F437490

General Info

Members Datasets Scaffolds Average Seq Length
411 246 822 102

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10436347|Ga0075433_104363471
Length 111
Sequence MNAGVTIWRCTGCGVAYFPERLLCPRCHGHTWQQDRVHEAVVEEVSVIRHMIGQADWTPKRIASVRTSDGQRITVGLRDESGPGTTIALFEDGAAPFGEGKKSQNGLRRGT

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.06
Nodule 0
Rhizoplane 10.22
Rhizosphere 73.48
Stem 0
Stem Tuber 0
Unclassified 16.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10436347 3300006852 Bacteria 1155
2 JGI25153J46596_10010095 3300003215 Bacteria 4307
3 Ga0070690_100203147 3300005330 Bacteria 1380
4 Ga0070677_10193200 3300005333 Bacteria 977
5 Ga0068868_101224394 3300005338 Unclassified 695
6 Ga0070669_100483503 3300005353 Bacteria 1025
7 Ga0070669_100733218 3300005353 Bacteria 836
8 Ga0070671_100894271 3300005355 Bacteria 776
9 Ga0070674_101690901 3300005356 Bacteria 572
10 Ga0070673_101626943 3300005364 Unclassified 610
11 Ga0070709_10080588 3300005434 Bacteria 2123
12 Ga0070714_101427877 3300005435 Unclassified 676
13 Ga0070713_100363748 3300005436 Archaea 1345
14 Ga0070713_101362381 3300005436 Bacteria 688
15 Ga0070710_11537594 3300005437 Unclassified 501
16 Ga0070701_10734766 3300005438 Bacteria 667
17 Ga0070705_100344634 3300005440 Bacteria 1084
18 Ga0070700_100308960 3300005441 Bacteria 1157
19 Ga0070708_100590076 3300005445 Bacteria 1047
20 Ga0070708_101203701 3300005445 Unclassified 709
21 Ga0070678_100348815 3300005456 Bacteria 1272
22 Ga0070662_100483332 3300005457 Bacteria 1031
23 Ga0070681_10309561 3300005458 Bacteria 1489
24 Ga0070706_100171035 3300005467 Bacteria 2029
25 Ga0070706_101520320 3300005467 Bacteria 611
26 Ga0070707_100199660 3300005468 Bacteria 1949
27 Ga0070699_100216444 3300005518 Bacteria 1706
28 Ga0068853_101735182 3300005539 Bacteria 605
29 Ga0070672_100192632 3300005543 Bacteria 1703
30 Ga0070665_100910868 3300005548 Bacteria 892
31 Ga0070704_100134371 3300005549 Bacteria 1922
32 Ga0070664_100624013 3300005564 Bacteria 1001
33 Ga0068859_100150982 3300005617 Bacteria 2399
34 Ga0068859_100420814 3300005617 Bacteria 1432
35 Ga0068866_10072738 3300005718 Bacteria 1822
36 Ga0068866_10538640 3300005718 Bacteria 779
37 Ga0068863_100908951 3300005841 Bacteria 881
38 Ga0068863_100912920 3300005841 Bacteria 879
39 Ga0068863_101007646 3300005841 Bacteria 836
40 Ga0068858_100279082 3300005842 Bacteria 1591
41 Ga0068860_100583994 3300005843 Bacteria 1122
42 Ga0068862_100466532 3300005844 Bacteria 1193
43 Ga0081455_10017936 3300005937 Bacteria 6762
44 Ga0081455_10019110 3300005937 Bacteria 6495
45 Ga0081455_10182412 3300005937 Unclassified 1588
46 Ga0081455_10668919 3300005937 Bacteria 666
47 Ga0081538_10006306 3300005981 Bacteria 10473
48 Ga0070717_10260769 3300006028 Archaea 1533
49 Ga0070717_10324659 3300006028 Unclassified 1372
50 Ga0070717_11431236 3300006028 Unclassified 627
51 Ga0070717_12066114 3300006028 Bacteria 513
52 Ga0075365_10007522 3300006038 Bacteria 6111
53 Ga0075365_10099474 3300006038 Bacteria 1990
54 Ga0075365_10177018 3300006038 Bacteria 1490
55 Ga0075365_10204845 3300006038 Bacteria 1382
56 Ga0075365_10306758 3300006038 Bacteria 1117
57 Ga0075365_10871939 3300006038 Unclassified 635
58 Ga0075365_11325157 3300006038 Bacteria 506
59 Ga0075363_100047384 3300006048 Bacteria 2282
60 Ga0075363_100131267 3300006048 Bacteria 1405
61 Ga0075363_100499285 3300006048 Bacteria 722
62 Ga0075364_10094173 3300006051 Bacteria 1990
63 Ga0075364_10521243 3300006051 Bacteria 812
64 Ga0075364_10875710 3300006051 Bacteria 611
65 Ga0070715_10099439 3300006163 Bacteria 1354
66 Ga0070712_100037815 3300006175 Unclassified 3293
67 Ga0070712_100975161 3300006175 Unclassified 733
68 Ga0070712_101546612 3300006175 Unclassified 580
69 Ga0075362_10020086 3300006177 Bacteria 2788
70 Ga0075362_10105365 3300006177 Unclassified 1322
71 Ga0075367_10183087 3300006178 Bacteria 1306
72 Ga0075367_10199355 3300006178 Bacteria 1250
73 Ga0075367_10237167 3300006178 Bacteria 1142
74 Ga0075367_10249086 3300006178 Bacteria 1114
75 Ga0075367_10285250 3300006178 Bacteria 1038
76 Ga0075367_10408129 3300006178 Bacteria 859
77 Ga0075367_10847595 3300006178 Bacteria 582
78 Ga0075369_10047324 3300006186 Bacteria 1854
79 Ga0075369_10058473 3300006186 Bacteria 1679
80 Ga0075366_10128526 3300006195 Bacteria 1529
81 Ga0075366_10242138 3300006195 Bacteria 1100
82 Ga0097621_101573202 3300006237 Bacteria 625
83 Ga0075370_10033986 3300006353 Bacteria 2857
84 Ga0075370_10192074 3300006353 Bacteria 1203
85 Ga0075370_10196800 3300006353 Bacteria 1188
86 Ga0075370_10218157 3300006353 Bacteria 1127
87 Ga0068871_100193972 3300006358 Bacteria 1751
88 Ga0068871_100663738 3300006358 Bacteria 953
89 Ga0075428_100248712 3300006844 Bacteria 1916
90 Ga0075428_100450657 3300006844 Bacteria 1378
91 Ga0075428_100844359 3300006844 Bacteria 972
92 Ga0075430_100263378 3300006846 Bacteria 1427
93 Ga0075430_100267098 3300006846 Bacteria 1416
94 Ga0075431_100307622 3300006847 Bacteria 1600
95 Ga0075431_100816482 3300006847 Bacteria 905
96 Ga0075433_10891933 3300006852 Bacteria 776
97 Ga0075433_11737970 3300006852 Bacteria 537
98 Ga0075434_100127033 3300006871 Bacteria 2567
99 Ga0075434_100350858 3300006871 Bacteria 1496
100 Ga0075434_100574122 3300006871 Bacteria 1147
101 Ga0075429_100040208 3300006880 Bacteria 4070
102 Ga0075429_100474021 3300006880 Bacteria 1097
103 Ga0075436_100108602 3300006914 Archaea 1936
104 Ga0097620_100150973 3300006931 Bacteria 2399
105 Ga0097620_100420807 3300006931 Bacteria 1432
106 Ga0075435_100367570 3300007076 Bacteria 1234
107 Ga0075435_101723877 3300007076 Bacteria 550
108 Ga0099795_10394471 3300007788 Bacteria 627
109 Ga0111539_10529829 3300009094 Bacteria 1372
110 Ga0111539_11785714 3300009094 Bacteria 713
111 Ga0111539_12205324 3300009094 Unclassified 639
112 Ga0105245_11561675 3300009098 Bacteria 711
113 Ga0105247_10162561 3300009101 Bacteria 1479
114 Ga0105247_11423349 3300009101 Bacteria 562
115 Ga0114129_10210349 3300009147 Bacteria 2630
116 Ga0114129_10384506 3300009147 Bacteria 1853
117 Ga0114129_10639827 3300009147 Bacteria 1374
118 Ga0114129_10766464 3300009147 Bacteria 1234
119 Ga0114129_10967268 3300009147 Bacteria 1074
120 Ga0114129_11680616 3300009147 Unclassified 775
121 Ga0105243_10631083 3300009148 Bacteria 1036
122 Ga0105243_11113585 3300009148 Bacteria 798
123 Ga0105241_12500711 3300009174 Bacteria 517
124 Ga0105242_10549174 3300009176 Bacteria 1107
125 Ga0105242_10777646 3300009176 Bacteria 945
126 Ga0105242_11104672 3300009176 Unclassified 807
127 Ga0105248_10013907 3300009177 Bacteria 8856
128 Ga0105248_12670126 3300009177 Bacteria 569
129 Ga0105238_11849948 3300009551 Bacteria 636
130 Ga0099796_10523887 3300010159 Unclassified 532
131 Ga0105246_10278433 3300011119 Bacteria 1341
132 Ga0157369_11009930 3300013105 Unclassified 852
133 Ga0157378_11656316 3300013297 Bacteria 686
134 Ga0163162_10292119 3300013306 Bacteria 1762
135 Ga0163162_13032122 3300013306 Unclassified 540
136 Ga0157375_10285490 3300013308 Bacteria 1814
137 Ga0157375_12377416 3300013308 Bacteria 632
138 Ga0163163_10065266 3300014325 Bacteria 3613
139 Ga0163163_10392190 3300014325 Bacteria 1446
140 Ga0163163_11004412 3300014325 Unclassified 898
141 Ga0157377_10911704 3300014745 Bacteria 658
142 Ga0157379_10721668 3300014968 Bacteria 937
143 Ga0157376_10441753 3300014969 Bacteria 1267
144 Ga0157376_10866731 3300014969 Bacteria 919
145 Ga0209758_1000217 3300025297 Bacteria 124619
146 Ga0207426_1071523 3300025302 Bacteria 966
147 Ga0207653_10016875 3300025885 Bacteria 2296
148 Ga0207682_10144629 3300025893 Bacteria 1069
149 Ga0207642_10954035 3300025899 Bacteria 551
150 Ga0207710_10119356 3300025900 Bacteria 1258
151 Ga0207685_10176616 3300025905 Bacteria 987
152 Ga0207685_10430665 3300025905 Bacteria 682
153 Ga0207699_10648116 3300025906 Bacteria 771
154 Ga0207645_10504329 3300025907 Bacteria 819
155 Ga0207643_10676841 3300025908 Bacteria 666
156 Ga0207707_10169356 3300025912 Bacteria 1909
157 Ga0207707_11667158 3300025912 Bacteria 500
158 Ga0207693_10317830 3300025915 Bacteria 1219
159 Ga0207693_10818840 3300025915 Unclassified 717
160 Ga0207663_10602732 3300025916 Unclassified 863
161 Ga0207662_10059755 3300025918 Bacteria 2285
162 Ga0207646_10245786 3300025922 Archaea 1616
163 Ga0207681_10425147 3300025923 Bacteria 1077
164 Ga0207687_10412122 3300025927 Bacteria 1113
165 Ga0207700_10357856 3300025928 Bacteria 1272
166 Ga0207700_12016827 3300025928 Unclassified 504
167 Ga0207644_10124377 3300025931 Bacteria 1967
168 Ga0207644_10344897 3300025931 Bacteria 1208
169 Ga0207706_10857549 3300025933 Bacteria 769
170 Ga0207706_11266936 3300025933 Unclassified 610
171 Ga0207686_10104440 3300025934 Bacteria 1898
172 Ga0207686_10617835 3300025934 Bacteria 855
173 Ga0207669_10115022 3300025937 Bacteria 1812
174 Ga0207669_10712448 3300025937 Bacteria 826
175 Ga0207704_11968729 3300025938 Unclassified 503
176 Ga0207665_10105408 3300025939 Bacteria 1974
177 Ga0207665_10679340 3300025939 Unclassified 809
178 Ga0207711_10032572 3300025941 Bacteria 4407
179 Ga0207689_11697220 3300025942 Unclassified 523
180 Ga0207661_12052533 3300025944 Bacteria 518
181 Ga0207679_11752634 3300025945 Bacteria 568
182 Ga0207651_10430790 3300025960 Bacteria 1128
183 Ga0207651_11481918 3300025960 Unclassified 611
184 Ga0207668_11681862 3300025972 Bacteria 573
185 Ga0207678_10113570 3300026067 Bacteria 2311
186 Ga0207708_10325814 3300026075 Bacteria 1255
187 Ga0207702_10402319 3300026078 Bacteria 1321
188 Ga0207641_10731541 3300026088 Bacteria 976
189 Ga0207641_10817368 3300026088 Bacteria 923
190 Ga0207641_11889090 3300026088 Bacteria 599
191 Ga0207648_10069832 3300026089 Bacteria 3061
192 Ga0207675_100515450 3300026118 Bacteria 1192
193 Ga0207675_102492339 3300026118 Bacteria 528
194 Ga0207683_10021013 3300026121 Bacteria 5586
195 Ga0207428_10502469 3300027907 Unclassified 880
196 Ga0268265_10376865 3300028380 Bacteria 1304
197 Ga0268264_10208878 3300028381 Bacteria 1791
198 Ga0268264_11341591 3300028381 Bacteria 726
199 Ga0268264_11859341 3300028381 Unclassified 612
200 Ga0265331_10138975 3300031250 Bacteria 1106
201 Ga0265331_10152914 3300031250 Bacteria 1047
202 Ga0307410_10332355 3300031852 Bacteria 1209
203 Ga0307416_100651835 3300032002 Bacteria 1138
204 Ga0373950_0082057 3300034818 Bacteria 675
205 Ga0373938_0004050 3300034957 Bacteria 2426
206 Ga0373926_0037944 3300035083 Bacteria 1715
207 Ga0373928_0281593 3300035084 Bacteria 504
208 Ga0373932_0027057 3300035112 Bacteria 1565
209 Ga0373936_0007755 3300035113 Bacteria 4031
210 Ga0373939_0038921 3300035114 Bacteria 1421
211 Ga0373945_0002273 3300035116 Bacteria 6013
212 Ga0373945_0163071 3300035116 Bacteria 909
213 Ga0373960_0006715 3300035121 Bacteria 2708
214 Ga0373943_0001769 3300035170 Bacteria 9776
215 Ga0373946_0002933 3300035171 Bacteria 6047
216 Ga0373946_0118110 3300035171 Bacteria 1208
217 Ga0373942_0008688 3300035207 Bacteria 2371
218 Ga0373961_0013064 3300035241 Bacteria 2088
219 Ga0373962_0018742 3300035242 Bacteria 1805
220 Ga0373962_0051322 3300035242 Bacteria 1189
221 Ga0373924_0418032 3300035410 Unclassified 600
222 Ga0373931_0002183 3300035691 Bacteria 8632
223 Ga0373931_0224883 3300035691 Bacteria 1131
224 Ga0373931_1090993 3300035691 Bacteria 543
225 Ga0373935_0007619 3300035692 Bacteria 6485
226 Ga0373935_0138334 3300035692 Bacteria 1643
227 Ga0373935_0415966 3300035692 Unclassified 967
228 Ga0373927_0004037 3300035695 Bacteria 10378
229 Ga0373927_0053252 3300035695 Bacteria 2617
230 Ga0373927_0262815 3300035695 Bacteria 1135
231 Ga0373947_0117021 3300035725 Bacteria 1690
232 Ga0373947_0261162 3300035725 Bacteria 1148
233 Ga0373947_0699677 3300035725 Bacteria 691
234 Ga0373947_0972510 3300035725 Unclassified 579
235 Ga0373925_0023812 3300037068 Bacteria 4466
236 Ga0373925_0343481 3300037068 Bacteria 1211
237 Ga0373925_1155348 3300037068 Bacteria 637
238 Ga0373925_1207830 3300037068 Bacteria 621
239 Ga0451793_1573411 3300041452 Unclassified 532
240 Ga0451853_0978691 3300041512 Unclassified 591
241 Ga0495617_028807 3300046452 Unclassified 1867
242 Ga0495603_0001954 3300046455 Bacteria 12167
243 Ga0495603_0199546 3300046455 Bacteria 1156
244 Ga0495638_0074847 3300046460 Bacteria 2065
245 Ga0495641_0087846 3300046461 Unclassified 1390
246 Ga0495641_0126904 3300046461 Bacteria 1138
247 Ga0495580_0148652 3300046472 Bacteria 1623
248 Ga0495582_0029330 3300046473 Bacteria 3020
249 Ga0495639_0054616 3300046475 Bacteria 1821
250 Ga0495639_0538045 3300046475 Unclassified 598
251 Ga0495664_0271030 3300046477 Bacteria 1026
252 Ga0495584_0028234 3300046491 Bacteria 2843
253 Ga0495585_0013431 3300046492 Bacteria 4793
254 Ga0495607_0026387 3300046501 Bacteria 3605
255 Ga0495618_0333750 3300046514 Unclassified 937
256 Ga0495630_0573143 3300046517 Bacteria 865
257 Ga0495637_0023510 3300046520 Unclassified 2800
258 Ga0495644_0002605 3300046523 Bacteria 7173
259 Ga0495663_0020895 3300046525 Unclassified 1881
260 Ga0495663_0128537 3300046525 Bacteria 853
261 Ga0495666_0023853 3300046526 Bacteria 3025
262 Ga0495665_0206745 3300046531 Unclassified 1017
263 Ga0495598_0000752 3300046537 Bacteria 6180
264 Ga0495609_0163078 3300046538 Unclassified 944
265 Ga0495621_0018606 3300046539 Unclassified 2258
266 Ga0495622_0088156 3300046557 Bacteria 1426
267 Ga0495633_0072136 3300046558 Unclassified 1610
268 Ga0495633_0279820 3300046558 Bacteria 759
269 Ga0495656_0003908 3300046615 Bacteria 5069
270 Ga0495656_0030296 3300046615 Bacteria 2186
271 Ga0495668_0036385 3300046616 Bacteria 2759
272 Ga0495611_0226709 3300046648 Bacteria 869
273 Ga0495625_0801031 3300046660 Bacteria 548
274 Ga0495635_0970934 3300046663 Bacteria 542
275 Ga0495659_0146790 3300046664 Unclassified 945
276 Ga0495659_0296487 3300046664 Bacteria 682
277 Ga0495661_0099732 3300046665 Bacteria 1637
278 Ga0495588_0240280 3300046674 Unclassified 955
279 Ga0495657_0409795 3300046675 Bacteria 797
280 Ga0495647_0183933 3300046681 Bacteria 910
281 Ga0495658_0002702 3300046683 Bacteria 8936
282 Ga0495669_0002081 3300046684 Bacteria 8194
283 Ga0495613_0755452 3300046689 Unclassified 637
284 Ga0495624_0010623 3300046690 Bacteria 6340
285 Ga0495624_0031652 3300046690 Bacteria 3436
286 Ga0495670_0075687 3300046691 Bacteria 1709
287 Ga0495589_0024765 3300046794 Bacteria 3049
288 Ga0495581_0245922 3300047315 Bacteria 1046
289 Ga0495581_0461598 3300047315 Bacteria 739
290 Ga0495636_0222518 3300047318 Unclassified 867
291 Ga0495674_0159051 3300047319 Bacteria 1891
292 Ga0495674_0844834 3300047319 Bacteria 710
293 Ga0495672_0205287 3300047320 Bacteria 983
294 Ga0495676_0072490 3300047321 Bacteria 2644
295 Ga0495676_0864029 3300047321 Unclassified 580
296 Ga0495679_036315 3300047446 Bacteria 1557
297 Ga0495685_205364 3300047447 Unclassified 631
298 Ga0495602_1127018 3300048088 Unclassified 513
299 Ga0495615_0095650 3300048090 Unclassified 833
300 Ga0496100_0520021 3300048903 Bacteria 918
301 Ga0496101_0151126 3300048904 Bacteria 1776
302 Ga0496101_0155909 3300048904 Bacteria 1749
303 Ga0496101_1045462 3300048904 Bacteria 642
304 Ga0496102_0448533 3300048905 Bacteria 1210
305 Ga0496103_0552436 3300048906 Bacteria 735
306 Ga0496104_0001339 3300048907 Bacteria 21311
307 Ga0496104_0007208 3300048907 Bacteria 9807
308 Ga0496104_0206421 3300048907 Bacteria 1876
309 Ga0496104_0642685 3300048907 Unclassified 970
310 Ga0496105_0018707 3300048908 Bacteria 5577
311 Ga0496105_0073859 3300048908 Bacteria 2817
312 Ga0496106_0074193 3300048909 Bacteria 2604
313 Ga0496106_0751223 3300048909 Unclassified 775
314 Ga0496106_0855815 3300048909 Bacteria 719
315 Ga0496107_0021953 3300048910 Bacteria 4509
316 Ga0496108_0063981 3300048911 Bacteria 3098
317 Ga0496109_0101378 3300048912 Bacteria 2672
318 Ga0496109_0275233 3300048912 Bacteria 1586
319 Ga0496109_0396591 3300048912 Bacteria 1304
320 Ga0496109_0577641 3300048912 Unclassified 1059
321 Ga0496110_0207241 3300048913 Bacteria 1782
322 Ga0496110_0309339 3300048913 Bacteria 1439
323 Ga0496111_0019770 3300048914 Bacteria 4684
324 Ga0496111_0911411 3300048914 Bacteria 633
325 Ga0496112_0053269 3300048915 Bacteria 3973
326 Ga0496112_0086986 3300048915 Bacteria 3092
327 Ga0496112_0131658 3300048915 Bacteria 2472
328 Ga0496112_0206711 3300048915 Bacteria 1921
329 Ga0496113_0093057 3300048916 Bacteria 2326
330 Ga0496113_0163447 3300048916 Bacteria 1761
331 Ga0496113_0919206 3300048916 Bacteria 691
332 Ga0496114_0043275 3300048917 Bacteria 3734
333 Ga0496114_0611077 3300048917 Bacteria 961
334 Ga0496114_0935326 3300048917 Unclassified 749
335 Ga0496114_1092810 3300048917 Bacteria 682
336 Ga0496115_0041877 3300048918 Bacteria 3647
337 Ga0496115_0084833 3300048918 Bacteria 2583
338 Ga0496115_0281767 3300048918 Bacteria 1364
339 Ga0496115_0699987 3300048918 Bacteria 796
340 Ga0496115_0941998 3300048918 Unclassified 663
341 Ga0501040_0087147 3300049576 Bacteria 2168
342 Ga0501040_1431168 3300049576 Unclassified 502
343 Ga0501042_1052824 3300049578 Bacteria 593
344 Ga0501046_0573164 3300049580 Bacteria 803
345 Ga0501072_0264215 3300049588 Bacteria 1370
346 Ga0501072_0438601 3300049588 Bacteria 1035
347 Ga0501074_0897069 3300049590 Bacteria 624
348 Ga0501076_0427232 3300049592 Bacteria 1090
349 Ga0501077_0204305 3300049593 Bacteria 1255
350 Ga0501077_0425980 3300049593 Bacteria 849
351 Ga0501080_0463511 3300049742 Bacteria 1135
352 Ga0501080_0498657 3300049742 Bacteria 1088
353 Ga0501081_0866494 3300049743 Bacteria 680
354 Ga0501083_0100648 3300049744 Bacteria 1906
355 Ga0501045_0086157 3300049824 Bacteria 2319
356 nmdc:mga03683_31756_c1 3300050489 Unclassified 1249
357 nmdc:mga03683_38173_c1 3300050489 Bacteria 1960
358 nmdc:mga03n38_202382_c1 3300050490 Bacteria 1028
359 nmdc:mga03n38_682716_c1 3300050490 Bacteria 591
360 nmdc:mga03n38_896444_c1 3300050490 Unclassified 521
361 nmdc:mga00v17_470959_c1 3300050491 Bacteria 815
362 nmdc:mga00v17_69610_c1 3300050491 Bacteria 2178
363 nmdc:mga00v17_90558_c1 3300050491 Bacteria 1921
364 nmdc:mga00v17_968067_c1 3300050491 Unclassified 537
365 nmdc:mga0yw44_105693_c2 3300050492 Unclassified 752
366 nmdc:mga0yw44_1081055_c1 3300050492 Bacteria 542
367 nmdc:mga0yw44_12198_c1 3300050492 Bacteria 4470
368 nmdc:mga0yw44_213561_c1 3300050492 Archaea 1277
369 nmdc:mga0yw44_554743_c1 3300050492 Unclassified 780
370 nmdc:mga0yw44_7912_c1 3300050492 Bacteria 5266
371 nmdc:mga0k408_102182_c1 3300050493 Bacteria 1691
372 nmdc:mga0k408_153906_c1 3300050493 Bacteria 1369
373 nmdc:mga0k408_72363_c1 3300050493 Bacteria 2013
374 nmdc:mga06z11_192736_c1 3300050494 Bacteria 1180
375 nmdc:mga06z11_201726_c1 3300050494 Bacteria 1156
376 nmdc:mga06z11_205250_c1 3300050494 Bacteria 1146
377 nmdc:mga06z11_88364_c1 3300050494 Bacteria 1678
378 nmdc:mga04h51_266063_c1 3300050495 Bacteria 691
379 nmdc:mga07m45_127688_c1 3300050496 Bacteria 1471
380 nmdc:mga07m45_172622_c1 3300050496 Bacteria 1257
381 nmdc:mga07m45_582251_c1 3300050496 Unclassified 646
382 nmdc:mga05p37_381425_c1 3300050507 Bacteria 1651
383 nmdc:mga05p37_465825_c1 3300050507 Bacteria 1459
384 nmdc:mga09592_105650_c1 3300050508 Bacteria 2414
385 nmdc:mga09592_213023_c1 3300050508 Bacteria 1674
386 nmdc:mga0qj67_217555_c1 3300050509 Bacteria 1551
387 nmdc:mga06r32_283713_c1 3300050510 Bacteria 1643
388 nmdc:mga06r32_777122_c1 3300050510 Bacteria 919
389 nmdc:mga06r32_88799_c1 3300050510 Bacteria 3017
390 nmdc:mga08y16_81294_c1 3300050511 Bacteria 3378
391 nmdc:mga0n895_100571_c1 3300050512 Bacteria 2900
392 nmdc:mga0n895_221040_c1 3300050512 Bacteria 1923
393 nmdc:mga0n895_272439_c1 3300050512 Archaea 1717
394 nmdc:mga0rr50_625148_c1 3300050513 Bacteria 918
395 nmdc:mga08x19_282098_c1 3300050514 Bacteria 1151
396 nmdc:mga0a205_1232901_c1 3300050515 Bacteria 596
397 nmdc:mga0sz30_50586_c2 3300050516 Bacteria 1576
398 Ga0495601_0158130 3300053077 Bacteria 1480
399 Ga0495601_0847593 3300053077 Unclassified 579
400 Ga0495612_0551785 3300053078 Unclassified 531
401 Ga0500644_0103938 3300053088 Bacteria 1084
402 Ga0500646_0111013 3300053090 Unclassified 872
403 Ga0500562_096147 3300053108 Unclassified 805
404 Ga0500652_068555 3300053131 Bacteria 1467
405 Ga0500658_0500953 3300053134 Bacteria 550
406 Ga0500588_0270990 3300053146 Bacteria 640
407 Ga0501084_0299810 3300054114 Bacteria 1357
408 Ga0501082_1000999 3300060353 Bacteria 731
409 Ga0501082_1148569 3300060353 Bacteria 679
410 Ga0530510_0056368 3300061734 Bacteria 2839
411 Ga0530510_0231407 3300061734 Bacteria 1375
412 Ga0075433_10436347
413 JGI25153J46596_10010095
414 Ga0070690_100203147
415 Ga0070677_10193200
416 Ga0068868_101224394
417 Ga0070669_100483503
418 Ga0070669_100733218
419 Ga0070671_100894271
420 Ga0070674_101690901
421 Ga0070673_101626943
422 Ga0070709_10080588
423 Ga0070714_101427877
424 Ga0070713_100363748
425 Ga0070713_101362381
426 Ga0070710_11537594
427 Ga0070701_10734766
428 Ga0070705_100344634
429 Ga0070700_100308960
430 Ga0070708_100590076
431 Ga0070708_101203701
432 Ga0070678_100348815
433 Ga0070662_100483332
434 Ga0070681_10309561
435 Ga0070706_100171035
436 Ga0070706_101520320
437 Ga0070707_100199660
438 Ga0070699_100216444
439 Ga0068853_101735182
440 Ga0070672_100192632
441 Ga0070665_100910868
442 Ga0070704_100134371
443 Ga0070664_100624013
444 Ga0068859_100150982
445 Ga0068859_100420814
446 Ga0068866_10072738
447 Ga0068866_10538640
448 Ga0068863_100908951
449 Ga0068863_100912920
450 Ga0068863_101007646
451 Ga0068858_100279082
452 Ga0068860_100583994
453 Ga0068862_100466532
454 Ga0081455_10017936
455 Ga0081455_10019110
456 Ga0081455_10182412
457 Ga0081455_10668919
458 Ga0081538_10006306
459 Ga0070717_10260769
460 Ga0070717_10324659
461 Ga0070717_11431236
462 Ga0070717_12066114
463 Ga0075365_10007522
464 Ga0075365_10099474
465 Ga0075365_10177018
466 Ga0075365_10204845
467 Ga0075365_10306758
468 Ga0075365_10871939
469 Ga0075365_11325157
470 Ga0075363_100047384
471 Ga0075363_100131267
472 Ga0075363_100499285
473 Ga0075364_10094173
474 Ga0075364_10521243
475 Ga0075364_10875710
476 Ga0070715_10099439
477 Ga0070712_100037815
478 Ga0070712_100975161
479 Ga0070712_101546612
480 Ga0075362_10020086
481 Ga0075362_10105365
482 Ga0075367_10183087
483 Ga0075367_10199355
484 Ga0075367_10237167
485 Ga0075367_10249086
486 Ga0075367_10285250
487 Ga0075367_10408129
488 Ga0075367_10847595
489 Ga0075369_10047324
490 Ga0075369_10058473
491 Ga0075366_10128526
492 Ga0075366_10242138
493 Ga0097621_101573202
494 Ga0075370_10033986
495 Ga0075370_10192074
496 Ga0075370_10196800
497 Ga0075370_10218157
498 Ga0068871_100193972
499 Ga0068871_100663738
500 Ga0075428_100248712
501 Ga0075428_100450657
502 Ga0075428_100844359
503 Ga0075430_100263378
504 Ga0075430_100267098
505 Ga0075431_100307622
506 Ga0075431_100816482
507 Ga0075433_10891933
508 Ga0075433_11737970
509 Ga0075434_100127033
510 Ga0075434_100350858
511 Ga0075434_100574122
512 Ga0075429_100040208
513 Ga0075429_100474021
514 Ga0075436_100108602
515 Ga0097620_100150973
516 Ga0097620_100420807
517 Ga0075435_100367570
518 Ga0075435_101723877
519 Ga0099795_10394471
520 Ga0111539_10529829
521 Ga0111539_11785714
522 Ga0111539_12205324
523 Ga0105245_11561675
524 Ga0105247_10162561
525 Ga0105247_11423349
526 Ga0114129_10210349
527 Ga0114129_10384506
528 Ga0114129_10639827
529 Ga0114129_10766464
530 Ga0114129_10967268
531 Ga0114129_11680616
532 Ga0105243_10631083
533 Ga0105243_11113585
534 Ga0105241_12500711
535 Ga0105242_10549174
536 Ga0105242_10777646
537 Ga0105242_11104672
538 Ga0105248_10013907
539 Ga0105248_12670126
540 Ga0105238_11849948
541 Ga0099796_10523887
542 Ga0105246_10278433
543 Ga0157369_11009930
544 Ga0157378_11656316
545 Ga0163162_10292119
546 Ga0163162_13032122
547 Ga0157375_10285490
548 Ga0157375_12377416
549 Ga0163163_10065266
550 Ga0163163_10392190
551 Ga0163163_11004412
552 Ga0157377_10911704
553 Ga0157379_10721668
554 Ga0157376_10441753
555 Ga0157376_10866731
556 Ga0209758_1000217
557 Ga0207426_1071523
558 Ga0207653_10016875
559 Ga0207682_10144629
560 Ga0207642_10954035
561 Ga0207710_10119356
562 Ga0207685_10176616
563 Ga0207685_10430665
564 Ga0207699_10648116
565 Ga0207645_10504329
566 Ga0207643_10676841
567 Ga0207707_10169356
568 Ga0207707_11667158
569 Ga0207693_10317830
570 Ga0207693_10818840
571 Ga0207663_10602732
572 Ga0207662_10059755
573 Ga0207646_10245786
574 Ga0207681_10425147
575 Ga0207687_10412122
576 Ga0207700_10357856
577 Ga0207700_12016827
578 Ga0207644_10124377
579 Ga0207644_10344897
580 Ga0207706_10857549
581 Ga0207706_11266936
582 Ga0207686_10104440
583 Ga0207686_10617835
584 Ga0207669_10115022
585 Ga0207669_10712448
586 Ga0207704_11968729
587 Ga0207665_10105408
588 Ga0207665_10679340
589 Ga0207711_10032572
590 Ga0207689_11697220
591 Ga0207661_12052533
592 Ga0207679_11752634
593 Ga0207651_10430790
594 Ga0207651_11481918
595 Ga0207668_11681862
596 Ga0207678_10113570
597 Ga0207708_10325814
598 Ga0207702_10402319
599 Ga0207641_10731541
600 Ga0207641_10817368
601 Ga0207641_11889090
602 Ga0207648_10069832
603 Ga0207675_100515450
604 Ga0207675_102492339
605 Ga0207683_10021013
606 Ga0207428_10502469
607 Ga0268265_10376865
608 Ga0268264_10208878
609 Ga0268264_11341591
610 Ga0268264_11859341
611 Ga0265331_10138975
612 Ga0265331_10152914
613 Ga0307410_10332355
614 Ga0307416_100651835
615 Ga0373950_0082057
616 Ga0373938_0004050
617 Ga0373926_0037944
618 Ga0373928_0281593
619 Ga0373932_0027057
620 Ga0373936_0007755
621 Ga0373939_0038921
622 Ga0373945_0002273
623 Ga0373945_0163071
624 Ga0373960_0006715
625 Ga0373943_0001769
626 Ga0373946_0002933
627 Ga0373946_0118110
628 Ga0373942_0008688
629 Ga0373961_0013064
630 Ga0373962_0018742
631 Ga0373962_0051322
632 Ga0373924_0418032
633 Ga0373931_0002183
634 Ga0373931_0224883
635 Ga0373931_1090993
636 Ga0373935_0007619
637 Ga0373935_0138334
638 Ga0373935_0415966
639 Ga0373927_0004037
640 Ga0373927_0053252
641 Ga0373927_0262815
642 Ga0373947_0117021
643 Ga0373947_0261162
644 Ga0373947_0699677
645 Ga0373947_0972510
646 Ga0373925_0023812
647 Ga0373925_0343481
648 Ga0373925_1155348
649 Ga0373925_1207830
650 Ga0451793_1573411
651 Ga0451853_0978691
652 Ga0495617_028807
653 Ga0495603_0001954
654 Ga0495603_0199546
655 Ga0495638_0074847
656 Ga0495641_0087846
657 Ga0495641_0126904
658 Ga0495580_0148652
659 Ga0495582_0029330
660 Ga0495639_0054616
661 Ga0495639_0538045
662 Ga0495664_0271030
663 Ga0495584_0028234
664 Ga0495585_0013431
665 Ga0495607_0026387
666 Ga0495618_0333750
667 Ga0495630_0573143
668 Ga0495637_0023510
669 Ga0495644_0002605
670 Ga0495663_0020895
671 Ga0495663_0128537
672 Ga0495666_0023853
673 Ga0495665_0206745
674 Ga0495598_0000752
675 Ga0495609_0163078
676 Ga0495621_0018606
677 Ga0495622_0088156
678 Ga0495633_0072136
679 Ga0495633_0279820
680 Ga0495656_0003908
681 Ga0495656_0030296
682 Ga0495668_0036385
683 Ga0495611_0226709
684 Ga0495625_0801031
685 Ga0495635_0970934
686 Ga0495659_0146790
687 Ga0495659_0296487
688 Ga0495661_0099732
689 Ga0495588_0240280
690 Ga0495657_0409795
691 Ga0495647_0183933
692 Ga0495658_0002702
693 Ga0495669_0002081
694 Ga0495613_0755452
695 Ga0495624_0010623
696 Ga0495624_0031652
697 Ga0495670_0075687
698 Ga0495589_0024765
699 Ga0495581_0245922
700 Ga0495581_0461598
701 Ga0495636_0222518
702 Ga0495674_0159051
703 Ga0495674_0844834
704 Ga0495672_0205287
705 Ga0495676_0072490
706 Ga0495676_0864029
707 Ga0495679_036315
708 Ga0495685_205364
709 Ga0495602_1127018
710 Ga0495615_0095650
711 Ga0496100_0520021
712 Ga0496101_0151126
713 Ga0496101_0155909
714 Ga0496101_1045462
715 Ga0496102_0448533
716 Ga0496103_0552436
717 Ga0496104_0001339
718 Ga0496104_0007208
719 Ga0496104_0206421
720 Ga0496104_0642685
721 Ga0496105_0018707
722 Ga0496105_0073859
723 Ga0496106_0074193
724 Ga0496106_0751223
725 Ga0496106_0855815
726 Ga0496107_0021953
727 Ga0496108_0063981
728 Ga0496109_0101378
729 Ga0496109_0275233
730 Ga0496109_0396591
731 Ga0496109_0577641
732 Ga0496110_0207241
733 Ga0496110_0309339
734 Ga0496111_0019770
735 Ga0496111_0911411
736 Ga0496112_0053269
737 Ga0496112_0086986
738 Ga0496112_0131658
739 Ga0496112_0206711
740 Ga0496113_0093057
741 Ga0496113_0163447
742 Ga0496113_0919206
743 Ga0496114_0043275
744 Ga0496114_0611077
745 Ga0496114_0935326
746 Ga0496114_1092810
747 Ga0496115_0041877
748 Ga0496115_0084833
749 Ga0496115_0281767
750 Ga0496115_0699987
751 Ga0496115_0941998
752 Ga0501040_0087147
753 Ga0501040_1431168
754 Ga0501042_1052824
755 Ga0501046_0573164
756 Ga0501072_0264215
757 Ga0501072_0438601
758 Ga0501074_0897069
759 Ga0501076_0427232
760 Ga0501077_0204305
761 Ga0501077_0425980
762 Ga0501080_0463511
763 Ga0501080_0498657
764 Ga0501081_0866494
765 Ga0501083_0100648
766 Ga0501045_0086157
767 nmdc:mga03683_31756_c1
768 nmdc:mga03683_38173_c1
769 nmdc:mga03n38_202382_c1
770 nmdc:mga03n38_682716_c1
771 nmdc:mga03n38_896444_c1
772 nmdc:mga00v17_470959_c1
773 nmdc:mga00v17_69610_c1
774 nmdc:mga00v17_90558_c1
775 nmdc:mga00v17_968067_c1
776 nmdc:mga0yw44_105693_c2
777 nmdc:mga0yw44_1081055_c1
778 nmdc:mga0yw44_12198_c1
779 nmdc:mga0yw44_213561_c1
780 nmdc:mga0yw44_554743_c1
781 nmdc:mga0yw44_7912_c1
782 nmdc:mga0k408_102182_c1
783 nmdc:mga0k408_153906_c1
784 nmdc:mga0k408_72363_c1
785 nmdc:mga06z11_192736_c1
786 nmdc:mga06z11_201726_c1
787 nmdc:mga06z11_205250_c1
788 nmdc:mga06z11_88364_c1
789 nmdc:mga04h51_266063_c1
790 nmdc:mga07m45_127688_c1
791 nmdc:mga07m45_172622_c1
792 nmdc:mga07m45_582251_c1
793 nmdc:mga05p37_381425_c1
794 nmdc:mga05p37_465825_c1
795 nmdc:mga09592_105650_c1
796 nmdc:mga09592_213023_c1
797 nmdc:mga0qj67_217555_c1
798 nmdc:mga06r32_283713_c1
799 nmdc:mga06r32_777122_c1
800 nmdc:mga06r32_88799_c1
801 nmdc:mga08y16_81294_c1
802 nmdc:mga0n895_100571_c1
803 nmdc:mga0n895_221040_c1
804 nmdc:mga0n895_272439_c1
805 nmdc:mga0rr50_625148_c1
806 nmdc:mga08x19_282098_c1
807 nmdc:mga0a205_1232901_c1
808 nmdc:mga0sz30_50586_c2
809 Ga0495601_0158130
810 Ga0495601_0847593
811 Ga0495612_0551785
812 Ga0500644_0103938
813 Ga0500646_0111013
814 Ga0500562_096147
815 Ga0500652_068555
816 Ga0500658_0500953
817 Ga0500588_0270990
818 Ga0501084_0299810
819 Ga0501082_1000999
820 Ga0501082_1148569
821 Ga0530510_0056368
822 Ga0530510_0231407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12172

DUF35_N

Rubredoxin-like zinc ribbon domain (DUF35_N)

6

33

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6skf-assembly1.cif.gz_Bj cryo-em structure of t. kodakarensis 70s ribosome 0.8751 11 39
8hl2-assembly1.cif.gz_L40E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8339 11 39
5t2a-assembly1.cif.gz_AS cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution 0.8122 42 102
4bts-assembly1.cif.gz_BL the crystal structure of the eukaryotic 40s ribosomal subunit in complex with eif1 and eif1a 0.8103 42 102
7pzy-assembly1.cif.gz_Y structure of the vacant candida albicans 80s ribosome 0.8078 42 102
ID Description Score Start End Superfamily
af_A0A1D8PDU3_27_145_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8033 42 102 2.40.50.140
af_Q9U0G9_142_272_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7781 42 102 2.40.50.140
af_P10735_31_139_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7616 42 102 2.40.50.140
af_A0A0P0XT53_109_185_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7577 42 92 2.40.50.140
5l37D00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.7425 42 93 2.40.50.220
ID Description Score Start End GO Terms
AF-A0A424IX16-F1-model_v4 DUF35 domain-containing protein 0.9822 14 106
AF-A0A6L5FHB9-F1-model_v4 DNA-binding protein 0.9658 7 106 GO:0003677
AF-A0A537VV52-F1-model_v4 DUF35 domain-containing protein 0.9635 6 106
AF-A0A424IX16-F1-model_v4 DUF35 domain-containing protein 0.9618 14 106
AF-A0A537VV52-F1-model_v4 DUF35 domain-containing protein 0.9453 6 106

Map