000340 3300025917 Bacteria 30175
280 Ga0207662_10029954 3300025918 Bacteria 3156
281 Ga0207649_10245144 3300025920 Bacteria 1288
282 Ga0207652_10000372 3300025921 Bacteria 46683
283 Ga0207646_10326990 3300025922 Unclassified 1385
284 Ga0207646_10458145 3300025922 Bacteria 1150
285 Ga0207694_10002533 3300025924 Bacteria 14843
286 Ga0207650_10000009 3300025925 Bacteria 483583
287 Ga0207650_10848218 3300025925 Bacteria 775
288 Ga0207659_10158090 3300025926 Unclassified 1776
289 Ga0207659_10380653 3300025926 Unclassified 1177
290 Ga0207687_10222564 3300025927 Bacteria 1487
291 Ga0207644_10067481 3300025931 Bacteria 2607
292 Ga0207644_10541927 3300025931 Bacteria 963
293 Ga0207644_10578211 3300025931 Unclassified 931
294 Ga0207706_10048303 3300025933 Bacteria 3764
295 Ga0207706_10315271 3300025933 Bacteria 1361
296 Ga0207686_10035605 3300025934 Bacteria 2989
297 Ga0207686_10463098 3300025934 Bacteria 977
298 Ga0207709_10040627 3300025935 Bacteria 2786
299 Ga0207709_10363144 3300025935 Bacteria 1097
300 Ga0207709_10404793 3300025935 Bacteria 1044
301 Ga0207709_10500523 3300025935 Unclassified 948
302 Ga0207670_10064341 3300025936 Bacteria 2513
303 Ga0207670_10093008 3300025936 Bacteria 2136
304 Ga0207670_10195374 3300025936 Unclassified 1534
305 Ga0207670_10203501 3300025936 Bacteria 1506
306 Ga0207691_10028528 3300025940 Bacteria 5225
307 Ga0207691_10682608 3300025940 Bacteria 867
308 Ga0207711_10490412 3300025941 Bacteria 1145
309 Ga0207711_10570437 3300025941 Unclassified 1056
310 Ga0207711_11115458 3300025941 Unclassified 730
311 Ga0207689_10042862 3300025942 Unclassified 3742
312 Ga0207689_10053433 3300025942 Bacteria 3328
313 Ga0207689_10107178 3300025942 Bacteria 2296
314 Ga0207689_10229191 3300025942 Bacteria 1535
315 Ga0207689_10466062 3300025942 Bacteria 1057
316 Ga0207679_10441320 3300025945 Bacteria 1153
317 Ga0207679_10896017 3300025945 Unclassified 811
318 Ga0207679_10993286 3300025945 Unclassified 769
319 Ga0207679_11550793 3300025945 Unclassified 607
320 Ga0207651_10261529 3300025960 Bacteria 1421
321 Ga0207651_10320313 3300025960 Bacteria 1296
322 Ga0207712_10002204 3300025961 Bacteria 12685
323 Ga0207712_10172134 3300025961 Bacteria 1693
324 Ga0207640_10106721 3300025981 Bacteria 1976
325 Ga0207640_10378947 3300025981 Bacteria 1146
326 Ga0207677_10111411 3300026023 Bacteria 2039
327 Ga0207703_10274879 3300026035 Bacteria 1527
328 Ga0207703_10356589 3300026035 Bacteria 1348
329 Ga0207639_10135809 3300026041 Bacteria 2042
330 Ga0207639_10699762 3300026041 Unclassified 940
331 Ga0207708_10000136 3300026075 Bacteria 57790
332 Ga0207708_10060588 3300026075 Bacteria 2889
333 Ga0207708_10075038 3300026075 Bacteria 2592
334 Ga0207702_10035375 3300026078 Bacteria 4176
335 Ga0207641_10221153 3300026088 Bacteria 1756
336 Ga0207641_10334011 3300026088 Unclassified 1440
337 Ga0207641_10778452 3300026088 Unclassified 946
338 Ga0207648_10034689 3300026089 Unclassified 4447
339 Ga0207648_10059569 3300026089 Bacteria 3330
340 Ga0207676_10005034 3300026095 Bacteria 9351
341 Ga0207676_10030162 3300026095 Bacteria 4068
342 Ga0207676_10087159 3300026095 Bacteria 2553
343 Ga0207676_10195332 3300026095 Bacteria 1784
344 Ga0207676_10201750 3300026095 Bacteria 1758
345 Ga0207676_10353695 3300026095 Bacteria 1359
346 Ga0207676_10561425 3300026095 Bacteria 1092
347 Ga0207676_10580313 3300026095 Bacteria 1075
348 Ga0207676_10608314 3300026095 Bacteria 1050
349 Ga0207674_10300913 3300026116 Bacteria 1553
350 Ga0207674_10359888 3300026116 Bacteria 1407
351 Ga0207675_100015075 3300026118 Bacteria 7211
352 Ga0207675_100145317 3300026118 Bacteria 2255
353 Ga0207675_101317091 3300026118 Unclassified 743
354 Ga0207683_10016756 3300026121 Bacteria 6238
355 Ga0207698_11003009 3300026142 Unclassified 846
356 Ga0207428_10077300 3300027907 Bacteria 2606
357 Ga0268265_10383763 3300028380 Bacteria 1293
358 Ga0268265_10920838 3300028380 Bacteria 859
359 Ga0268265_11162926 3300028380 Bacteria 768
360 Ga0268264_10047924 3300028381 Bacteria 3553
361 Ga0268264_10157751 3300028381 Bacteria 2041
362 Ga0268264_10167750 3300028381 Bacteria 1983
363 Ga0268264_10257737 3300028381 Bacteria 1623
364 Ga0268264_10660789 3300028381 Unclassified 1035
365 Ga0268264_11328459 3300028381 Unclassified 729
366 Ga0307408_100139935 3300031548 Bacteria 1899
367 Ga0307408_100560332 3300031548 Bacteria 1010
368 Ga0307406_10671672 3300031901 Unclassified 862
369 Ga0307407_10511207 3300031903 Bacteria 882
370 Ga0307412_10197086 3300031911 Bacteria 1527
371 Ga0307416_101526322 3300032002 Bacteria 774
372 Ga0307411_10189289 3300032005 Bacteria 1570
373 Ga0373942_0004093 3300035207 Bacteria 3399
374 Ga0395900_0279516 3300037418 Bacteria 1662
375 Ga0242419_001833 3300038698 Bacteria 1344
376 Ga0242422_01050 3300038699 Bacteria 1880
377 Ga0242420_006023 3300038996 Bacteria 1903
378 Ga0242420_070032 3300038996 Bacteria 712
379 Ga0451576_0328165 3300045051 Bacteria 1602
380 Ga0451576_1074229 3300045051 Bacteria 843
381 Ga0496102_0108733 3300048905 Unclassified 2583
382 Ga0496103_0616145 3300048906 Unclassified 691
383 Ga0496106_0231901 3300048909 Bacteria 1474
384 Ga0496106_0796246 3300048909 Unclassified 750
385 Ga0496106_0893531 3300048909 Unclassified 702
386 Ga0496109_0481391 3300048912 Bacteria 1172
387 Ga0496112_0132667 3300048915 Bacteria 2462
388 Ga0501292_005804 3300049515 Bacteria 1734
389 Ga0501292_029496 3300049515 Unclassified 917
390 Ga0501198_006974 3300049649 Unclassified 1619
391 Ga0501202_038596 3300049652 Bacteria 1024
392 Ga0501223_003436 3300049663 Unclassified 3448
393 Ga0501233_003078 3300049668 Unclassified 2980
394 Ga0501235_007241 3300049669 Unclassified 2421
395 Ga0501249_011400 3300049679 Unclassified 1866
396 Ga0501249_037056 3300049679 Bacteria 1100
397 Ga0501250_008084 3300049680 Bacteria 1152
398 Ga0501260_007438 3300049689 Bacteria 1068
399 Ga0501225_0078394 3300049705 Bacteria 946
400 Ga0501283_006641 3300049779 Bacteria 1626
401 Ga0501226_003708 3300049853 Unclassified 1797
402 nmdc:mga05p37_34467_c1 3300050507 Bacteria 6201
403 nmdc:mga08y16_16153_c1 3300050511 Bacteria 7848
404 nmdc:mga08y16_58218_c1 3300050511 Unclassified 4037
405 nmdc:mga0n895_116492_c1 3300050512 Bacteria 2690
406 nmdc:mga0n895_34272_c1 3300050512 Bacteria 4885
407 nmdc:mga0rr50_392589_c1 3300050513 Bacteria 1171
408 nmdc:mga0a205_31544_c1 3300050515 Bacteria 5077
409 nmdc:mga0a205_342733_c1 3300050515 Bacteria 1363
410 nmdc:mga0a205_4312_c1 3300050515 Bacteria 12757
411 nmdc:mga0a205_57730_c1 3300050515 Bacteria 3747
412 Ga0207677_10696879
413 MBSR1b_contig_3179911
414 JGI25406J46586_10023256
415 Ga0065714_10129537
416 Ga0065704_10276217
417 Ga0065712_10002406
418 Ga0065712_10031581
419 Ga0065715_10023917
420 Ga0065715_10348832
421 Ga0070676_10155777
422 Ga0070690_100009843
423 Ga0070670_100000043
424 Ga0068869_100016676
425 Ga0068869_100253398
426 Ga0068869_100261968
427 Ga0068869_100866301
428 Ga0068869_100897958
429 Ga0070680_100000123
430 Ga0070680_100139018
431 Ga0070680_100334038
432 Ga0068868_100023352
433 Ga0068868_100111729
434 Ga0070660_100957177
435 Ga0070689_100215183
436 Ga0070689_100468033
437 Ga0070687_100053630
438 Ga0070687_100131225
439 Ga0070687_100236691
440 Ga0070661_100330405
441 Ga0070692_10007132
442 Ga0070692_10023901
443 Ga0070692_10385347
444 Ga0070669_100032259
445 Ga0070669_100200959
446 Ga0070675_100011163
447 Ga0070671_100021940
448 Ga0070671_100035817
449 Ga0070671_100463437
450 Ga0070673_100105751
451 Ga0070673_100341201
452 Ga0070673_100413068
453 Ga0070673_100519117
454 Ga0070688_100098092
455 Ga0070659_100280439
456 Ga0070659_101010512
457 Ga0070667_100344817
458 Ga0070667_100591294
459 Ga0070703_10004975
460 Ga0070701_10039233
461 Ga0070701_10147383
462 Ga0070701_10251347
463 Ga0070701_10317209
464 Ga0070705_100039812
465 Ga0070705_100058194
466 Ga0070700_100102603
467 Ga0070700_100333265
468 Ga0070694_100019305
469 Ga0070694_100032448
470 Ga0070694_100041411
471 Ga0070694_100101741
472 Ga0070694_100174264
473 Ga0070708_100000343
474 Ga0070678_100426361
475 Ga0070662_100145024
476 Ga0070662_100197041
477 Ga0070681_10000128
478 Ga0068867_100109341
479 Ga0068867_100116853
480 Ga0068867_100175852
481 Ga0070685_10018035
482 Ga0070706_100002975
483 Ga0070698_100016308
484 Ga0070698_100057641
485 Ga0070699_100001203
486 Ga0070699_100132486
487 Ga0070699_100550688
488 Ga0070699_100842518
489 Ga0070679_100000014
490 Ga0070679_100376646
491 Ga0070697_100024726
492 Ga0070697_100054688
493 Ga0070697_100750915
494 Ga0070672_100453704
495 Ga0070672_100635846
496 Ga0070686_100036434
497 Ga0070686_100064396
498 Ga0070686_100540183
499 Ga0070695_100163701
500 Ga0070695_100181632
501 Ga0070696_100057374
502 Ga0070696_100215953
503 Ga0070696_100223251
504 Ga0070696_100233128
505 Ga0070693_100007005
506 Ga0070693_100152882
507 Ga0070693_100216168
508 Ga0070693_100390825
509 Ga0070693_100405532
510 Ga0070704_100235154
511 Ga0070704_100332410
512 Ga0068855_100342537
513 Ga0070664_100104714
514 Ga0070664_100584901
515 Ga0070664_100685238
516 Ga0070664_100762916
517 Ga0068857_100179506
518 Ga0068857_100398891
519 Ga0068857_100578397
520 Ga0068857_101216499
521 Ga0068854_100057205
522 Ga0068854_100689456
523 Ga0068856_101506779
524 Ga0070702_100059036
525 Ga0070702_100087465
526 Ga0068852_100077523
527 Ga0068859_100028924
528 Ga0068859_100033766
529 Ga0068859_100571017
530 Ga0068859_100624982
531 Ga0068864_100009751
532 Ga0068864_100023187
533 Ga0068864_100150984
534 Ga0068864_100572071
535 Ga0068864_100659363
536 Ga0068864_101183235
537 Ga0068866_10006457
538 Ga0068861_100010725
539 Ga0068861_100142372
540 Ga0068861_100153900
541 Ga0068861_100647786
542 Ga0068851_10015817
543 Ga0068870_10056806
544 Ga0068870_10204188
545 Ga0068863_100120538
546 Ga0068863_100757428
547 Ga0068863_101168230
548 Ga0068858_100012878
549 Ga0068858_100219940
550 Ga0068858_100869787
551 Ga0068858_101254611
552 Ga0068860_100042676
553 Ga0068860_100067804
554 Ga0068860_100103971
555 Ga0068860_100109247
556 Ga0068860_100194481
557 Ga0068860_100219463
558 Ga0068860_100273816
559 Ga0068860_100353399
560 Ga0068862_100044113
561 Ga0068862_100127434
562 Ga0068862_100221933
563 Ga0068862_100584932
564 Ga0081539_10000858
565 Ga0097621_100006031
566 Ga0097621_100076862
567 Ga0097621_100459850
568 Ga0068871_100006625
569 Ga0068871_100065519
570 Ga0075428_100097621
571 Ga0075430_100060021
572 Ga0075431_100058824
573 Ga0075433_10084973
574 Ga0075433_10141958
575 Ga0075433_10270327
576 Ga0075433_10290236
577 Ga0075434_100271966
578 Ga0075434_100347760
579 Ga0075429_100105750
580 Ga0068865_100006614
581 Ga0068865_100882987
582 Ga0097620_100028923
583 Ga0097620_100033766
584 Ga0097620_100172832
585 Ga0097620_100409434
586 Ga0097620_100570918
587 Ga0097620_100624974
588 Ga0075435_100926807
589 Ga0105250_10088825
590 Ga0105240_10112528
591 Ga0105240_10298385
592 Ga0105240_10375729
593 Ga0111539_10036366
594 Ga0111539_10110920
595 Ga0105245_10014025
596 Ga0105245_10602478
597 Ga0105247_10000394
598 Ga0105247_10143839
599 Ga0105247_10525389
600 Ga0114129_10023200
601 Ga0114129_10060503
602 Ga0114129_10097140
603 Ga0105243_10018302
604 Ga0105243_10190615
605 Ga0105243_10322737
606 Ga0105243_10426134
607 Ga0105243_10454558
608 Ga0105241_10130086
609 Ga0105241_10166929
610 Ga0105241_10203247
611 Ga0105241_10369470
612 Ga0105242_10025123
613 Ga0105242_10044481
614 Ga0105242_10195931
615 Ga0105248_10073868
616 Ga0105248_10414038
617 Ga0105248_10429453
618 Ga0105248_10525731
619 Ga0105248_10856101
620 Ga0105248_10881240
621 Ga0105248_10941328
622 Ga0105237_10001199
623 Ga0105237_10016529
624 Ga0105237_10339121
625 Ga0105238_10001358
626 Ga0105249_10288333
627 Ga0105249_10393083
628 Ga0105239_10132753
629 Ga0105239_10861614
630 Ga0105239_10992543
631 Ga0105239_11337813
632 Ga0105239_11625806
633 Ga0105246_10025685
634 Ga0105246_10300195
635 Ga0105246_10403919
636 Ga0157373_10002374
637 Ga0157373_10109301
638 Ga0157378_10009694
639 Ga0157378_10611402
640 Ga0163162_10005564
641 Ga0163162_10006933
642 Ga0163162_10018521
643 Ga0163162_10037208
644 Ga0163162_10524000
645 Ga0157372_10032375
646 Ga0157372_10224681
647 Ga0157372_10278466
648 Ga0157375_10026557
649 Ga0157375_10072710
650 Ga0157375_10141546
651 Ga0157375_10548350
652 Ga0157375_11017387
653 Ga0163163_10011831
654 Ga0163163_10013529
655 Ga0163163_10024786
656 Ga0163163_10033850
657 Ga0163163_10067578
658 Ga0163163_10197645
659 Ga0163163_10235401
660 Ga0163163_10317562
661 Ga0163163_11349996
662 Ga0157380_10036503
663 Ga0157380_10290163
664 Ga0157380_10501219
665 Ga0157377_10394006
666 Ga0157376_10728802
667 Ga0157376_10835909
668 Ga0163161_10041510
669 Ga0163161_11170419
670 Ga0207656_10009629
671 Ga0207653_10002864
672 Ga0207710_10000671
673 Ga0207680_10446211
674 Ga0207647_10084765
675 Ga0207647_10225383
676 Ga0207645_10088327
677 Ga0207645_10200530
678 Ga0207643_10008548
679 Ga0207643_10221254
680 Ga0207684_10024418
681 Ga0207654_10126259
682 Ga0207654_10137986
683 Ga0207654_10255038
684 Ga0207654_10296682
685 Ga0207707_10000016
686 Ga0207707_10033961
687 Ga0207707_10247931
688 Ga0207695_10279287
689 Ga0207671_10001638
690 Ga0207660_10000340
691 Ga0207662_10029954
692 Ga0207649_10245144
693 Ga0207652_10000372
694 Ga0207646_10326990
695 Ga0207646_10458145
696 Ga0207694_10002533
697 Ga0207650_10000009
698 Ga0207650_10848218
699 Ga0207659_10158090
700 Ga0207659_10380653
701 Ga0207687_10222564
702 Ga0207644_10067481
703 Ga0207644_10541927
704 Ga0207644_10578211
705 Ga0207706_10048303
706 Ga0207706_10315271
707 Ga0207686_10035605
708 Ga0207686_10463098
709 Ga0207709_10040627
710 Ga0207709_10363144
711 Ga0207709_10404793
712 Ga0207709_10500523
713 Ga0207670_10064341
714 Ga0207670_10093008
715 Ga0207670_10195374
716 Ga0207670_10203501
717 Ga0207691_10028528
718 Ga0207691_10682608
719 Ga0207711_10490412
720 Ga0207711_10570437
721 Ga0207711_11115458
722 Ga0207689_10042862
723 Ga0207689_10053433
724 Ga0207689_10107178
725 Ga0207689_10229191
726 Ga0207689_10466062
727 Ga0207679_10441320
728 Ga0207679_10896017
729 Ga0207679_10993286
730 Ga0207679_11550793
731 Ga0207651_10261529
732 Ga0207651_10320313
733 Ga0207712_10002204
734 Ga0207712_10172134
735 Ga0207640_10106721
736 Ga0207640_10378947
737 Ga0207677_10111411
738 Ga0207703_10274879
739 Ga0207703_10356589
740 Ga0207639_10135809
741 Ga0207639_10699762
742 Ga0207708_10000136
743 Ga0207708_10060588
744 Ga0207708_10075038
745 Ga0207702_10035375
746 Ga0207641_10221153
747 Ga0207641_10334011
748 Ga0207641_10778452
749 Ga0207648_10034689
750 Ga0207648_10059569
751 Ga0207676_10005034
752 Ga0207676_10030162
753 Ga0207676_10087159
754 Ga0207676_10195332
755 Ga0207676_10201750
756 Ga0207676_10353695
757 Ga0207676_10561425
758 Ga0207676_10580313
759 Ga0207676_10608314
760 Ga0207674_10300913
761 Ga0207674_10359888
762 Ga0207675_100015075
763 Ga0207675_100145317
764 Ga0207675_101317091
765 Ga0207683_10016756
766 Ga0207698_11003009
767 Ga0207428_10077300
768 Ga0268265_10383763
769 Ga0268265_10920838
770 Ga0268265_11162926
771 Ga0268264_10047924
772 Ga0268264_10157751
773 Ga0268264_10167750
774 Ga0268264_10257737
775 Ga0268264_10660789
776 Ga0268264_11328459
777 Ga0307408_100139935
778 Ga0307408_100560332
779 Ga0307406_10671672
780 Ga0307407_10511207
781 Ga0307412_10197086
782 Ga0307416_101526322
783 Ga0307411_10189289
784 Ga0373942_0004093
785 Ga0395900_0279516
786 Ga0242419_001833
787 Ga0242422_01050
788 Ga0242420_006023
789 Ga0242420_070032
790 Ga0451576_0328165
791 Ga0451576_1074229
792 Ga0496102_0108733
793 Ga0496103_0616145
794 Ga0496106_0231901
795 Ga0496106_0796246
796 Ga0496106_0893531
797 Ga0496109_0481391
798 Ga0496112_0132667
799 Ga0501292_005804
800 Ga0501292_029496
801 Ga0501198_006974
802 Ga0501202_038596
803 Ga0501223_003436
804 Ga0501233_003078
805 Ga0501235_007241
806 Ga0501249_011400
807 Ga0501249_037056
808 Ga0501250_008084
809 Ga0501260_007438
810 Ga0501225_0078394
811 Ga0501283_006641
812 Ga0501226_003708
813 nmdc:mga05p37_34467_c1
814 nmdc:mga08y16_16153_c1
815 nmdc:mga08y16_58218_c1
816 nmdc:mga0n895_116492_c1
817 nmdc:mga0n895_34272_c1
818 nmdc:mga0rr50_392589_c1
819 nmdc:mga0a205_31544_c1
820 nmdc:mga0a205_342733_c1
821 nmdc:mga0a205_4312_c1
822 nmdc:mga0a205_57730_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hlz-assembly1.cif.gz_A crystal structure of bt_1490 (np_810393.1) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution 0.7534 28 181
4qjg-assembly1.cif.gz_A structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum in complex with penicillin v 0.7215 121 160
3jcu-assembly1.cif.gz_p cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution 0.6787 26 178
6gne-assembly1.cif.gz_A catalytic domain of starch synthase iv from arabidopsis thaliana bound to adp and acarbose 0.6731 107 136
4wmc-assembly2.cif.gz_F oxa-48 covalent complex with avibactam inhibitor 0.6575 122 156
ID Description Score Start End Superfamily
af_Q4CRR1_119_301_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7476 27 178 3.40.1000.10
af_K7L5I8_494_746_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7153 107 142 3.40.50.2000
af_A4HU23_158_314_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7049 36 178 3.40.1000.10
af_Q4E501_133_290_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7024 30 167 3.40.1000.10
af_K7K1B5_197_452_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6964 106 138 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A5C6CKH1-F1-model_v4 Uncharacterized protein 0.8721 29 175
AF-A0A2E8KMP8-F1-model_v4 PsbP C-terminal domain-containing protein 0.8671 30 175
AF-A0A3E0Q048-F1-model_v4 DUF1795 domain-containing protein 0.8593 29 184
AF-A0A7V2E9T3-F1-model_v4 DUF1795 domain-containing protein 0.8553 29 178
AF-A0A2V5TSA1-F1-model_v4 DUF1795 domain-containing protein 0.8549 12 191

Map