F437520

General Info

Members Datasets Scaffolds Average Seq Length
411 227 822 205

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10769663|Ga0157372_107696632
Length 226
Sequence MQKRLRQSSSRVLLKQKEITRMRNRSLKYILITLLAVVGVSANAAQELMHADEEHALQYLEATKKEVLDATKGLSVAQWNFKPAPDRWSVAQVMEHIAASEDFIRDGLIKGKVMVSPPGEPGRDMKKIDADVEAMIPDRSHKAQAPDPLVPNNRFGSPDGSIKHFLESRETTEQYLRTTPGLRDHVMDGPVGKMDGYEFILFIAAHNERHTKQINEVKADPNFPKS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 9.73
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 20.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10769663 3300013307 Unclassified 1119
2 MBSR1b_contig_6713616 2162886012 Bacteria 2561
3 JGI24752J21851_1001574 3300001976 Bacteria 3071
4 JGI24737J22298_10027925 3300001990 Bacteria 1776
5 JGI24034J26672_10000399 3300002239 Bacteria 5624
6 JGI24751J29686_10007686 3300002459 Bacteria 2204
7 rootH1_10180806 3300003316 Unclassified 1132
8 rootL2_10037323 3300003322 Bacteria 19376
9 rootL2_10351110 3300003322 Unclassified 1839
10 Ga0065712_10014076 3300005290 Bacteria 2176
11 Ga0065715_10000727 3300005293 Bacteria 8990
12 Ga0070658_10007650 3300005327 Bacteria 8711
13 Ga0070658_10200974 3300005327 Bacteria 1682
14 Ga0070676_10057483 3300005328 Bacteria 2302
15 Ga0070683_100007271 3300005329 Bacteria 9341
16 Ga0070683_100384367 3300005329 Bacteria 1338
17 Ga0070690_100036982 3300005330 Unclassified 3073
18 Ga0070670_100434047 3300005331 Bacteria 1162
19 Ga0070677_10003406 3300005333 Bacteria 5124
20 Ga0068869_100002512 3300005334 Bacteria 11068
21 Ga0068869_100019326 3300005334 Unclassified 4652
22 Ga0070666_10030489 3300005335 Bacteria 3553
23 Ga0070680_100105075 3300005336 Unclassified 2347
24 Ga0070680_100377917 3300005336 Bacteria 1206
25 Ga0070682_100004629 3300005337 Bacteria 7641
26 Ga0068868_100023647 3300005338 Unclassified 4652
27 Ga0068868_100104220 3300005338 Bacteria 2298
28 Ga0070660_100051043 3300005339 Unclassified 3184
29 Ga0070660_100468259 3300005339 Unclassified 1046
30 Ga0070660_100856636 3300005339 Unclassified 765
31 Ga0070689_100002262 3300005340 Bacteria 12507
32 Ga0070689_100216356 3300005340 Bacteria 1570
33 Ga0070687_100114430 3300005343 Bacteria 1532
34 Ga0070661_100004895 3300005344 Bacteria 9223
35 Ga0070661_100013164 3300005344 Bacteria 5805
36 Ga0070668_100003996 3300005347 Bacteria 10915
37 Ga0070669_100064932 3300005353 Bacteria 2688
38 Ga0070675_100023123 3300005354 Unclassified 4967
39 Ga0070671_100094671 3300005355 Bacteria 2504
40 Ga0070674_100034796 3300005356 Bacteria 3368
41 Ga0070673_100035585 3300005364 Bacteria 3777
42 Ga0070673_100283523 3300005364 Bacteria 1454
43 Ga0070688_100007296 3300005365 Bacteria 5955
44 Ga0070659_100024445 3300005366 Unclassified 4631
45 Ga0070659_100033114 3300005366 Bacteria 4012
46 Ga0070667_100291949 3300005367 Bacteria 1466
47 Ga0070709_10013992 3300005434 Bacteria 4527
48 Ga0070713_100556015 3300005436 Bacteria 1087
49 Ga0070713_100653938 3300005436 Unclassified 1001
50 Ga0070713_100715276 3300005436 Bacteria 957
51 Ga0070710_10007913 3300005437 Bacteria 5165
52 Ga0070711_100100976 3300005439 Unclassified 2099
53 Ga0070711_100130060 3300005439 Bacteria 1874
54 Ga0070711_100175348 3300005439 Bacteria 1637
55 Ga0070705_100055288 3300005440 Bacteria 2332
56 Ga0070705_100099129 3300005440 Unclassified 1835
57 Ga0070700_100117092 3300005441 Unclassified 1780
58 Ga0070708_100000882 3300005445 Bacteria 22663
59 Ga0070708_100000885 3300005445 Bacteria 22655
60 Ga0070708_100010243 3300005445 Bacteria 7590
61 Ga0070708_100017645 3300005445 Bacteria 5958
62 Ga0070708_100056821 3300005445 Bacteria 3482
63 Ga0070708_100311652 3300005445 Bacteria 1482
64 Ga0070708_101173310 3300005445 Unclassified 719
65 Ga0070663_100025161 3300005455 Unclassified 4017
66 Ga0070678_100178917 3300005456 Bacteria 1734
67 Ga0070678_100334882 3300005456 Bacteria 1296
68 Ga0070681_10044122 3300005458 Bacteria 4463
69 Ga0070681_10531714 3300005458 Unclassified 1089
70 Ga0068867_100001758 3300005459 Bacteria 15078
71 Ga0070685_10000742 3300005466 Bacteria 17767
72 Ga0070706_100000792 3300005467 Bacteria 35324
73 Ga0070706_100012856 3300005467 Bacteria 7749
74 Ga0070706_100306917 3300005467 Bacteria 1480
75 Ga0070707_100000592 3300005468 Bacteria 36476
76 Ga0070707_100001006 3300005468 Bacteria 27918
77 Ga0070707_100029356 3300005468 Bacteria 5236
78 Ga0070707_100038769 3300005468 Bacteria 4552
79 Ga0070707_100051486 3300005468 Bacteria 3948
80 Ga0070707_100096246 3300005468 Unclassified 2867
81 Ga0070707_100142221 3300005468 Bacteria 2335
82 Ga0070698_100000903 3300005471 Bacteria 32615
83 Ga0070698_100001464 3300005471 Bacteria 26208
84 Ga0070698_100026494 3300005471 Bacteria 6035
85 Ga0070698_100179318 3300005471 Unclassified 2057
86 Ga0070699_100000604 3300005518 Bacteria 33879
87 Ga0070699_100135823 3300005518 Bacteria 2170
88 Ga0070679_100035737 3300005530 Bacteria 4929
89 Ga0070679_100134786 3300005530 Bacteria 2450
90 Ga0070684_100157975 3300005535 Bacteria 2056
91 Ga0070684_100334948 3300005535 Bacteria 1391
92 Ga0070684_100470540 3300005535 Bacteria 1162
93 Ga0070697_100001265 3300005536 Bacteria 19087
94 Ga0070697_100004546 3300005536 Bacteria 10668
95 Ga0070697_100006458 3300005536 Bacteria 9078
96 Ga0070697_100018532 3300005536 Bacteria 5488
97 Ga0070697_100062902 3300005536 Unclassified 3030
98 Ga0070697_100095164 3300005536 Bacteria 2469
99 Ga0070697_100106387 3300005536 Unclassified 2334
100 Ga0070697_100164986 3300005536 Bacteria 1873
101 Ga0070697_100296507 3300005536 Unclassified 1389
102 Ga0070697_100301192 3300005536 Bacteria 1378
103 Ga0070697_100914327 3300005536 Bacteria 779
104 Ga0068853_100007918 3300005539 Bacteria 8521
105 Ga0068853_100058903 3300005539 Bacteria 3316
106 Ga0070672_100053256 3300005543 Bacteria 3163
107 Ga0070686_100068807 3300005544 Unclassified 2310
108 Ga0070686_100229664 3300005544 Bacteria 1345
109 Ga0070695_100010928 3300005545 Bacteria 5425
110 Ga0070696_100340787 3300005546 Bacteria 1158
111 Ga0070696_100871216 3300005546 Unclassified 745
112 Ga0070693_100036674 3300005547 Bacteria 2728
113 Ga0068855_100058077 3300005563 Unclassified 4532
114 Ga0068855_100158469 3300005563 Bacteria 2570
115 Ga0068855_100236755 3300005563 Bacteria 2041
116 Ga0070664_100062976 3300005564 Bacteria 3162
117 Ga0070664_100204680 3300005564 Bacteria 1762
118 Ga0068857_100001497 3300005577 Bacteria 18609
119 Ga0068857_100303440 3300005577 Unclassified 1472
120 Ga0068854_100029396 3300005578 Bacteria 3804
121 Ga0068854_100135314 3300005578 Bacteria 1886
122 Ga0068856_100008956 3300005614 Bacteria 9737
123 Ga0068856_100187885 3300005614 Bacteria 2080
124 Ga0068856_100220412 3300005614 Bacteria 1912
125 Ga0070702_100001285 3300005615 Bacteria 10190
126 Ga0068859_100057927 3300005617 Bacteria 3902
127 Ga0068864_100121526 3300005618 Unclassified 2335
128 Ga0068864_100506299 3300005618 Bacteria 1162
129 Ga0068866_10002294 3300005718 Bacteria 7923
130 Ga0068861_100111832 3300005719 Bacteria 2189
131 Ga0068851_10003125 3300005834 Bacteria 7338
132 Ga0068851_10046351 3300005834 Bacteria 2199
133 Ga0068870_10016550 3300005840 Unclassified 3526
134 Ga0068863_100028937 3300005841 Bacteria 5291
135 Ga0068863_100137393 3300005841 Bacteria 2335
136 Ga0068863_100347879 3300005841 Bacteria 1443
137 Ga0068863_100450466 3300005841 Bacteria 1263
138 Ga0068858_100184903 3300005842 Bacteria 1968
139 Ga0068860_100020829 3300005843 Bacteria 6353
140 Ga0068860_100544404 3300005843 Bacteria 1162
141 Ga0068862_100004657 3300005844 Bacteria 11555
142 Ga0081455_10137825 3300005937 Bacteria 1899
143 Ga0070717_10000029 3300006028 Bacteria 143008
144 Ga0070716_100000157 3300006173 Bacteria 27050
145 Ga0070716_100068651 3300006173 Bacteria 2074
146 Ga0070716_100133638 3300006173 Bacteria 1572
147 Ga0070716_100288383 3300006173 Unclassified 1136
148 Ga0070712_100027924 3300006175 Unclassified 3770
149 Ga0070712_100035931 3300006175 Bacteria 3367
150 Ga0070712_100113989 3300006175 Bacteria 2023
151 Ga0097621_100084948 3300006237 Bacteria 2639
152 Ga0097621_100219369 3300006237 Bacteria 1657
153 Ga0097621_100431575 3300006237 Bacteria 1184
154 Ga0097621_100604393 3300006237 Bacteria 1003
155 Ga0097621_100717454 3300006237 Bacteria 921
156 Ga0068871_100104433 3300006358 Bacteria 2377
157 Ga0068871_100152948 3300006358 Bacteria 1968
158 Ga0068871_100370382 3300006358 Bacteria 1270
159 Ga0075433_10005995 3300006852 Bacteria 9573
160 Ga0075433_10007733 3300006852 Bacteria 8539
161 Ga0075434_100000201 3300006871 Bacteria 40218
162 Ga0075434_100001903 3300006871 Bacteria 18086
163 Ga0075434_100360371 3300006871 Bacteria 1475
164 Ga0068865_100064614 3300006881 Bacteria 2576
165 Ga0075436_100172544 3300006914 Bacteria 1527
166 Ga0097620_100057927 3300006931 Bacteria 3902
167 Ga0075435_100000779 3300007076 Bacteria 19795
168 Ga0075435_100016323 3300007076 Bacteria 5598
169 Ga0075435_100886624 3300007076 Bacteria 778
170 Ga0105251_10133726 3300009011 Bacteria 1123
171 Ga0105240_10046160 3300009093 Bacteria 5522
172 Ga0105240_10078707 3300009093 Bacteria 4059
173 Ga0105240_11010814 3300009093 Unclassified 889
174 Ga0111539_10608218 3300009094 Bacteria 1273
175 Ga0105245_10007471 3300009098 Bacteria 9572
176 Ga0105245_10011385 3300009098 Bacteria 7748
177 Ga0105245_10320801 3300009098 Bacteria 1526
178 Ga0105245_10823139 3300009098 Bacteria 967
179 Ga0105247_10003848 3300009101 Bacteria 9718
180 Ga0114129_10777226 3300009147 Bacteria 1224
181 Ga0114129_10820837 3300009147 Unclassified 1184
182 Ga0105241_10002049 3300009174 Bacteria 15222
183 Ga0105241_10002978 3300009174 Bacteria 12635
184 Ga0105241_10335896 3300009174 Bacteria 1307
185 Ga0105248_10014426 3300009177 Bacteria 8698
186 Ga0105248_10078001 3300009177 Unclassified 3725
187 Ga0105248_10176772 3300009177 Bacteria 2405
188 Ga0105237_10031084 3300009545 Bacteria 5416
189 Ga0105237_10566244 3300009545 Unclassified 1143
190 Ga0105238_10016350 3300009551 Bacteria 7510
191 Ga0105238_10028475 3300009551 Bacteria 5691
192 Ga0105238_10112229 3300009551 Bacteria 2705
193 Ga0105249_10005291 3300009553 Bacteria 11142
194 Ga0105239_10006552 3300010375 Bacteria 13487
195 Ga0105246_10005119 3300011119 Bacteria 7974
196 Ga0157373_10005753 3300013100 Bacteria 9281
197 Ga0157371_10002970 3300013102 Bacteria 15743
198 Ga0157370_10177389 3300013104 Bacteria 1980
199 Ga0157369_10002033 3300013105 Bacteria 24370
200 Ga0157369_10078981 3300013105 Unclassified 3525
201 Ga0157374_10134378 3300013296 Unclassified 2397
202 Ga0157374_10212006 3300013296 Bacteria 1899
203 Ga0157374_10328581 3300013296 Bacteria 1516
204 Ga0157374_10934870 3300013296 Unclassified 885
205 Ga0157378_10000384 3300013297 Bacteria 43827
206 Ga0157378_10004965 3300013297 Bacteria 11664
207 Ga0157378_10005045 3300013297 Bacteria 11592
208 Ga0157378_10041243 3300013297 Bacteria 4094
209 Ga0157378_10153721 3300013297 Bacteria 2145
210 Ga0157378_10705530 3300013297 Unclassified 1029
211 Ga0163162_10084804 3300013306 Unclassified 3244
212 Ga0163162_10170264 3300013306 Bacteria 2303
213 Ga0157372_10005047 3300013307 Bacteria 14022
214 Ga0157372_10034628 3300013307 Bacteria 5554
215 Ga0157375_10059633 3300013308 Bacteria 3781
216 Ga0157375_10418362 3300013308 Bacteria 1506
217 Ga0163163_10001819 3300014325 Bacteria 18005
218 Ga0163163_10065409 3300014325 Bacteria 3609
219 Ga0157380_10675930 3300014326 Bacteria 1034
220 Ga0157377_10001344 3300014745 Bacteria 10555
221 Ga0157379_10001576 3300014968 Bacteria 18790
222 Ga0157379_10009309 3300014968 Bacteria 8556
223 Ga0157376_10044096 3300014969 Bacteria 3664
224 Ga0157376_10063393 3300014969 Unclassified 3114
225 Ga0157376_10077447 3300014969 Bacteria 2844
226 Ga0157376_10734329 3300014969 Bacteria 995
227 Ga0182007_10051443 3300015262 Bacteria 1359
228 Ga0182005_1038718 3300015265 Unclassified 1297
229 Ga0207697_10024858 3300025315 Bacteria 2450
230 Ga0207656_10045288 3300025321 Bacteria 1882
231 Ga0207656_10055739 3300025321 Bacteria 1721
232 Ga0207682_10004777 3300025893 Bacteria 5614
233 Ga0207692_10017455 3300025898 Unclassified 3202
234 Ga0207642_10177699 3300025899 Bacteria 1157
235 Ga0207710_10281780 3300025900 Unclassified 837
236 Ga0207688_10011192 3300025901 Unclassified 4884
237 Ga0207680_10007495 3300025903 Bacteria 5325
238 Ga0207699_10039474 3300025906 Bacteria 2713
239 Ga0207645_10000310 3300025907 Bacteria 40989
240 Ga0207643_10000514 3300025908 Bacteria 24771
241 Ga0207684_10000768 3300025910 Bacteria 37301
242 Ga0207684_10001932 3300025910 Bacteria 21481
243 Ga0207684_10011879 3300025910 Bacteria 7590
244 Ga0207684_10226778 3300025910 Unclassified 1612
245 Ga0207654_10003962 3300025911 Bacteria 7455
246 Ga0207654_10472002 3300025911 Unclassified 883
247 Ga0207707_10128921 3300025912 Unclassified 2212
248 Ga0207695_10095754 3300025913 Bacteria 2972
249 Ga0207693_10046446 3300025915 Bacteria 3411
250 Ga0207693_10049583 3300025915 Unclassified 3297
251 Ga0207663_10043578 3300025916 Bacteria 2748
252 Ga0207663_10219501 3300025916 Bacteria 1382
253 Ga0207660_10275598 3300025917 Bacteria 1334
254 Ga0207662_10003522 3300025918 Bacteria 8068
255 Ga0207657_10001677 3300025919 Bacteria 23895
256 Ga0207657_10033756 3300025919 Bacteria 4609
257 Ga0207649_10000479 3300025920 Bacteria 28540
258 Ga0207652_10016932 3300025921 Bacteria 5961
259 Ga0207652_10130580 3300025921 Bacteria 2240
260 Ga0207646_10000020 3300025922 Bacteria 272909
261 Ga0207646_10000564 3300025922 Bacteria 48766
262 Ga0207646_10004919 3300025922 Bacteria 14289
263 Ga0207646_10009355 3300025922 Bacteria 9684
264 Ga0207646_10131129 3300025922 Bacteria 2256
265 Ga0207646_10299845 3300025922 Bacteria 1452
266 Ga0207646_10565656 3300025922 Bacteria 1021
267 Ga0207681_10089222 3300025923 Bacteria 2197
268 Ga0207694_10067136 3300025924 Bacteria 2799
269 Ga0207650_10001320 3300025925 Bacteria 17937
270 Ga0207659_10125756 3300025926 Bacteria 1971
271 Ga0207687_10057843 3300025927 Unclassified 2725
272 Ga0207687_10109120 3300025927 Bacteria 2050
273 Ga0207687_10283760 3300025927 Bacteria 1328
274 Ga0207700_10933655 3300025928 Unclassified 776
275 Ga0207644_10019284 3300025931 Bacteria 4624
276 Ga0207690_10287997 3300025932 Bacteria 1281
277 Ga0207706_10000595 3300025933 Bacteria 38424
278 Ga0207706_10007827 3300025933 Bacteria 9863
279 Ga0207670_10001577 3300025936 Bacteria 11939
280 Ga0207670_10471330 3300025936 Bacteria 1015
281 Ga0207669_10028517 3300025937 Bacteria 3073
282 Ga0207669_10823396 3300025937 Bacteria 771
283 Ga0207704_10071719 3300025938 Bacteria 2199
284 Ga0207665_10000085 3300025939 Bacteria 60799
285 Ga0207665_10031908 3300025939 Unclassified 3487
286 Ga0207665_10130035 3300025939 Bacteria 1786
287 Ga0207665_10259884 3300025939 Unclassified 1286
288 Ga0207691_10000404 3300025940 Bacteria 43190
289 Ga0207711_10032040 3300025941 Bacteria 4442
290 Ga0207711_10204160 3300025941 Bacteria 1804
291 Ga0207689_10001889 3300025942 Bacteria 19815
292 Ga0207689_10155424 3300025942 Bacteria 1886
293 Ga0207661_10000196 3300025944 Bacteria 39288
294 Ga0207661_10317145 3300025944 Bacteria 1401
295 Ga0207679_10000281 3300025945 Bacteria 38441
296 Ga0207651_10008547 3300025960 Bacteria 5536
297 Ga0207668_10032776 3300025972 Bacteria 3437
298 Ga0207640_10307720 3300025981 Bacteria 1256
299 Ga0207658_10037343 3300025986 Unclassified 3489
300 Ga0207658_10249711 3300025986 Bacteria 1507
301 Ga0207677_10016703 3300026023 Unclassified 4355
302 Ga0207639_10083288 3300026041 Bacteria 2538
303 Ga0207678_10001538 3300026067 Bacteria 21169
304 Ga0207702_10640303 3300026078 Bacteria 1045
305 Ga0207641_10000127 3300026088 Bacteria 111663
306 Ga0207641_10059862 3300026088 Bacteria 3245
307 Ga0207641_10412211 3300026088 Unclassified 1299
308 Ga0207641_10663698 3300026088 Unclassified 1025
309 Ga0207648_10000259 3300026089 Bacteria 57412
310 Ga0207676_10000923 3300026095 Bacteria 22723
311 Ga0207676_10023956 3300026095 Bacteria 4512
312 Ga0207674_10000183 3300026116 Bacteria 77186
313 Ga0207675_100007265 3300026118 Bacteria 10472
314 Ga0207683_10000470 3300026121 Bacteria 37505
315 Ga0207683_10220782 3300026121 Bacteria 1727
316 Ga0268266_10001535 3300028379 Bacteria 27009
317 Ga0268265_10002337 3300028380 Bacteria 14401
318 Ga0268264_10008029 3300028381 Bacteria 8777
319 Ga0268264_10022039 3300028381 Bacteria 5198
320 Ga0268264_10470753 3300028381 Bacteria 1221
321 Ga0265319_1006337 3300028563 Bacteria 5494
322 Ga0265338_10032700 3300028800 Bacteria 5065
323 Ga0265338_10455465 3300028800 Unclassified 905
324 Ga0265760_10003699 3300031090 Bacteria 4431
325 Ga0265325_10031113 3300031241 Bacteria 2859
326 Ga0265331_10164786 3300031250 Unclassified 1004
327 Ga0307508_10000100 3300031616 Bacteria 102032
328 Ga0265342_10075884 3300031712 Bacteria 1949
329 Ga0307413_10251701 3300031824 Bacteria 1311
330 Ga0307416_100105497 3300032002 Unclassified 2467
331 Ga0395900_0770060 3300037418 Unclassified 892
332 Ga0395905_0357662 3300037471 Bacteria 1353
333 Ga0395905_0609149 3300037471 Bacteria 994
334 Ga0436365_0213241 3300039437 Bacteria 2363
335 Ga0451853_2464767 3300041512 Unclassified 871
336 Ga0439441_008230 3300042001 Bacteria 1698
337 Ga0451577_0011930 3300042876 Bacteria 8192
338 Ga0451577_0527656 3300042876 Bacteria 1072
339 Ga0451577_0581826 3300042876 Unclassified 1016
340 Ga0453683_0024262 3300044673 Bacteria 3860
341 Ga0453683_0038222 3300044673 Bacteria 3018
342 Ga0453683_0047903 3300044673 Unclassified 2680
343 Ga0453684_0085613 3300044712 Unclassified 3915
344 Ga0453684_0247729 3300044712 Unclassified 2047
345 Ga0453684_0283881 3300044712 Bacteria 1887
346 Ga0451576_0145730 3300045051 Bacteria 2469
347 Ga0451576_0418651 3300045051 Bacteria 1405
348 Ga0495580_0000904 3300046472 Bacteria 25856
349 Ga0495580_0001301 3300046472 Bacteria 22045
350 Ga0495580_0409705 3300046472 Unclassified 913
351 Ga0495630_0048004 3300046517 Unclassified 3195
352 Ga0495666_0453803 3300046526 Unclassified 574
353 Ga0495645_0216168 3300046543 Unclassified 1292
354 Ga0496100_0052730 3300048903 Bacteria 2646
355 Ga0496100_0096723 3300048903 Bacteria 2026
356 Ga0496100_0342225 3300048903 Unclassified 1128
357 Ga0496101_0034363 3300048904 Bacteria 3580
358 Ga0496101_0159059 3300048904 Unclassified 1732
359 Ga0496101_0227244 3300048904 Bacteria 1450
360 Ga0496102_0003082 3300048905 Bacteria 14119
361 Ga0496102_0011843 3300048905 Bacteria 7528
362 Ga0496102_0032360 3300048905 Bacteria 4697
363 Ga0496102_0044484 3300048905 Unclassified 4030
364 Ga0496102_0152196 3300048905 Bacteria 2174
365 Ga0496102_0185474 3300048905 Unclassified 1961
366 Ga0496103_0006360 3300048906 Bacteria 7057
367 Ga0496103_0032778 3300048906 Bacteria 3172
368 Ga0496103_0045967 3300048906 Bacteria 2695
369 Ga0496103_0069096 3300048906 Bacteria 2208
370 Ga0496104_0211255 3300048907 Unclassified 1852
371 Ga0496105_0409644 3300048908 Unclassified 1075
372 Ga0496105_0725828 3300048908 Unclassified 761
373 Ga0496106_0073704 3300048909 Bacteria 2612
374 Ga0496106_0153157 3300048909 Bacteria 1819
375 Ga0496106_0401022 3300048909 Bacteria 1102
376 Ga0496107_0029982 3300048910 Bacteria 3875
377 Ga0496107_0301007 3300048910 Bacteria 1194
378 Ga0496108_0000122 3300048911 Bacteria 77284
379 Ga0496108_0253115 3300048911 Bacteria 1532
380 Ga0496109_0000141 3300048912 Bacteria 71942
381 Ga0496109_0086087 3300048912 Bacteria 2902
382 Ga0496110_0000082 3300048913 Bacteria 49329
383 Ga0496111_0000370 3300048914 Bacteria 22385
384 Ga0496112_0006219 3300048915 Bacteria 10455
385 Ga0496112_0059939 3300048915 Bacteria 3750
386 Ga0496112_0106718 3300048915 Bacteria 2770
387 Ga0496112_0436788 3300048915 Bacteria 1247
388 Ga0496113_0000063 3300048916 Bacteria 46175
389 Ga0496114_0014425 3300048917 Bacteria 6344
390 Ga0496114_0185635 3300048917 Unclassified 1817
391 Ga0496115_0007994 3300048918 Bacteria 7807
392 Ga0496115_0018506 3300048918 Bacteria 5350
393 Ga0496115_0030989 3300048918 Unclassified 4212
394 Ga0501314_018821 3300049530 Unclassified 705
395 Ga0501036_0054077 3300049572 Bacteria 3400
396 Ga0501042_0447958 3300049578 Unclassified 936
397 Ga0501071_0001637 3300049587 Bacteria 13154
398 Ga0501075_0011282 3300049591 Bacteria 6322
399 Ga0501076_0014065 3300049592 Bacteria 6016
400 nmdc:mga05p37_749810_c1 3300050507 Bacteria 1076
401 nmdc:mga0n895_4162_c1 3300050512 Bacteria 11811
402 nmdc:mga0n895_8235_c1 3300050512 Bacteria 9015
403 nmdc:mga0rr50_10124_c1 3300050513 Bacteria 5968
404 nmdc:mga08x19_156046_c1 3300050514 Bacteria 1548
405 nmdc:mga0a205_131091_c1 3300050515 Unclassified 2407
406 nmdc:mga0a205_379_c1 3300050515 Bacteria 33748
407 Ga0500650_0141277 3300053098 Bacteria 1116
408 Ga0500642_0046744 3300053130 Bacteria 1894
409 Ga0500568_0008645 3300053139 Bacteria 4892
410 Ga0501084_0022330 3300054114 Bacteria 5281
411 Ga0501082_0110044 3300060353 Bacteria 2385
412 Ga0157372_10769663
413 MBSR1b_contig_6713616
414 JGI24752J21851_1001574
415 JGI24737J22298_10027925
416 JGI24034J26672_10000399
417 JGI24751J29686_10007686
418 rootH1_10180806
419 rootL2_10037323
420 rootL2_10351110
421 Ga0065712_10014076
422 Ga0065715_10000727
423 Ga0070658_10007650
424 Ga0070658_10200974
425 Ga0070676_10057483
426 Ga0070683_100007271
427 Ga0070683_100384367
428 Ga0070690_100036982
429 Ga0070670_100434047
430 Ga0070677_10003406
431 Ga0068869_100002512
432 Ga0068869_100019326
433 Ga0070666_10030489
434 Ga0070680_100105075
435 Ga0070680_100377917
436 Ga0070682_100004629
437 Ga0068868_100023647
438 Ga0068868_100104220
439 Ga0070660_100051043
440 Ga0070660_100468259
441 Ga0070660_100856636
442 Ga0070689_100002262
443 Ga0070689_100216356
444 Ga0070687_100114430
445 Ga0070661_100004895
446 Ga0070661_100013164
447 Ga0070668_100003996
448 Ga0070669_100064932
449 Ga0070675_100023123
450 Ga0070671_100094671
451 Ga0070674_100034796
452 Ga0070673_100035585
453 Ga0070673_100283523
454 Ga0070688_100007296
455 Ga0070659_100024445
456 Ga0070659_100033114
457 Ga0070667_100291949
458 Ga0070709_10013992
459 Ga0070713_100556015
460 Ga0070713_100653938
461 Ga0070713_100715276
462 Ga0070710_10007913
463 Ga0070711_100100976
464 Ga0070711_100130060
465 Ga0070711_100175348
466 Ga0070705_100055288
467 Ga0070705_100099129
468 Ga0070700_100117092
469 Ga0070708_100000882
470 Ga0070708_100000885
471 Ga0070708_100010243
472 Ga0070708_100017645
473 Ga0070708_100056821
474 Ga0070708_100311652
475 Ga0070708_101173310
476 Ga0070663_100025161
477 Ga0070678_100178917
478 Ga0070678_100334882
479 Ga0070681_10044122
480 Ga0070681_10531714
481 Ga0068867_100001758
482 Ga0070685_10000742
483 Ga0070706_100000792
484 Ga0070706_100012856
485 Ga0070706_100306917
486 Ga0070707_100000592
487 Ga0070707_100001006
488 Ga0070707_100029356
489 Ga0070707_100038769
490 Ga0070707_100051486
491 Ga0070707_100096246
492 Ga0070707_100142221
493 Ga0070698_100000903
494 Ga0070698_100001464
495 Ga0070698_100026494
496 Ga0070698_100179318
497 Ga0070699_100000604
498 Ga0070699_100135823
499 Ga0070679_100035737
500 Ga0070679_100134786
501 Ga0070684_100157975
502 Ga0070684_100334948
503 Ga0070684_100470540
504 Ga0070697_100001265
505 Ga0070697_100004546
506 Ga0070697_100006458
507 Ga0070697_100018532
508 Ga0070697_100062902
509 Ga0070697_100095164
510 Ga0070697_100106387
511 Ga0070697_100164986
512 Ga0070697_100296507
513 Ga0070697_100301192
514 Ga0070697_100914327
515 Ga0068853_100007918
516 Ga0068853_100058903
517 Ga0070672_100053256
518 Ga0070686_100068807
519 Ga0070686_100229664
520 Ga0070695_100010928
521 Ga0070696_100340787
522 Ga0070696_100871216
523 Ga0070693_100036674
524 Ga0068855_100058077
525 Ga0068855_100158469
526 Ga0068855_100236755
527 Ga0070664_100062976
528 Ga0070664_100204680
529 Ga0068857_100001497
530 Ga0068857_100303440
531 Ga0068854_100029396
532 Ga0068854_100135314
533 Ga0068856_100008956
534 Ga0068856_100187885
535 Ga0068856_100220412
536 Ga0070702_100001285
537 Ga0068859_100057927
538 Ga0068864_100121526
539 Ga0068864_100506299
540 Ga0068866_10002294
541 Ga0068861_100111832
542 Ga0068851_10003125
543 Ga0068851_10046351
544 Ga0068870_10016550
545 Ga0068863_100028937
546 Ga0068863_100137393
547 Ga0068863_100347879
548 Ga0068863_100450466
549 Ga0068858_100184903
550 Ga0068860_100020829
551 Ga0068860_100544404
552 Ga0068862_100004657
553 Ga0081455_10137825
554 Ga0070717_10000029
555 Ga0070716_100000157
556 Ga0070716_100068651
557 Ga0070716_100133638
558 Ga0070716_100288383
559 Ga0070712_100027924
560 Ga0070712_100035931
561 Ga0070712_100113989
562 Ga0097621_100084948
563 Ga0097621_100219369
564 Ga0097621_100431575
565 Ga0097621_100604393
566 Ga0097621_100717454
567 Ga0068871_100104433
568 Ga0068871_100152948
569 Ga0068871_100370382
570 Ga0075433_10005995
571 Ga0075433_10007733
572 Ga0075434_100000201
573 Ga0075434_100001903
574 Ga0075434_100360371
575 Ga0068865_100064614
576 Ga0075436_100172544
577 Ga0097620_100057927
578 Ga0075435_100000779
579 Ga0075435_100016323
580 Ga0075435_100886624
581 Ga0105251_10133726
582 Ga0105240_10046160
583 Ga0105240_10078707
584 Ga0105240_11010814
585 Ga0111539_10608218
586 Ga0105245_10007471
587 Ga0105245_10011385
588 Ga0105245_10320801
589 Ga0105245_10823139
590 Ga0105247_10003848
591 Ga0114129_10777226
592 Ga0114129_10820837
593 Ga0105241_10002049
594 Ga0105241_10002978
595 Ga0105241_10335896
596 Ga0105248_10014426
597 Ga0105248_10078001
598 Ga0105248_10176772
599 Ga0105237_10031084
600 Ga0105237_10566244
601 Ga0105238_10016350
602 Ga0105238_10028475
603 Ga0105238_10112229
604 Ga0105249_10005291
605 Ga0105239_10006552
606 Ga0105246_10005119
607 Ga0157373_10005753
608 Ga0157371_10002970
609 Ga0157370_10177389
610 Ga0157369_10002033
611 Ga0157369_10078981
612 Ga0157374_10134378
613 Ga0157374_10212006
614 Ga0157374_10328581
615 Ga0157374_10934870
616 Ga0157378_10000384
617 Ga0157378_10004965
618 Ga0157378_10005045
619 Ga0157378_10041243
620 Ga0157378_10153721
621 Ga0157378_10705530
622 Ga0163162_10084804
623 Ga0163162_10170264
624 Ga0157372_10005047
625 Ga0157372_10034628
626 Ga0157375_10059633
627 Ga0157375_10418362
628 Ga0163163_10001819
629 Ga0163163_10065409
630 Ga0157380_10675930
631 Ga0157377_10001344
632 Ga0157379_10001576
633 Ga0157379_10009309
634 Ga0157376_10044096
635 Ga0157376_10063393
636 Ga0157376_10077447
637 Ga0157376_10734329
638 Ga0182007_10051443
639 Ga0182005_1038718
640 Ga0207697_10024858
641 Ga0207656_10045288
642 Ga0207656_10055739
643 Ga0207682_10004777
644 Ga0207692_10017455
645 Ga0207642_10177699
646 Ga0207710_10281780
647 Ga0207688_10011192
648 Ga0207680_10007495
649 Ga0207699_10039474
650 Ga0207645_10000310
651 Ga0207643_10000514
652 Ga0207684_10000768
653 Ga0207684_10001932
654 Ga0207684_10011879
655 Ga0207684_10226778
656 Ga0207654_10003962
657 Ga0207654_10472002
658 Ga0207707_10128921
659 Ga0207695_10095754
660 Ga0207693_10046446
661 Ga0207693_10049583
662 Ga0207663_10043578
663 Ga0207663_10219501
664 Ga0207660_10275598
665 Ga0207662_10003522
666 Ga0207657_10001677
667 Ga0207657_10033756
668 Ga0207649_10000479
669 Ga0207652_10016932
670 Ga0207652_10130580
671 Ga0207646_10000020
672 Ga0207646_10000564
673 Ga0207646_10004919
674 Ga0207646_10009355
675 Ga0207646_10131129
676 Ga0207646_10299845
677 Ga0207646_10565656
678 Ga0207681_10089222
679 Ga0207694_10067136
680 Ga0207650_10001320
681 Ga0207659_10125756
682 Ga0207687_10057843
683 Ga0207687_10109120
684 Ga0207687_10283760
685 Ga0207700_10933655
686 Ga0207644_10019284
687 Ga0207690_10287997
688 Ga0207706_10000595
689 Ga0207706_10007827
690 Ga0207670_10001577
691 Ga0207670_10471330
692 Ga0207669_10028517
693 Ga0207669_10823396
694 Ga0207704_10071719
695 Ga0207665_10000085
696 Ga0207665_10031908
697 Ga0207665_10130035
698 Ga0207665_10259884
699 Ga0207691_10000404
700 Ga0207711_10032040
701 Ga0207711_10204160
702 Ga0207689_10001889
703 Ga0207689_10155424
704 Ga0207661_10000196
705 Ga0207661_10317145
706 Ga0207679_10000281
707 Ga0207651_10008547
708 Ga0207668_10032776
709 Ga0207640_10307720
710 Ga0207658_10037343
711 Ga0207658_10249711
712 Ga0207677_10016703
713 Ga0207639_10083288
714 Ga0207678_10001538
715 Ga0207702_10640303
716 Ga0207641_10000127
717 Ga0207641_10059862
718 Ga0207641_10412211
719 Ga0207641_10663698
720 Ga0207648_10000259
721 Ga0207676_10000923
722 Ga0207676_10023956
723 Ga0207674_10000183
724 Ga0207675_100007265
725 Ga0207683_10000470
726 Ga0207683_10220782
727 Ga0268266_10001535
728 Ga0268265_10002337
729 Ga0268264_10008029
730 Ga0268264_10022039
731 Ga0268264_10470753
732 Ga0265319_1006337
733 Ga0265338_10032700
734 Ga0265338_10455465
735 Ga0265760_10003699
736 Ga0265325_10031113
737 Ga0265331_10164786
738 Ga0307508_10000100
739 Ga0265342_10075884
740 Ga0307413_10251701
741 Ga0307416_100105497
742 Ga0395900_0770060
743 Ga0395905_0357662
744 Ga0395905_0609149
745 Ga0436365_0213241
746 Ga0451853_2464767
747 Ga0439441_008230
748 Ga0451577_0011930
749 Ga0451577_0527656
750 Ga0451577_0581826
751 Ga0453683_0024262
752 Ga0453683_0038222
753 Ga0453683_0047903
754 Ga0453684_0085613
755 Ga0453684_0247729
756 Ga0453684_0283881
757 Ga0451576_0145730
758 Ga0451576_0418651
759 Ga0495580_0000904
760 Ga0495580_0001301
761 Ga0495580_0409705
762 Ga0495630_0048004
763 Ga0495666_0453803
764 Ga0495645_0216168
765 Ga0496100_0052730
766 Ga0496100_0096723
767 Ga0496100_0342225
768 Ga0496101_0034363
769 Ga0496101_0159059
770 Ga0496101_0227244
771 Ga0496102_0003082
772 Ga0496102_0011843
773 Ga0496102_0032360
774 Ga0496102_0044484
775 Ga0496102_0152196
776 Ga0496102_0185474
777 Ga0496103_0006360
778 Ga0496103_0032778
779 Ga0496103_0045967
780 Ga0496103_0069096
781 Ga0496104_0211255
782 Ga0496105_0409644
783 Ga0496105_0725828
784 Ga0496106_0073704
785 Ga0496106_0153157
786 Ga0496106_0401022
787 Ga0496107_0029982
788 Ga0496107_0301007
789 Ga0496108_0000122
790 Ga0496108_0253115
791 Ga0496109_0000141
792 Ga0496109_0086087
793 Ga0496110_0000082
794 Ga0496111_0000370
795 Ga0496112_0006219
796 Ga0496112_0059939
797 Ga0496112_0106718
798 Ga0496112_0436788
799 Ga0496113_0000063
800 Ga0496114_0014425
801 Ga0496114_0185635
802 Ga0496115_0007994
803 Ga0496115_0018506
804 Ga0496115_0030989
805 Ga0501314_018821
806 Ga0501036_0054077
807 Ga0501042_0447958
808 Ga0501071_0001637
809 Ga0501075_0011282
810 Ga0501076_0014065
811 nmdc:mga05p37_749810_c1
812 nmdc:mga0n895_4162_c1
813 nmdc:mga0n895_8235_c1
814 nmdc:mga0rr50_10124_c1
815 nmdc:mga08x19_156046_c1
816 nmdc:mga0a205_131091_c1
817 nmdc:mga0a205_379_c1
818 Ga0500650_0141277
819 Ga0500642_0046744
820 Ga0500568_0008645
821 Ga0501084_0022330
822 Ga0501082_0110044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

59

214

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8207 42 203
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7852 42 203
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7806 36 205
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7791 41 204
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7624 41 204
ID Description Score Start End Superfamily
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8207 42 203 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7852 42 203 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7318 37 206 1.20.120.450
2p1aA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7098 42 208 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7053 41 205 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1Q7YLS0-F1-model_v4 DinB-like domain-containing protein 0.9972 38 214
AF-A0A2N9NSW1-F1-model_v4 DinB-like domain-containing protein 0.997 35 214
AF-A0A2V9FMU5-F1-model_v4 DinB family protein 0.994 34 213
AF-A0A1Q7YLS0-F1-model_v4 DinB-like domain-containing protein 0.9916 38 214
AF-A0A2V9B2B7-F1-model_v4 DinB-like domain-containing protein 0.9903 33 214 GO:0016020

Map