F437454

General Info

Members Datasets Scaffolds Average Seq Length
411 185 822 242

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100062318|Ga0070714_1000623184
Length 259
Sequence LRVEEARPRLEALGFRPEDVETLAAHFLDAESRGSLGHGLSRIEWLETWAAIDVDARPVRLVAEPGYEHWDGAGALGYLTLAAVVDAQLAEPPSRARLVVCSHTFPTGALGYWVRQLAAGGLVGVLTATSPRRLPPPGGGEPLTGTNPLAIAIPSSEGVPVVADVSMGAVTHGAVLAGLARPDELVPFGGPHAHKAFALAVGLQLLVDALVPDEGFGAVLLVARPDADPVPELRRLADGVRLPGDSLRDLSDSSGSLPP

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.22
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100062318 3300005435 Bacteria 3205
2 Ga0070658_10055007 3300005327 Bacteria 3232
3 Ga0070658_10133424 3300005327 Bacteria 2070
4 Ga0070658_10333606 3300005327 Bacteria 1296
5 Ga0070683_100070279 3300005329 Bacteria 3265
6 Ga0070683_100141344 3300005329 Bacteria 2281
7 Ga0070683_100540996 3300005329 Bacteria 1113
8 Ga0070683_100988743 3300005329 Bacteria 808
9 Ga0070680_100029538 3300005336 Bacteria 4403
10 Ga0070680_100044077 3300005336 Bacteria 3624
11 Ga0070680_100052488 3300005336 Bacteria 3328
12 Ga0070680_100074642 3300005336 Bacteria 2791
13 Ga0070680_100093170 3300005336 Bacteria 2495
14 Ga0070680_100125563 3300005336 Bacteria 2144
15 Ga0070682_100154385 3300005337 Bacteria 1579
16 Ga0070682_100173331 3300005337 Bacteria 1501
17 Ga0070660_100000984 3300005339 Bacteria 19070
18 Ga0070660_100008211 3300005339 Bacteria 7297
19 Ga0070660_100043571 3300005339 Bacteria 3430
20 Ga0070661_100010897 3300005344 Bacteria 6331
21 Ga0070661_100015673 3300005344 Bacteria 5350
22 Ga0070661_100084184 3300005344 Bacteria 2350
23 Ga0070659_100047383 3300005366 Bacteria 3371
24 Ga0070714_100048553 3300005435 Bacteria 3610
25 Ga0070710_10248702 3300005437 Bacteria 1142
26 Ga0070711_100005702 3300005439 Bacteria 7465
27 Ga0070705_100124635 3300005440 Bacteria 1669
28 Ga0070708_100005931 3300005445 Bacteria 9714
29 Ga0070708_100118887 3300005445 Bacteria 2435
30 Ga0070681_10009254 3300005458 Bacteria 9684
31 Ga0070681_10019910 3300005458 Bacteria 6723
32 Ga0070681_10033774 3300005458 Bacteria 5135
33 Ga0070681_10036885 3300005458 Bacteria 4907
34 Ga0070681_10069651 3300005458 Bacteria 3484
35 Ga0070681_10094342 3300005458 Bacteria 2941
36 Ga0070681_10118608 3300005458 Bacteria 2583
37 Ga0070681_10128812 3300005458 Bacteria 2463
38 Ga0070706_100049551 3300005467 Bacteria 3876
39 Ga0070706_100108438 3300005467 Bacteria 2584
40 Ga0070698_100119011 3300005471 Bacteria 2602
41 Ga0070679_100024523 3300005530 Bacteria 5911
42 Ga0070679_100029343 3300005530 Bacteria 5428
43 Ga0070679_100030787 3300005530 Bacteria 5300
44 Ga0070679_100033763 3300005530 Bacteria 5066
45 Ga0070679_100050625 3300005530 Archaea 4138
46 Ga0070679_100085042 3300005530 Bacteria 3150
47 Ga0070679_100128553 3300005530 Bacteria 2515
48 Ga0070679_100360491 3300005530 Unclassified 1401
49 Ga0070684_100003158 3300005535 Bacteria 12307
50 Ga0070684_100049155 3300005535 Bacteria 3659
51 Ga0068853_100305383 3300005539 Bacteria 1472
52 Ga0070696_100263149 3300005546 Unclassified 1309
53 Ga0070693_100064851 3300005547 Unclassified 2133
54 Ga0068855_100006224 3300005563 Bacteria 14542
55 Ga0068855_100017150 3300005563 Bacteria 8711
56 Ga0068855_100026803 3300005563 Bacteria 6895
57 Ga0068855_100265244 3300005563 Bacteria 1912
58 Ga0068855_100410006 3300005563 Bacteria 1484
59 Ga0068857_100032773 3300005577 Bacteria 4592
60 Ga0068857_100039039 3300005577 Bacteria 4204
61 Ga0068854_100191709 3300005578 Bacteria 1602
62 Ga0068856_100036406 3300005614 Bacteria 4825
63 Ga0068856_100079084 3300005614 Bacteria 3261
64 Ga0068856_100150172 3300005614 Unclassified 2339
65 Ga0068852_100030738 3300005616 Bacteria 4425
66 Ga0068852_100052834 3300005616 Bacteria 3495
67 Ga0070717_10014101 3300006028 Bacteria 6142
68 Ga0070717_10146930 3300006028 Bacteria 2037
69 Ga0070717_10427285 3300006028 Bacteria 1192
70 Ga0075434_100006458 3300006871 Bacteria 10745
71 Ga0075435_100115144 3300007076 Bacteria 2238
72 Ga0105240_10009134 3300009093 Bacteria 14072
73 Ga0105240_10019185 3300009093 Bacteria 9142
74 Ga0105240_10100440 3300009093 Bacteria 3521
75 Ga0105240_10509886 3300009093 Unclassified 1336
76 Ga0105245_10234742 3300009098 Bacteria 1775
77 Ga0105241_10250766 3300009174 Bacteria 1501
78 Ga0105237_10056633 3300009545 Bacteria 3923
79 Ga0105237_10491961 3300009545 Unclassified 1233
80 Ga0105238_10051824 3300009551 Bacteria 4126
81 Ga0105238_10213407 3300009551 Bacteria 1906
82 Ga0157370_10002642 3300013104 Bacteria 21525
83 Ga0157370_10060061 3300013104 Bacteria 3611
84 Ga0157370_10153613 3300013104 Bacteria 2141
85 Ga0157370_10320060 3300013104 Bacteria 1431
86 Ga0157370_10831366 3300013104 Bacteria 840
87 Ga0157369_10006270 3300013105 Bacteria 13803
88 Ga0157369_10014867 3300013105 Bacteria 8786
89 Ga0157369_10042900 3300013105 Bacteria 4933
90 Ga0157369_10166069 3300013105 Bacteria 2328
91 Ga0157369_10235806 3300013105 Bacteria 1912
92 Ga0157369_10240222 3300013105 Bacteria 1892
93 Ga0157369_10307895 3300013105 Bacteria 1647
94 Ga0157369_10357989 3300013105 Bacteria 1515
95 Ga0157374_10047704 3300013296 Bacteria 3972
96 Ga0157372_10050747 3300013307 Bacteria 4614
97 Ga0157372_10065665 3300013307 Bacteria 4075
98 Ga0157372_10102254 3300013307 Bacteria 3273
99 Ga0157372_10257884 3300013307 Bacteria 2024
100 Ga0157375_10015522 3300013308 Bacteria 6820
101 Ga0157375_10074915 3300013308 Unclassified 3407
102 Ga0163163_10031474 3300014325 Bacteria 5120
103 Ga0206356_10551105 3300020070 Unclassified 2125
104 Ga0206356_10893402 3300020070 Bacteria 4643
105 Ga0206354_10803545 3300020081 Bacteria 3292
106 Ga0206354_11139467 3300020081 Bacteria 2858
107 Ga0206354_11718414 3300020081 Bacteria 1651
108 Ga0206353_10862134 3300020082 Bacteria 11133
109 Ga0206353_11119996 3300020082 Bacteria 6428
110 Ga0206353_11133803 3300020082 Bacteria 1679
111 Ga0206353_11433193 3300020082 Bacteria 1743
112 Ga0206353_11847047 3300020082 Bacteria 1962
113 Ga0207692_10294603 3300025898 Bacteria 986
114 Ga0207699_10171514 3300025906 Bacteria 1452
115 Ga0207705_10056017 3300025909 Bacteria 2842
116 Ga0207684_10210216 3300025910 Bacteria 1678
117 Ga0207707_10018092 3300025912 Bacteria 6141
118 Ga0207707_10075007 3300025912 Bacteria 2951
119 Ga0207707_10297528 3300025912 Unclassified 1396
120 Ga0207695_10106024 3300025913 Unclassified 2797
121 Ga0207671_10068026 3300025914 Bacteria 2653
122 Ga0207671_10333868 3300025914 Unclassified 1201
123 Ga0207663_10240402 3300025916 Bacteria 1328
124 Ga0207660_10041805 3300025917 Bacteria 3214
125 Ga0207660_10059426 3300025917 Bacteria 2744
126 Ga0207660_10065238 3300025917 Bacteria 2630
127 Ga0207660_10135154 3300025917 Bacteria 1881
128 Ga0207660_10208100 3300025917 Bacteria 1531
129 Ga0207660_10289975 3300025917 Unclassified 1301
130 Ga0207657_10000166 3300025919 Bacteria 67098
131 Ga0207657_10001116 3300025919 Bacteria 28490
132 Ga0207657_10002091 3300025919 Bacteria 21596
133 Ga0207657_10005205 3300025919 Bacteria 13632
134 Ga0207657_10073394 3300025919 Bacteria 2891
135 Ga0207657_10283536 3300025919 Bacteria 1315
136 Ga0207649_10018477 3300025920 Bacteria 3966
137 Ga0207649_10020943 3300025920 Bacteria 3755
138 Ga0207649_10287462 3300025920 Bacteria 1198
139 Ga0207652_10076808 3300025921 Bacteria 2913
140 Ga0207652_10079597 3300025921 Bacteria 2863
141 Ga0207652_10111311 3300025921 Bacteria 2428
142 Ga0207652_10199110 3300025921 Bacteria 1803
143 Ga0207652_10200599 3300025921 Bacteria 1795
144 Ga0207694_10218148 3300025924 Bacteria 1555
145 Ga0207694_10387718 3300025924 Bacteria 1160
146 Ga0207664_10032576 3300025929 Bacteria 3996
147 Ga0207686_10038620 3300025934 Bacteria 2890
148 Ga0207661_10013264 3300025944 Bacteria 6017
149 Ga0207661_10029703 3300025944 Bacteria 4203
150 Ga0207661_10107498 3300025944 Unclassified 2354
151 Ga0207661_10160633 3300025944 Unclassified 1949
152 Ga0207667_10157354 3300025949 Bacteria 2338
153 Ga0207667_10368335 3300025949 Unclassified 1465
154 Ga0207667_10405253 3300025949 Bacteria 1388
155 Ga0207667_10947509 3300025949 Unclassified 850
156 Ga0207677_10680591 3300026023 Bacteria 911
157 Ga0207639_10260585 3300026041 Bacteria 1516
158 Ga0207678_10204376 3300026067 Bacteria 1689
159 Ga0207678_10244947 3300026067 Bacteria 1535
160 Ga0207702_10053339 3300026078 Bacteria 3422
161 Ga0207702_10705215 3300026078 Unclassified 995
162 Ga0207674_10005383 3300026116 Bacteria 15230
163 Ga0207674_10051217 3300026116 Bacteria 4214
164 Ga0207683_10255486 3300026121 Bacteria 1600
165 Ga0207683_10835030 3300026121 Bacteria 855
166 Ga0207698_10124044 3300026142 Bacteria 2192
167 Ga0268266_10079530 3300028379 Bacteria 2855
168 Ga0265334_10009878 3300028573 Bacteria 4034
169 Ga0265322_10002697 3300028654 Bacteria 5446
170 Ga0265338_10011110 3300028800 Bacteria 10436
171 Ga0265325_10008824 3300031241 Bacteria 5922
172 Ga0265340_10041788 3300031247 Unclassified 2253
173 Ga0265339_10027457 3300031249 Bacteria 3249
174 Ga0265327_10021917 3300031251 Bacteria 3838
175 Ga0265316_10010636 3300031344 Bacteria 8369
176 Ga0265316_10097395 3300031344 Bacteria 2239
177 Ga0265313_10006421 3300031595 Bacteria 8325
178 Ga0265314_10005226 3300031711 Bacteria 11767
179 Ga0307406_10092790 3300031901 Bacteria 2037
180 Ga0307407_10338950 3300031903 Unclassified 1061
181 Ga0373936_0007048 3300035113 Bacteria 4229
182 Ga0373945_0025492 3300035116 Bacteria 2054
183 Ga0373943_0005958 3300035170 Bacteria 5469
184 Ga0373947_0012095 3300035725 Bacteria 4943
185 Ga0373947_0017676 3300035725 Bacteria 4103
186 Ga0373947_0069007 3300035725 Bacteria 2163
187 Ga0373937_0176201 3300036401 Bacteria 2007
188 Ga0373937_0228188 3300036401 Bacteria 1753
189 Ga0373925_0048723 3300037068 Unclassified 3157
190 Ga0395899_0003970 3300037312 Bacteria 11655
191 Ga0395899_0091678 3300037312 Unclassified 2201
192 Ga0395900_0014144 3300037418 Bacteria 8148
193 Ga0395900_0036781 3300037418 Bacteria 5046
194 Ga0395900_0049677 3300037418 Bacteria 4322
195 Ga0395900_0127761 3300037418 Bacteria 2606
196 Ga0395900_0162732 3300037418 Unclassified 2275
197 Ga0395898_0005922 3300037466 Bacteria 13132
198 Ga0395898_0008235 3300037466 Bacteria 11019
199 Ga0395898_0023857 3300037466 Bacteria 6175
200 Ga0395898_0702214 3300037466 Unclassified 953
201 Ga0395905_0046361 3300037471 Bacteria 4075
202 Ga0436364_0734328 3300037853 Bacteria 917
203 Ga0395901_0002557 3300038443 Bacteria 18428
204 Ga0395901_0210624 3300038443 Unclassified 2034
205 Ga0436365_1323523 3300039437 Bacteria 4032
206 Ga0466966_0017348 3300044684 Bacteria 4757
207 Ga0466961_0108652 3300044693 Bacteria 1746
208 Ga0466963_0006849 3300044694 Bacteria 6780
209 Ga0466963_0011173 3300044694 Bacteria 5463
210 Ga0466963_0029302 3300044694 Bacteria 3542
211 Ga0466963_0029663 3300044694 Bacteria 3523
212 Ga0466963_0052718 3300044694 Bacteria 2700
213 Ga0466963_0091491 3300044694 Bacteria 2072
214 Ga0466963_0224578 3300044694 Bacteria 1316
215 Ga0466963_0275076 3300044694 Bacteria 1183
216 Ga0466964_0012308 3300044706 Bacteria 3237
217 Ga0466964_0018281 3300044706 Bacteria 2688
218 Ga0466964_0038339 3300044706 Bacteria 1926
219 Ga0466968_0004113 3300044735 Bacteria 5419
220 Ga0466957_0101637 3300044842 Bacteria 1813
221 Ga0466957_0132173 3300044842 Bacteria 1600
222 Ga0466960_0092548 3300044901 Bacteria 1544
223 Ga0466959_0054358 3300045049 Bacteria 2926
224 Ga0451576_0220999 3300045051 Bacteria 1978
225 Ga0466967_0000947 3300045976 Bacteria 15667
226 Ga0466967_0001528 3300045976 Bacteria 13533
227 Ga0466967_0009742 3300045976 Bacteria 7158
228 Ga0466967_0011126 3300045976 Bacteria 6797
229 Ga0466967_0016390 3300045976 Bacteria 5843
230 Ga0466967_0036536 3300045976 Bacteria 4195
231 Ga0466967_0037764 3300045976 Bacteria 4136
232 Ga0466967_0039696 3300045976 Bacteria 4049
233 Ga0466967_0047537 3300045976 Bacteria 3741
234 Ga0466967_0066662 3300045976 Bacteria 3208
235 Ga0466967_0094723 3300045976 Bacteria 2719
236 Ga0466967_0163637 3300045976 Bacteria 2090
237 Ga0466967_0989071 3300045976 Unclassified 837
238 Ga0495603_0000081 3300046455 Bacteria 42501
239 Ga0495641_0010586 3300046461 Bacteria 5326
240 Ga0495651_0043988 3300046462 Bacteria 3462
241 Ga0495664_0185515 3300046477 Bacteria 1261
242 Ga0495594_0000307 3300046499 Bacteria 24065
243 Ga0495608_0037676 3300046511 Bacteria 3251
244 Ga0495628_0023695 3300046516 Bacteria 5035
245 Ga0495628_0084136 3300046516 Bacteria 2469
246 Ga0495630_0007358 3300046517 Bacteria 7863
247 Ga0495630_0073862 3300046517 Unclassified 2568
248 Ga0495666_0008059 3300046526 Bacteria 5283
249 Ga0495652_0127163 3300046529 Bacteria 2023
250 Ga0495652_0188640 3300046529 Bacteria 1575
251 Ga0495652_0252092 3300046529 Bacteria 1307
252 Ga0495640_0031023 3300046533 Bacteria 3820
253 Ga0495640_0106089 3300046533 Bacteria 1840
254 Ga0495587_0062301 3300046536 Bacteria 2184
255 Ga0495645_0075630 3300046543 Bacteria 2424
256 Ga0495667_0043334 3300046559 Bacteria 2982
257 Ga0495667_0047659 3300046559 Bacteria 2830
258 Ga0495667_0286305 3300046559 Bacteria 1046
259 Ga0495634_0029209 3300046642 Bacteria 3818
260 Ga0495635_0021053 3300046663 Bacteria 4545
261 Ga0495657_0084514 3300046675 Bacteria 2047
262 Ga0495646_0106023 3300046680 Bacteria 1605
263 Ga0495647_0027889 3300046681 Bacteria 2078
264 Ga0495658_0084492 3300046683 Bacteria 1869
265 Ga0495613_0179626 3300046689 Bacteria 1499
266 Ga0495600_0156836 3300046809 Bacteria 1472
267 Ga0495581_0184413 3300047315 Unclassified 1221
268 Ga0495581_0196240 3300047315 Bacteria 1181
269 Ga0495604_0063584 3300047317 Bacteria 2814
270 Ga0495674_0028700 3300047319 Bacteria 5069
271 Ga0495674_0051520 3300047319 Bacteria 3629
272 Ga0495676_0004078 3300047321 Bacteria 13311
273 Ga0495676_0085443 3300047321 Bacteria 2377
274 Ga0495680_0002425 3300047322 Bacteria 19080
275 Ga0495680_0013536 3300047322 Bacteria 7110
276 Ga0495675_0025465 3300047444 Bacteria 3772
277 Ga0495684_0014025 3300047471 Bacteria 6164
278 Ga0495684_0317828 3300047471 Bacteria 1114
279 Ga0495602_0070431 3300048088 Bacteria 2993
280 Ga0495602_0126838 3300048088 Bacteria 2043
281 Ga0496100_0000294 3300048903 Bacteria 24866
282 Ga0496100_0091322 3300048903 Bacteria 2078
283 Ga0496101_0003814 3300048904 Bacteria 9419
284 Ga0496101_0010607 3300048904 Bacteria 6086
285 Ga0496101_0041360 3300048904 Bacteria 3286
286 Ga0496102_0014221 3300048905 Bacteria 6915
287 Ga0496102_0027626 3300048905 Bacteria 5067
288 Ga0496103_0425008 3300048906 Bacteria 853
289 Ga0496104_0000584 3300048907 Bacteria 31102
290 Ga0496104_0001783 3300048907 Bacteria 18638
291 Ga0496104_0186674 3300048907 Bacteria 1984
292 Ga0496105_0000912 3300048908 Bacteria 20124
293 Ga0496105_0006423 3300048908 Bacteria 9035
294 Ga0496105_0298879 3300048908 Bacteria 1294
295 Ga0496106_0000725 3300048909 Bacteria 23756
296 Ga0496107_0000973 3300048910 Bacteria 17022
297 Ga0496107_0013986 3300048910 Bacteria 5615
298 Ga0496108_0001201 3300048911 Bacteria 20295
299 Ga0496108_0008072 3300048911 Bacteria 8540
300 Ga0496108_0041291 3300048911 Bacteria 3851
301 Ga0496108_0086232 3300048911 Bacteria 2666
302 Ga0496109_0002830 3300048912 Bacteria 14540
303 Ga0496109_0003529 3300048912 Bacteria 13051
304 Ga0496109_0426156 3300048912 Unclassified 1253
305 Ga0496110_0000277 3300048913 Bacteria 33321
306 Ga0496110_0020480 3300048913 Bacteria 5586
307 Ga0496110_0615053 3300048913 Bacteria 985
308 Ga0496111_0000676 3300048914 Bacteria 17925
309 Ga0496111_0006881 3300048914 Bacteria 7419
310 Ga0496112_0000434 3300048915 Bacteria 27667
311 Ga0496112_0004336 3300048915 Bacteria 11993
312 Ga0496112_0006627 3300048915 Bacteria 10196
313 Ga0496112_0027345 3300048915 Bacteria 5499
314 Ga0496112_0312001 3300048915 Bacteria 1518
315 Ga0496113_0080992 3300048916 Bacteria 2488
316 Ga0496114_0000447 3300048917 Bacteria 30276
317 Ga0496114_0010755 3300048917 Bacteria 7283
318 Ga0496114_0036021 3300048917 Archaea 4089
319 Ga0496114_0036991 3300048917 Bacteria 4036
320 Ga0496115_0000276 3300048918 Bacteria 45046
321 Ga0496115_0016523 3300048918 Bacteria 5622
322 Ga0496115_0054777 3300048918 Bacteria 3203
323 Ga0501031_0000033 3300049568 Bacteria 76506
324 Ga0501031_0229690 3300049568 Bacteria 1207
325 Ga0501032_0001553 3300049569 Bacteria 18316
326 Ga0501032_0095064 3300049569 Bacteria 1975
327 Ga0501033_0000388 3300049570 Bacteria 42262
328 Ga0501033_0014544 3300049570 Bacteria 5974
329 Ga0501033_0185026 3300049570 Bacteria 1492
330 Ga0501034_0289417 3300049571 Bacteria 1576
331 Ga0501036_0000100 3300049572 Bacteria 54095
332 Ga0501036_0040028 3300049572 Bacteria 3964
333 Ga0501037_0067390 3300049573 Bacteria 2606
334 Ga0501038_0000227 3300049574 Bacteria 47719
335 Ga0501038_0062175 3300049574 Bacteria 3190
336 Ga0501039_0006785 3300049575 Bacteria 8706
337 Ga0501039_0010718 3300049575 Bacteria 6982
338 Ga0501040_0000234 3300049576 Bacteria 32549
339 Ga0501040_0003233 3300049576 Bacteria 10542
340 Ga0501041_0000012 3300049577 Bacteria 58514
341 Ga0501041_0008674 3300049577 Bacteria 5987
342 Ga0501042_0000006 3300049578 Bacteria 64564
343 Ga0501042_0004620 3300049578 Bacteria 8790
344 Ga0501043_0010785 3300049579 Bacteria 7156
345 Ga0501043_0118673 3300049579 Bacteria 2074
346 Ga0501046_0000577 3300049580 Bacteria 36233
347 Ga0501046_0004059 3300049580 Bacteria 13358
348 Ga0501046_0133117 3300049580 Bacteria 1884
349 Ga0501047_0000421 3300049581 Bacteria 47507
350 Ga0501048_0000027 3300049582 Bacteria 66478
351 Ga0501048_0000546 3300049582 Bacteria 26517
352 Ga0501067_0001112 3300049583 Bacteria 14540
353 Ga0501068_0000344 3300049584 Bacteria 23396
354 Ga0501068_0058157 3300049584 Bacteria 2345
355 Ga0501069_0007776 3300049585 Bacteria 5627
356 Ga0501069_0007953 3300049585 Bacteria 5567
357 Ga0501069_0008086 3300049585 Bacteria 5524
358 Ga0501069_0079059 3300049585 Bacteria 1851
359 Ga0501069_0166435 3300049585 Bacteria 1271
360 Ga0501070_0001108 3300049586 Bacteria 24175
361 Ga0501070_0042510 3300049586 Bacteria 3785
362 Ga0501070_0051125 3300049586 Bacteria 3430
363 Ga0501070_0060653 3300049586 Bacteria 3135
364 Ga0501070_0183872 3300049586 Bacteria 1719
365 Ga0501071_0000054 3300049587 Bacteria 38443
366 Ga0501071_0252447 3300049587 Bacteria 1331
367 Ga0501072_0004021 3300049588 Bacteria 11123
368 Ga0501072_0013189 3300049588 Bacteria 6328
369 Ga0501073_0003861 3300049589 Bacteria 11251
370 Ga0501073_0042575 3300049589 Unclassified 3204
371 Ga0501074_0000008 3300049590 Bacteria 105048
372 Ga0501074_0099676 3300049590 Bacteria 2079
373 Ga0501074_0147518 3300049590 Bacteria 1682
374 Ga0501074_0287585 3300049590 Bacteria 1168
375 Ga0501074_0465634 3300049590 Bacteria 896
376 Ga0501075_0000096 3300049591 Bacteria 40796
377 Ga0501075_0002869 3300049591 Bacteria 11558
378 Ga0501075_0211502 3300049591 Bacteria 1479
379 Ga0501075_0335917 3300049591 Bacteria 1151
380 Ga0501076_0000020 3300049592 Bacteria 86221
381 Ga0501076_0039343 3300049592 Bacteria 3712
382 Ga0501077_0000040 3300049593 Bacteria 65332
383 Ga0501077_0094076 3300049593 Bacteria 1899
384 Ga0501077_0127025 3300049593 Bacteria 1616
385 Ga0501079_0000001 3300049741 Bacteria 121247
386 Ga0501079_0004063 3300049741 Bacteria 10835
387 Ga0501079_0157129 3300049741 Bacteria 1772
388 Ga0501080_0000042 3300049742 Bacteria 81541
389 Ga0501080_0112353 3300049742 Bacteria 2525
390 Ga0501080_0195133 3300049742 Bacteria 1860
391 Ga0501081_0000001 3300049743 Bacteria 115059
392 Ga0501081_0002399 3300049743 Bacteria 11807
393 Ga0501083_0000490 3300049744 Bacteria 25303
394 Ga0501083_0142140 3300049744 Bacteria 1571
395 Ga0501035_0173208 3300049822 Bacteria 1863
396 Ga0501035_0219758 3300049822 Bacteria 1622
397 Ga0501044_0014725 3300049823 Bacteria 8432
398 Ga0501044_0068806 3300049823 Unclassified 3605
399 Ga0501045_0000017 3300049824 Bacteria 71857
400 Ga0501045_0000736 3300049824 Bacteria 20879
401 Ga0501045_0371423 3300049824 Bacteria 1064
402 Ga0495619_0110164 3300053085 Bacteria 1881
403 Ga0501084_0000283 3300054114 Bacteria 38382
404 Ga0501084_0000615 3300054114 Bacteria 27138
405 Ga0501082_0000393 3300060353 Bacteria 38800
406 Ga0501082_0005119 3300060353 Bacteria 11416
407 Ga0501082_0487482 3300060353 Bacteria 1077
408 Ga0501082_0493351 3300060353 Bacteria 1070
409 Ga0530510_0001522 3300061734 Bacteria 15607
410 Ga0530510_0004185 3300061734 Bacteria 9966
411 Ga0530510_0252200 3300061734 Bacteria 1315
412 Ga0070714_100062318
413 Ga0070658_10055007
414 Ga0070658_10133424
415 Ga0070658_10333606
416 Ga0070683_100070279
417 Ga0070683_100141344
418 Ga0070683_100540996
419 Ga0070683_100988743
420 Ga0070680_100029538
421 Ga0070680_100044077
422 Ga0070680_100052488
423 Ga0070680_100074642
424 Ga0070680_100093170
425 Ga0070680_100125563
426 Ga0070682_100154385
427 Ga0070682_100173331
428 Ga0070660_100000984
429 Ga0070660_100008211
430 Ga0070660_100043571
431 Ga0070661_100010897
432 Ga0070661_100015673
433 Ga0070661_100084184
434 Ga0070659_100047383
435 Ga0070714_100048553
436 Ga0070710_10248702
437 Ga0070711_100005702
438 Ga0070705_100124635
439 Ga0070708_100005931
440 Ga0070708_100118887
441 Ga0070681_10009254
442 Ga0070681_10019910
443 Ga0070681_10033774
444 Ga0070681_10036885
445 Ga0070681_10069651
446 Ga0070681_10094342
447 Ga0070681_10118608
448 Ga0070681_10128812
449 Ga0070706_100049551
450 Ga0070706_100108438
451 Ga0070698_100119011
452 Ga0070679_100024523
453 Ga0070679_100029343
454 Ga0070679_100030787
455 Ga0070679_100033763
456 Ga0070679_100050625
457 Ga0070679_100085042
458 Ga0070679_100128553
459 Ga0070679_100360491
460 Ga0070684_100003158
461 Ga0070684_100049155
462 Ga0068853_100305383
463 Ga0070696_100263149
464 Ga0070693_100064851
465 Ga0068855_100006224
466 Ga0068855_100017150
467 Ga0068855_100026803
468 Ga0068855_100265244
469 Ga0068855_100410006
470 Ga0068857_100032773
471 Ga0068857_100039039
472 Ga0068854_100191709
473 Ga0068856_100036406
474 Ga0068856_100079084
475 Ga0068856_100150172
476 Ga0068852_100030738
477 Ga0068852_100052834
478 Ga0070717_10014101
479 Ga0070717_10146930
480 Ga0070717_10427285
481 Ga0075434_100006458
482 Ga0075435_100115144
483 Ga0105240_10009134
484 Ga0105240_10019185
485 Ga0105240_10100440
486 Ga0105240_10509886
487 Ga0105245_10234742
488 Ga0105241_10250766
489 Ga0105237_10056633
490 Ga0105237_10491961
491 Ga0105238_10051824
492 Ga0105238_10213407
493 Ga0157370_10002642
494 Ga0157370_10060061
495 Ga0157370_10153613
496 Ga0157370_10320060
497 Ga0157370_10831366
498 Ga0157369_10006270
499 Ga0157369_10014867
500 Ga0157369_10042900
501 Ga0157369_10166069
502 Ga0157369_10235806
503 Ga0157369_10240222
504 Ga0157369_10307895
505 Ga0157369_10357989
506 Ga0157374_10047704
507 Ga0157372_10050747
508 Ga0157372_10065665
509 Ga0157372_10102254
510 Ga0157372_10257884
511 Ga0157375_10015522
512 Ga0157375_10074915
513 Ga0163163_10031474
514 Ga0206356_10551105
515 Ga0206356_10893402
516 Ga0206354_10803545
517 Ga0206354_11139467
518 Ga0206354_11718414
519 Ga0206353_10862134
520 Ga0206353_11119996
521 Ga0206353_11133803
522 Ga0206353_11433193
523 Ga0206353_11847047
524 Ga0207692_10294603
525 Ga0207699_10171514
526 Ga0207705_10056017
527 Ga0207684_10210216
528 Ga0207707_10018092
529 Ga0207707_10075007
530 Ga0207707_10297528
531 Ga0207695_10106024
532 Ga0207671_10068026
533 Ga0207671_10333868
534 Ga0207663_10240402
535 Ga0207660_10041805
536 Ga0207660_10059426
537 Ga0207660_10065238
538 Ga0207660_10135154
539 Ga0207660_10208100
540 Ga0207660_10289975
541 Ga0207657_10000166
542 Ga0207657_10001116
543 Ga0207657_10002091
544 Ga0207657_10005205
545 Ga0207657_10073394
546 Ga0207657_10283536
547 Ga0207649_10018477
548 Ga0207649_10020943
549 Ga0207649_10287462
550 Ga0207652_10076808
551 Ga0207652_10079597
552 Ga0207652_10111311
553 Ga0207652_10199110
554 Ga0207652_10200599
555 Ga0207694_10218148
556 Ga0207694_10387718
557 Ga0207664_10032576
558 Ga0207686_10038620
559 Ga0207661_10013264
560 Ga0207661_10029703
561 Ga0207661_10107498
562 Ga0207661_10160633
563 Ga0207667_10157354
564 Ga0207667_10368335
565 Ga0207667_10405253
566 Ga0207667_10947509
567 Ga0207677_10680591
568 Ga0207639_10260585
569 Ga0207678_10204376
570 Ga0207678_10244947
571 Ga0207702_10053339
572 Ga0207702_10705215
573 Ga0207674_10005383
574 Ga0207674_10051217
575 Ga0207683_10255486
576 Ga0207683_10835030
577 Ga0207698_10124044
578 Ga0268266_10079530
579 Ga0265334_10009878
580 Ga0265322_10002697
581 Ga0265338_10011110
582 Ga0265325_10008824
583 Ga0265340_10041788
584 Ga0265339_10027457
585 Ga0265327_10021917
586 Ga0265316_10010636
587 Ga0265316_10097395
588 Ga0265313_10006421
589 Ga0265314_10005226
590 Ga0307406_10092790
591 Ga0307407_10338950
592 Ga0373936_0007048
593 Ga0373945_0025492
594 Ga0373943_0005958
595 Ga0373947_0012095
596 Ga0373947_0017676
597 Ga0373947_0069007
598 Ga0373937_0176201
599 Ga0373937_0228188
600 Ga0373925_0048723
601 Ga0395899_0003970
602 Ga0395899_0091678
603 Ga0395900_0014144
604 Ga0395900_0036781
605 Ga0395900_0049677
606 Ga0395900_0127761
607 Ga0395900_0162732
608 Ga0395898_0005922
609 Ga0395898_0008235
610 Ga0395898_0023857
611 Ga0395898_0702214
612 Ga0395905_0046361
613 Ga0436364_0734328
614 Ga0395901_0002557
615 Ga0395901_0210624
616 Ga0436365_1323523
617 Ga0466966_0017348
618 Ga0466961_0108652
619 Ga0466963_0006849
620 Ga0466963_0011173
621 Ga0466963_0029302
622 Ga0466963_0029663
623 Ga0466963_0052718
624 Ga0466963_0091491
625 Ga0466963_0224578
626 Ga0466963_0275076
627 Ga0466964_0012308
628 Ga0466964_0018281
629 Ga0466964_0038339
630 Ga0466968_0004113
631 Ga0466957_0101637
632 Ga0466957_0132173
633 Ga0466960_0092548
634 Ga0466959_0054358
635 Ga0451576_0220999
636 Ga0466967_0000947
637 Ga0466967_0001528
638 Ga0466967_0009742
639 Ga0466967_0011126
640 Ga0466967_0016390
641 Ga0466967_0036536
642 Ga0466967_0037764
643 Ga0466967_0039696
644 Ga0466967_0047537
645 Ga0466967_0066662
646 Ga0466967_0094723
647 Ga0466967_0163637
648 Ga0466967_0989071
649 Ga0495603_0000081
650 Ga0495641_0010586
651 Ga0495651_0043988
652 Ga0495664_0185515
653 Ga0495594_0000307
654 Ga0495608_0037676
655 Ga0495628_0023695
656 Ga0495628_0084136
657 Ga0495630_0007358
658 Ga0495630_0073862
659 Ga0495666_0008059
660 Ga0495652_0127163
661 Ga0495652_0188640
662 Ga0495652_0252092
663 Ga0495640_0031023
664 Ga0495640_0106089
665 Ga0495587_0062301
666 Ga0495645_0075630
667 Ga0495667_0043334
668 Ga0495667_0047659
669 Ga0495667_0286305
670 Ga0495634_0029209
671 Ga0495635_0021053
672 Ga0495657_0084514
673 Ga0495646_0106023
674 Ga0495647_0027889
675 Ga0495658_0084492
676 Ga0495613_0179626
677 Ga0495600_0156836
678 Ga0495581_0184413
679 Ga0495581_0196240
680 Ga0495604_0063584
681 Ga0495674_0028700
682 Ga0495674_0051520
683 Ga0495676_0004078
684 Ga0495676_0085443
685 Ga0495680_0002425
686 Ga0495680_0013536
687 Ga0495675_0025465
688 Ga0495684_0014025
689 Ga0495684_0317828
690 Ga0495602_0070431
691 Ga0495602_0126838
692 Ga0496100_0000294
693 Ga0496100_0091322
694 Ga0496101_0003814
695 Ga0496101_0010607
696 Ga0496101_0041360
697 Ga0496102_0014221
698 Ga0496102_0027626
699 Ga0496103_0425008
700 Ga0496104_0000584
701 Ga0496104_0001783
702 Ga0496104_0186674
703 Ga0496105_0000912
704 Ga0496105_0006423
705 Ga0496105_0298879
706 Ga0496106_0000725
707 Ga0496107_0000973
708 Ga0496107_0013986
709 Ga0496108_0001201
710 Ga0496108_0008072
711 Ga0496108_0041291
712 Ga0496108_0086232
713 Ga0496109_0002830
714 Ga0496109_0003529
715 Ga0496109_0426156
716 Ga0496110_0000277
717 Ga0496110_0020480
718 Ga0496110_0615053
719 Ga0496111_0000676
720 Ga0496111_0006881
721 Ga0496112_0000434
722 Ga0496112_0004336
723 Ga0496112_0006627
724 Ga0496112_0027345
725 Ga0496112_0312001
726 Ga0496113_0080992
727 Ga0496114_0000447
728 Ga0496114_0010755
729 Ga0496114_0036021
730 Ga0496114_0036991
731 Ga0496115_0000276
732 Ga0496115_0016523
733 Ga0496115_0054777
734 Ga0501031_0000033
735 Ga0501031_0229690
736 Ga0501032_0001553
737 Ga0501032_0095064
738 Ga0501033_0000388
739 Ga0501033_0014544
740 Ga0501033_0185026
741 Ga0501034_0289417
742 Ga0501036_0000100
743 Ga0501036_0040028
744 Ga0501037_0067390
745 Ga0501038_0000227
746 Ga0501038_0062175
747 Ga0501039_0006785
748 Ga0501039_0010718
749 Ga0501040_0000234
750 Ga0501040_0003233
751 Ga0501041_0000012
752 Ga0501041_0008674
753 Ga0501042_0000006
754 Ga0501042_0004620
755 Ga0501043_0010785
756 Ga0501043_0118673
757 Ga0501046_0000577
758 Ga0501046_0004059
759 Ga0501046_0133117
760 Ga0501047_0000421
761 Ga0501048_0000027
762 Ga0501048_0000546
763 Ga0501067_0001112
764 Ga0501068_0000344
765 Ga0501068_0058157
766 Ga0501069_0007776
767 Ga0501069_0007953
768 Ga0501069_0008086
769 Ga0501069_0079059
770 Ga0501069_0166435
771 Ga0501070_0001108
772 Ga0501070_0042510
773 Ga0501070_0051125
774 Ga0501070_0060653
775 Ga0501070_0183872
776 Ga0501071_0000054
777 Ga0501071_0252447
778 Ga0501072_0004021
779 Ga0501072_0013189
780 Ga0501073_0003861
781 Ga0501073_0042575
782 Ga0501074_0000008
783 Ga0501074_0099676
784 Ga0501074_0147518
785 Ga0501074_0287585
786 Ga0501074_0465634
787 Ga0501075_0000096
788 Ga0501075_0002869
789 Ga0501075_0211502
790 Ga0501075_0335917
791 Ga0501076_0000020
792 Ga0501076_0039343
793 Ga0501077_0000040
794 Ga0501077_0094076
795 Ga0501077_0127025
796 Ga0501079_0000001
797 Ga0501079_0004063
798 Ga0501079_0157129
799 Ga0501080_0000042
800 Ga0501080_0112353
801 Ga0501080_0195133
802 Ga0501081_0000001
803 Ga0501081_0002399
804 Ga0501083_0000490
805 Ga0501083_0142140
806 Ga0501035_0173208
807 Ga0501035_0219758
808 Ga0501044_0014725
809 Ga0501044_0068806
810 Ga0501045_0000017
811 Ga0501045_0000736
812 Ga0501045_0371423
813 Ga0495619_0110164
814 Ga0501084_0000283
815 Ga0501084_0000615
816 Ga0501082_0000393
817 Ga0501082_0005119
818 Ga0501082_0487482
819 Ga0501082_0493351
820 Ga0530510_0001522
821 Ga0530510_0004185
822 Ga0530510_0252200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02615

Ldh_2

Malate/L-lactate dehydrogenase

4

181

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g8y-assembly1.cif.gz_B the structure of a putative malate/lactate dehydrogenase from e. coli. 0.7633 3 244
4h8a-assembly1.cif.gz_A crystal structure of ureidoglycolate dehydrogenase in binary complex with nadh 0.7589 3 247
4fju-assembly1.cif.gz_B crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate 0.7578 3 247
1wtj-assembly1.cif.gz_A crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae pvar.tomato 0.7531 3 245
1v9n-assembly1.cif.gz_A-2 structure of malate dehydrogenase from pyrococcus horikoshii ot3 0.7455 3 237
ID Description Score Start End Superfamily
af_P77555_4_66_1.10.1530.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.9304 3 45 1.10.1530.10
af_Q9VP68_93_150_1.10.1530.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.9185 3 45 1.10.1530.10
4h8aB01 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.8911 3 45 1.10.1530.10
4fjsB01 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.8793 3 45 1.10.1530.10
4fjuB01 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.8479 3 45 1.10.1530.10
ID Description Score Start End GO Terms
AF-A0A7V9I4U0-F1-model_v4 Ldh family oxidoreductase 0.9657 7 81 GO:0016491
AF-A0A538JLR2-F1-model_v4 Ldh family oxidoreductase 0.9606 3 105 GO:0016491
AF-A0A7V9I4U0-F1-model_v4 Ldh family oxidoreductase 0.9297 7 81 GO:0016491
AF-A0A7Y5XY33-F1-model_v4 Lactate dehydrogenase 0.9004 6 171 GO:0016491
AF-A0A3C0XPB1-F1-model_v4 Ldh family oxidoreductase 0.8703 3 246 GO:0016491

Map