F437372

General Info

Members Datasets Scaffolds Average Seq Length
410 263 818 284

Family's Representative Sequence

Representative Sequence 3300049127|Ga0501306_006796|Ga0501306_006796_308_1261
Length 317
Sequence MRTLHISEYSGQARNDILFCIRKLGSFRRNFAMALVSMTEMLKKAKDEGYAVGQFNINNLEFFQAILQAAEEEKSPVILGVSEGAARYVGGFKTVVKITEGLIEDYKISVPVAIHLDHGSSYDKCKEAIDAGFTSVMIDASHHPFEENIEETTKVVEYAHSKGVSVEAELGTVGGQEDDVVAEGVIYADPQECKVLVDRTGIDCLAPALGSVHGPYKGEPNLGYKEMEEIANLTNMPLVLHGGTGIPTKDIQKAISFGTAKINVNTENQIASAKTVREVLAAKPDEYDPRKYMGPARDAIKATVIGKMREFGSSNKA

Samples

Sample ID Description Type Environment
1 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
57 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
63 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
71 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
77 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
78 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
81 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
142 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
143 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
145 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
146 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
147 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
148 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
149 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
150 2554235283 Bacillus safensis VK Isolate Rhizosphere
151 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
152 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
153 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
154 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
155 2643221729 Bacillus sp. Root11 Isolate Unclassified
156 2643221730 Bacillus sp. Root131 Isolate Unclassified
157 2643221731 Bacillus sp. Root147 Isolate Unclassified
158 2643221732 Bacillus sp. Root239 Isolate Unclassified
159 2643221735 Bacillus sp. Root920 Isolate Unclassified
160 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
161 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
162 2671180694 Paenibacillus sp. A3 Isolate Unclassified
163 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
164 2684622632 Bacillus cereus 905 Isolate Unclassified
165 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
166 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
167 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
168 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
169 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
170 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
171 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
172 2738541295 Bacillus sp. OK085 Isolate Unclassified
173 2738541358 Bacillus sp. OV752 Isolate Unclassified
174 2738543006 Bacillus sp. OK077 Isolate Unclassified
175 2738543010 Bacillus sp. YR335 Isolate Unclassified
176 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
177 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
178 2811994870 Bacillus sp. JB4 Isolate Unclassified
179 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
180 2818991441 Niallia circulans 3243 Isolate Rhizosphere
181 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
182 2818991459 Paenibacillus sp. 597 Isolate Unclassified
183 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
184 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
185 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
186 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
187 2842882022 Bacillus sp. R-71893 Isolate Unclassified
188 2849139964 Bacillus sp. R-71875 Isolate Unclassified
189 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
190 2857472729 Cohnella sp. R-74144 Isolate Unclassified
191 2857581216 Bacillus sp. R-71922 Isolate Unclassified
192 2860837431 Bacillus sp. WR11 Isolate Unclassified
193 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
194 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
195 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
196 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
197 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
198 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
199 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
200 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
201 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
202 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
203 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
204 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
205 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
206 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
207 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
208 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
209 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
210 2919720352 Priestia megaterium 4340 Isolate Unclassified
211 2919726948 Bacillus pumilus 4489 Isolate Unclassified
212 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
213 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
214 2929004312 Priestia megaterium 1104 Isolate Unclassified
215 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
216 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
217 2938917290 Bacillus sp. CR71 Isolate Unclassified
218 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
219 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
220 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
221 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
222 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
223 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
224 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
225 2965761152 Bacillus sp. COPE52 Isolate Unclassified
226 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
227 2969141011 Bacillus velezensis MH25 Isolate Unclassified
228 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
229 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
230 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
231 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
232 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
233 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
234 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
235 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
236 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
237 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
238 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
239 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
240 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
241 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
242 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
243 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
244 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
245 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
246 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
247 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
248 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
249 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
250 8022653035 Bacillus sp. Rc4 Isolate Unclassified
251 8022792930 Bacillus sp. Xin Isolate Rhizosphere
252 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
253 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
254 8023438354 Bacillus sp. BH2 Isolate Unclassified
255 8023444577 Bacillus sp. BH32 Isolate Unclassified
256 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
257 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
258 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
259 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
260 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
261 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
262 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
263 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 33.41
Metatranscriptomes 36.1
Isolates 30.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0.24
Rhizoplane 4.63
Rhizosphere 68.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501306_006796 3300049127 Bacteria 1354
2 JGI24033J26618_1002464 3300002155 Bacteria 1898
3 JGI25159J45721_1017064 3300002987 Bacteria 1517
4 JGI25151J46595_10000061 3300003187 Bacteria 146828
5 JGI25151J46595_10005621 3300003187 Bacteria 6445
6 rootH1_10027859 3300003316 Bacteria 4157
7 rootH2_10206100 3300003320 Bacteria 1428
8 rootL2_10163485 3300003322 Bacteria 3377
9 rootH1_10137525 3300003323 Bacteria 5942
10 Ga0006562J51391_1000183 3300003578 Bacteria 13240
11 Ga0006562J51391_1000330 3300003578 Bacteria 10510
12 Ga0055528_1001055 3300003790 Bacteria 18211
13 Ga0058860_11337129 3300004801 Bacteria 1026
14 Ga0070676_10009624 3300005328 Bacteria 5224
15 Ga0070670_100033251 3300005331 Bacteria 4442
16 Ga0070669_100140377 3300005353 Bacteria 1862
17 Ga0070675_100074735 3300005354 Bacteria 2816
18 Ga0070671_100005752 3300005355 Bacteria 9875
19 Ga0070672_100142039 3300005543 Bacteria 1981
20 Ga0068864_100090084 3300005618 Bacteria 2704
21 Ga0068870_10128000 3300005840 Bacteria 1471
22 Ga0070715_10060099 3300006163 Bacteria 1665
23 Ga0105244_10000081 3300009036 Bacteria 106439
24 Ga0105244_10031485 3300009036 Bacteria 2814
25 Ga0105245_10021482 3300009098 Bacteria 5663
26 Ga0105247_10003421 3300009101 Bacteria 10365
27 Ga0105247_10101216 3300009101 Bacteria 1842
28 Ga0105243_10000209 3300009148 Bacteria 68700
29 Ga0105242_10003006 3300009176 Bacteria 13178
30 Ga0105239_10021121 3300010375 Bacteria 7183
31 Ga0105246_10003326 3300011119 Bacteria 9733
32 Ga0157371_10004522 3300013102 Bacteria 12115
33 Ga0157374_10037731 3300013296 Bacteria 4437
34 Ga0157378_10002375 3300013297 Bacteria 16722
35 Ga0157372_10038724 3300013307 Bacteria 5261
36 Ga0157377_10001213 3300014745 Bacteria 10986
37 Ga0157376_10110523 3300014969 Bacteria 2418
38 Ga0224712_10153947 3300022467 Bacteria 1021
39 Ga0209566_100721 3300025225 Bacteria 18778
40 Ga0209147_100559 3300025229 Bacteria 20945
41 Ga0209147_102048 3300025229 Bacteria 5757
42 Ga0209673_1002651 3300025273 Bacteria 11967
43 Ga0209130_1002659 3300025284 Bacteria 8536
44 Ga0209675_1006379 3300025291 Bacteria 4742
45 Ga0209675_1008568 3300025291 Bacteria 3737
46 Ga0209025_1000011 3300025294 Bacteria 976387
47 Ga0209025_1001377 3300025294 Bacteria 32622
48 Ga0209025_1001513 3300025294 Bacteria 29849
49 Ga0209025_1002114 3300025294 Bacteria 22397
50 Ga0209025_1002353 3300025294 Bacteria 20346
51 Ga0209025_1018853 3300025294 Bacteria 3881
52 Ga0207426_1011669 3300025302 Bacteria 3334
53 Ga0207696_1000580 3300025711 Bacteria 28547
54 Ga0207696_1001795 3300025711 Bacteria 11078
55 Ga0207655_1000159 3300025728 Bacteria 123598
56 Ga0207655_1029235 3300025728 Bacteria 2584
57 Ga0207713_1002687 3300025735 Bacteria 12718
58 Ga0207713_1008954 3300025735 Bacteria 5693
59 Ga0207710_10091267 3300025900 Bacteria 1426
60 Ga0207645_10033103 3300025907 Bacteria 3322
61 Ga0207650_10008545 3300025925 Bacteria 6992
62 Ga0207687_10036989 3300025927 Bacteria 3328
63 Ga0207644_10019067 3300025931 Bacteria 4649
64 Ga0207686_10044815 3300025934 Bacteria 2718
65 Ga0207709_10005108 3300025935 Bacteria 7491
66 Ga0207669_10211750 3300025937 Bacteria 1415
67 Ga0209371_1001260 3300027312 Bacteria 17981
68 Ga0209969_1017120 3300027360 Bacteria 1066
69 Ga0210000_1008894 3300027462 Bacteria 1474
70 Ga0237817_10215 3300030083 Bacteria 14866
71 Ga0268256_1001100 3300030500 Bacteria 17605
72 Ga0307408_100005553 3300031548 Bacteria 8427
73 Ga0307416_100142180 3300032002 Bacteria 2183
74 Ga0395899_0033022 3300037312 Bacteria 3888
75 Ga0395899_0042516 3300037312 Bacteria 3392
76 Ga0395899_0290884 3300037312 Bacteria 1108
77 Ga0395900_0388659 3300037418 Bacteria 1362
78 Ga0237819_00011 3300038705 Bacteria 65140
79 Ga0237819_00685 3300038705 Bacteria 10981
80 Ga0439433_0055915 3300041999 Bacteria 935
81 Ga0439449_0001402 3300042007 Bacteria 9426
82 Ga0439462_0000657 3300042015 Bacteria 6992
83 Ga0466961_0015354 3300044693 Bacteria 4917
84 Ga0466961_0022544 3300044693 Bacteria 4051
85 Ga0466968_0013130 3300044735 Bacteria 3252
86 Ga0466968_0087110 3300044735 Bacteria 1379
87 Ga0466970_0120465 3300044765 Bacteria 1437
88 Ga0466967_0000079 3300045976 Bacteria 34795
89 Ga0466967_0444192 3300045976 Bacteria 1267
90 Ga0495590_0071138 3300046457 Bacteria 1221
91 Ga0495605_0152656 3300046474 Bacteria 1030
92 Ga0495584_0017641 3300046491 Bacteria 3632
93 Ga0495585_0024151 3300046492 Bacteria 3487
94 Ga0495607_0155836 3300046501 Bacteria 1165
95 Ga0495631_0034030 3300046518 Bacteria 2286
96 Ga0495661_0048810 3300046665 Bacteria 2570
97 Ga0495661_0052848 3300046665 Bacteria 2446
98 Ga0495661_0151201 3300046665 Bacteria 1254
99 Ga0495670_0154565 3300046691 Bacteria 1204
100 Ga0495589_0145778 3300046794 Bacteria 1132
101 Ga0495676_0018955 3300047321 Bacteria 6061
102 Ga0495683_0019982 3300047323 Bacteria 3456
103 Ga0495626_0006535 3300048091 Bacteria 6622
104 Ga0496100_0000719 3300048903 Bacteria 15828
105 Ga0496101_0011595 3300048904 Bacteria 5853
106 Ga0496102_0006486 3300048905 Bacteria 9975
107 Ga0496102_0253388 3300048905 Bacteria 1660
108 Ga0496103_0092833 3300048906 Bacteria 1905
109 Ga0496104_0005563 3300048907 Bacteria 11034
110 Ga0496105_0151546 3300048908 Bacteria 1905
111 Ga0496106_0001720 3300048909 Bacteria 16330
112 Ga0496107_0000182 3300048910 Bacteria 32619
113 Ga0496108_0001556 3300048911 Bacteria 18160
114 Ga0496109_0001672 3300048912 Bacteria 18485
115 Ga0496109_0086335 3300048912 Bacteria 2898
116 Ga0496110_0002417 3300048913 Bacteria 13981
117 Ga0496111_0007715 3300048914 Bacteria 7076
118 Ga0496111_0068379 3300048914 Bacteria 2581
119 Ga0496112_0003996 3300048915 Bacteria 12362
120 Ga0496112_0306801 3300048915 Bacteria 1532
121 Ga0496113_0007351 3300048916 Bacteria 7076
122 Ga0496115_0234987 3300048918 Bacteria 1511
123 Ga0496116_0017338 3300048919 Bacteria 5592
124 Ga0496116_0030025 3300048919 Bacteria 3911
125 Ga0496116_0040630 3300048919 Bacteria 3201
126 Ga0496117_0014737 3300048920 Bacteria 6712
127 Ga0496119_0001218 3300048922 Bacteria 32113
128 Ga0496120_0083973 3300048923 Bacteria 1718
129 Ga0496122_0051374 3300048925 Bacteria 3132
130 Ga0496122_0102648 3300048925 Bacteria 1905
131 Ga0496122_0278531 3300048925 Bacteria 916
132 Ga0496123_0024320 3300048926 Bacteria 4607
133 Ga0496123_0095544 3300048926 Bacteria 1748
134 Ga0496124_0071956 3300048927 Bacteria 2864
135 Ga0496125_0001020 3300048928 Bacteria 43481
136 Ga0496125_0014586 3300048928 Bacteria 7644
137 Ga0496126_0030262 3300048929 Bacteria 5131
138 Ga0496126_0269906 3300048929 Bacteria 1412
139 Ga0496126_0274312 3300048929 Bacteria 1399
140 Ga0501306_000769 3300049127 Bacteria 2682
141 Ga0501306_014719 3300049127 Bacteria 1035
142 Ga0501306_016902 3300049127 Bacteria 985
143 Ga0501308_003839 3300049128 Bacteria 1416
144 Ga0501308_010045 3300049128 Bacteria 1044
145 Ga0501308_012487 3300049128 Bacteria 971
146 Ga0501309_004184 3300049129 Bacteria 1672
147 Ga0501309_012818 3300049129 Bacteria 1109
148 Ga0501309_015007 3300049129 Bacteria 1045
149 Ga0501309_017892 3300049129 Bacteria 975
150 Ga0501341_00910 3300049131 Bacteria 1378
151 Ga0501341_00976 3300049131 Bacteria 1350
152 Ga0501341_01209 3300049131 Bacteria 1257
153 Ga0501341_02505 3300049131 Bacteria 996
154 Ga0501343_000379 3300049132 Bacteria 2535
155 Ga0501343_000483 3300049132 Bacteria 2329
156 Ga0501343_001538 3300049132 Bacteria 1575
157 Ga0501343_003471 3300049132 Bacteria 1161
158 Ga0501343_003712 3300049132 Bacteria 1129
159 Ga0501343_005211 3300049132 Bacteria 993
160 Ga0501344_00266 3300049133 Bacteria 2010
161 Ga0501345_00321 3300049134 Bacteria 1531
162 Ga0501304_005131 3300049160 Bacteria 1017
163 Ga0501305_000393 3300049161 Bacteria 3497
164 Ga0501305_000574 3300049161 Bacteria 3079
165 Ga0501305_001346 3300049161 Bacteria 2378
166 Ga0501305_003380 3300049161 Bacteria 1803
167 Ga0501305_006128 3300049161 Bacteria 1483
168 Ga0501305_006705 3300049161 Bacteria 1439
169 Ga0501305_009044 3300049161 Bacteria 1301
170 Ga0501305_012897 3300049161 Bacteria 1149
171 Ga0501305_013285 3300049161 Bacteria 1137
172 Ga0501305_022216 3300049161 Bacteria 942
173 Ga0501307_001682 3300049162 Bacteria 1924
174 Ga0501307_012894 3300049162 Bacteria 1002
175 Ga0501311_002409 3300049527 Bacteria 1792
176 Ga0501311_003314 3300049527 Bacteria 1631
177 Ga0501311_010336 3300049527 Bacteria 1131
178 Ga0501311_014231 3300049527 Bacteria 1013
179 Ga0501312_002314 3300049528 Bacteria 2043
180 Ga0501312_003502 3300049528 Bacteria 1787
181 Ga0501312_003714 3300049528 Bacteria 1754
182 Ga0501312_010760 3300049528 Bacteria 1231
183 Ga0501312_010789 3300049528 Bacteria 1229
184 Ga0501312_013049 3300049528 Bacteria 1151
185 Ga0501312_015402 3300049528 Bacteria 1084
186 Ga0501312_015912 3300049528 Bacteria 1071
187 Ga0501312_020488 3300049528 Bacteria 979
188 Ga0501313_000843 3300049529 Bacteria 2361
189 Ga0501313_002231 3300049529 Bacteria 1815
190 Ga0501313_002623 3300049529 Bacteria 1719
191 Ga0501313_006971 3300049529 Bacteria 1237
192 Ga0501313_011377 3300049529 Bacteria 1026
193 Ga0501313_011658 3300049529 Bacteria 1016
194 Ga0501314_006172 3300049530 Bacteria 1038
195 Ga0501315_000061 3300049531 Bacteria 4822
196 Ga0501315_002585 3300049531 Bacteria 1722
197 Ga0501315_002985 3300049531 Bacteria 1655
198 Ga0501315_003565 3300049531 Bacteria 1567
199 Ga0501315_005187 3300049531 Bacteria 1401
200 Ga0501315_008177 3300049531 Bacteria 1210
201 Ga0501315_008711 3300049531 Bacteria 1185
202 Ga0501315_008726 3300049531 Bacteria 1185
203 Ga0501315_010160 3300049531 Bacteria 1126
204 Ga0501315_011663 3300049531 Bacteria 1076
205 Ga0501315_015767 3300049531 Bacteria 972
206 Ga0501316_000118 3300049532 Bacteria 4099
207 Ga0501316_001346 3300049532 Bacteria 2063
208 Ga0501316_001737 3300049532 Bacteria 1915
209 Ga0501316_001858 3300049532 Bacteria 1877
210 Ga0501316_001869 3300049532 Bacteria 1873
211 Ga0501316_003284 3300049532 Bacteria 1560
212 Ga0501316_004027 3300049532 Bacteria 1457
213 Ga0501316_011033 3300049532 Bacteria 1037
214 Ga0501316_012700 3300049532 Bacteria 988
215 Ga0501316_012888 3300049532 Bacteria 982
216 Ga0501316_013639 3300049532 Bacteria 962
217 Ga0501317_000046 3300049533 Bacteria 5477
218 Ga0501317_000624 3300049533 Bacteria 2620
219 Ga0501317_000829 3300049533 Bacteria 2410
220 Ga0501317_000999 3300049533 Bacteria 2289
221 Ga0501317_003935 3300049533 Bacteria 1515
222 Ga0501317_007657 3300049533 Bacteria 1225
223 Ga0501317_008958 3300049533 Bacteria 1165
224 Ga0501317_013542 3300049533 Bacteria 1021
225 Ga0501317_015533 3300049533 Bacteria 977
226 Ga0501317_016788 3300049533 Bacteria 953
227 Ga0501318_002382 3300049534 Bacteria 1620
228 Ga0501318_002797 3300049534 Bacteria 1547
229 Ga0501318_003048 3300049534 Bacteria 1507
230 Ga0501318_005006 3300049534 Bacteria 1296
231 Ga0501318_005697 3300049534 Bacteria 1246
232 Ga0501318_009557 3300049534 Bacteria 1060
233 Ga0501318_010459 3300049534 Bacteria 1030
234 Ga0501318_011352 3300049534 Bacteria 1005
235 Ga0501320_004680 3300049536 Bacteria 1216
236 Ga0501321_000160 3300049537 Bacteria 3645
237 Ga0501321_000428 3300049537 Bacteria 2668
238 Ga0501321_001919 3300049537 Bacteria 1735
239 Ga0501321_002272 3300049537 Bacteria 1646
240 Ga0501321_003168 3300049537 Bacteria 1488
241 Ga0501321_005565 3300049537 Bacteria 1250
242 Ga0501321_009330 3300049537 Bacteria 1057
243 Ga0501322_004032 3300049538 Bacteria 974
244 Ga0501323_003800 3300049539 Bacteria 1564
245 Ga0501323_004392 3300049539 Bacteria 1489
246 Ga0501323_008822 3300049539 Bacteria 1178
247 Ga0501323_008864 3300049539 Bacteria 1176
248 Ga0501323_011529 3300049539 Bacteria 1068
249 Ga0501323_015091 3300049539 Bacteria 972
250 Ga0501325_002590 3300049541 Bacteria 1250
251 Ga0501326_01636 3300049542 Bacteria 1055
252 Ga0501326_02019 3300049542 Bacteria 976
253 Ga0501327_01503 3300049543 Bacteria 1126
254 Ga0501330_000056 3300049546 Bacteria 3056
255 Ga0501330_000488 3300049546 Bacteria 1703
256 Ga0501331_00543 3300049547 Bacteria 1585
257 Ga0501331_01544 3300049547 Bacteria 1131
258 Ga0501332_00603 3300049548 Bacteria 1647
259 Ga0501332_02391 3300049548 Bacteria 1047
260 Ga0501333_000385 3300049549 Bacteria 1977
261 Ga0501333_000569 3300049549 Bacteria 1750
262 Ga0501334_01554 3300049550 Bacteria 1284
263 Ga0501334_01709 3300049550 Bacteria 1245
264 Ga0501334_02481 3300049550 Bacteria 1099
265 Ga0501334_03254 3300049550 Bacteria 1000
266 Ga0501335_000087 3300049551 Bacteria 4094
267 Ga0501335_000219 3300049551 Bacteria 3193
268 Ga0501335_001580 3300049551 Bacteria 1764
269 Ga0501335_006542 3300049551 Bacteria 1064
270 Ga0501335_006560 3300049551 Bacteria 1063
271 Ga0501335_007923 3300049551 Bacteria 991
272 Ga0501336_000474 3300049552 Bacteria 1993
273 Ga0501336_001168 3300049552 Bacteria 1520
274 Ga0501336_003341 3300049552 Bacteria 1081
275 Ga0501337_002427 3300049553 Bacteria 1139
276 Ga0501337_002632 3300049553 Bacteria 1109
277 Ga0501338_00477 3300049554 Bacteria 1818
278 Ga0501338_01020 3300049554 Bacteria 1421
279 Ga0501338_02000 3300049554 Bacteria 1136
280 Ga0501340_002546 3300049556 Bacteria 1059
281 Ga0501072_0556821 3300049588 Bacteria 905
282 Ga0501217_009490 3300049661 Bacteria 2118
283 Ga0501212_011176 3300049851 Bacteria 1290
284 Ga0587098_011579 3300059604 Bacteria 996
285 2511180283 2510917027 Bacteria 5287437
286 2511701438 2511231119 Bacteria 4019861
287 2512735175 2512564039 Bacteria 8739048
288 2540608633 2540341094 Bacteria 4061186
289 2545557852 2545555800 Bacteria 4222588
290 2553395807 2551306519 Bacteria 5465154
291 2555468594 2554235283 Bacteria 3683090
292 2578932244 2576861599 Bacteria 4217202
293 2587743754 2585428059 Bacteria 8696589
294 2587744027 2585428059 Bacteria 8696589
295 2631983841 2630968484 Bacteria 3876276
296 2644422499 2643221676 Bacteria 8119172
297 2644702439 2643221729 Bacteria 6621700
298 2644715069 2643221730 Bacteria 6523787
299 2644720460 2643221731 Bacteria 5623886
300 2644726455 2643221732 Bacteria 5756404
301 2644738609 2643221735 Bacteria 3676263
302 2651531048 2648501850 Bacteria 3975476
303 2672338672 2671180330 Bacteria 5521719
304 2673820407 2671180694 Bacteria 7506943
305 2674421625 2671180844 Bacteria 4164150
306 2685153294 2684622632 Bacteria 5380049
307 2686998734 2684623153 Bacteria 3878815
308 2687500010 2687453109 Bacteria 3860091
309 2695629393 2695420354 Bacteria 3922431
310 2698319898 2695420987 Bacteria 6152737
311 2705997211 2703719227 Bacteria 5631989
312 2717914911 2716884898 Bacteria 3928789
313 2721508454 2718218445 Bacteria 5113413
314 2738813630 2738541295 Bacteria 5730091
315 2739156899 2738541358 Bacteria 5932299
316 2739209351 2738543006 Bacteria 5904091
317 2739232360 2738543010 Bacteria 5583595
318 2739233769 2738543010 Bacteria 5583595
319 2808870735 2808606364 Bacteria 4465927
320 2809053774 2808606399 Bacteria 4021018
321 2812313923 2811994870 Bacteria 3776934
322 2816865404 2816332186 Bacteria 5331395
323 2819567379 2818991441 Bacteria 5062707
324 2819583617 2818991443 Bacteria 6598732
325 2819670828 2818991459 Bacteria 8736032
326 2819711039 2818991465 Bacteria 5388835
327 2819722933 2818991468 Bacteria 3723169
328 2823529957 2823526263 Bacteria 3765752
329 2831908135 2831905167 Bacteria 3319172
330 2842886400 2842882022 Bacteria 6158489
331 2849141232 2849139964 Bacteria 5613304
332 2849142935 2849139964 Bacteria 5613304
333 2857458399 2857453340 Bacteria 8090534
334 2857473589 2857472729 Bacteria 6568124
335 2857583193 2857581216 Bacteria 5522813
336 2860841445 2860837431 Bacteria 4202080
337 2865008804 2865002811 Bacteria 6333767
338 2877772317 2877768649 Bacteria 3957164
339 2880173167 2880169592 Bacteria 3900066
340 2881646102 2881644220 Bacteria 5302661
341 2888579163 2888578766 Bacteria 6743310
342 2889052302 2889049205 Bacteria 7524325
343 2897113435 2897109615 Bacteria 4009619
344 2904114337 2904113452 Bacteria 7796941
345 2904117520 2904113452 Bacteria 7796941
346 2904528813 2904524088 Bacteria 5887454
347 2904561758 2904560550 Bacteria 4029838
348 2904755998 2904755435 Bacteria 7986759
349 2908667204 2908665501 Bacteria 3678115
350 2916976196 2916971899 Bacteria 4250608
351 2919094780 2919093281 Bacteria 3660974
352 2919148443 2919143609 Bacteria 6219228
353 2919429080 2919425241 Bacteria 8055701
354 2919521788 2919517244 Bacteria 5858162
355 2919724918 2919720352 Bacteria 5986006
356 2919727350 2919726948 Bacteria 3696050
357 2925329631 2925326138 Bacteria 9652120
358 2928098211 2928093941 Bacteria 5965005
359 2929007645 2929004312 Bacteria 5678476
360 2929239005 2929233124 Bacteria 5948380
361 2936363316 2936361878 Bacteria 5632809
362 2938923227 2938917290 Bacteria 5914775
363 2947432096 2947426588 Bacteria 5357194
364 2954776619 2954773129 Bacteria 3741715
365 2956901674 2956897341 Bacteria 5447711
366 2956902377 2956897341 Bacteria 5447711
367 2960321382 2960319331 Bacteria 5502575
368 2960378650 2960375949 Bacteria 5361395
369 2962294686 2962290636 Bacteria 4072939
370 2964375424 2964375228 Bacteria 4909004
371 2965766625 2965761152 Bacteria 5806513
372 2969140613 2969136845 Bacteria 3923176
373 2969144881 2969141011 Bacteria 4118468
374 2969768565 2969765954 Bacteria 4216713
375 2969770912 2969770375 Bacteria 4271280
376 2971416757 2971410472 Bacteria 8311090
377 2971897009 2971893375 Bacteria 3929648
378 2977254998 2977254563 Bacteria 4828420
379 2979088988 2979083700 Bacteria 5894929
380 2980129440 2980125574 Bacteria 5567337
381 2980496448 2980492589 Bacteria 4072961
382 2990275982 2990275345 Bacteria 4887158
383 3001269679 3001267043 Bacteria 4823521
384 3001275024 3001272096 Bacteria 4729684
385 3001898358 3001892409 Bacteria 6328293
386 3006826700 3006826541 Bacteria 4678913
387 3006862468 3006858327 Bacteria 4317835
388 3006883161 3006879489 Bacteria 4064221
389 3006969502 3006969106 Bacteria 4739423
390 3006978017 3006973921 Bacteria 4423788
391 3006980457 3006978542 Bacteria 5328100
392 3006986524 3006984091 Bacteria 4207523
393 3006990850 3006988479 Bacteria 4767936
394 8022626812 8022621104 Bacteria 5241040
395 8022632541 8022630665 Bacteria 3886130
396 8022656903 8022653035 Bacteria 4035078
397 8022798855 8022792930 Bacteria 5693794
398 8022894430 8022893055 Bacteria 5300455
399 8022918458 8022914991 Bacteria 5584517
400 8023441475 8023438354 Bacteria 5779374
401 8023448996 8023444577 Bacteria 5661597
402 8051954069 8051952484 Bacteria 3926774
403 8052175856 8052174270 Bacteria 3881265
404 8054283782 8054280661 Bacteria 4232245
405 8054801620 8054795415 Bacteria 9785225
406 8056536979 8056533031 Bacteria 8964429
407 8057476730 8057473075 Bacteria 5892720
408 8057587754 8057582654 Bacteria 5218944
409 8057636685 8057632132 Bacteria 4726859
410 Ga0501306_006796
411 JGI24033J26618_1002464
412 JGI25159J45721_1017064
413 JGI25151J46595_10000061
414 JGI25151J46595_10005621
415 rootH1_10027859
416 rootH2_10206100
417 rootL2_10163485
418 rootH1_10137525
419 Ga0006562J51391_1000183
420 Ga0006562J51391_1000330
421 Ga0055528_1001055
422 Ga0058860_11337129
423 Ga0070676_10009624
424 Ga0070670_100033251
425 Ga0070669_100140377
426 Ga0070675_100074735
427 Ga0070671_100005752
428 Ga0070672_100142039
429 Ga0068864_100090084
430 Ga0068870_10128000
431 Ga0070715_10060099
432 Ga0105244_10000081
433 Ga0105244_10031485
434 Ga0105245_10021482
435 Ga0105247_10003421
436 Ga0105247_10101216
437 Ga0105243_10000209
438 Ga0105242_10003006
439 Ga0105239_10021121
440 Ga0105246_10003326
441 Ga0157371_10004522
442 Ga0157374_10037731
443 Ga0157378_10002375
444 Ga0157372_10038724
445 Ga0157377_10001213
446 Ga0157376_10110523
447 Ga0224712_10153947
448 Ga0209566_100721
449 Ga0209147_100559
450 Ga0209147_102048
451 Ga0209673_1002651
452 Ga0209130_1002659
453 Ga0209675_1006379
454 Ga0209675_1008568
455 Ga0209025_1000011
456 Ga0209025_1001377
457 Ga0209025_1001513
458 Ga0209025_1002114
459 Ga0209025_1002353
460 Ga0209025_1018853
461 Ga0207426_1011669
462 Ga0207696_1000580
463 Ga0207696_1001795
464 Ga0207655_1000159
465 Ga0207655_1029235
466 Ga0207713_1002687
467 Ga0207713_1008954
468 Ga0207710_10091267
469 Ga0207645_10033103
470 Ga0207650_10008545
471 Ga0207687_10036989
472 Ga0207644_10019067
473 Ga0207686_10044815
474 Ga0207709_10005108
475 Ga0207669_10211750
476 Ga0209371_1001260
477 Ga0209969_1017120
478 Ga0210000_1008894
479 Ga0237817_10215
480 Ga0268256_1001100
481 Ga0307408_100005553
482 Ga0307416_100142180
483 Ga0395899_0033022
484 Ga0395899_0042516
485 Ga0395899_0290884
486 Ga0395900_0388659
487 Ga0237819_00011
488 Ga0237819_00685
489 Ga0439433_0055915
490 Ga0439449_0001402
491 Ga0439462_0000657
492 Ga0466961_0015354
493 Ga0466961_0022544
494 Ga0466968_0013130
495 Ga0466968_0087110
496 Ga0466970_0120465
497 Ga0466967_0000079
498 Ga0466967_0444192
499 Ga0495590_0071138
500 Ga0495605_0152656
501 Ga0495584_0017641
502 Ga0495585_0024151
503 Ga0495607_0155836
504 Ga0495631_0034030
505 Ga0495661_0048810
506 Ga0495661_0052848
507 Ga0495661_0151201
508 Ga0495670_0154565
509 Ga0495589_0145778
510 Ga0495676_0018955
511 Ga0495683_0019982
512 Ga0495626_0006535
513 Ga0496100_0000719
514 Ga0496101_0011595
515 Ga0496102_0006486
516 Ga0496102_0253388
517 Ga0496103_0092833
518 Ga0496104_0005563
519 Ga0496105_0151546
520 Ga0496106_0001720
521 Ga0496107_0000182
522 Ga0496108_0001556
523 Ga0496109_0001672
524 Ga0496109_0086335
525 Ga0496110_0002417
526 Ga0496111_0007715
527 Ga0496111_0068379
528 Ga0496112_0003996
529 Ga0496112_0306801
530 Ga0496113_0007351
531 Ga0496115_0234987
532 Ga0496116_0017338
533 Ga0496116_0030025
534 Ga0496116_0040630
535 Ga0496117_0014737
536 Ga0496119_0001218
537 Ga0496120_0083973
538 Ga0496122_0051374
539 Ga0496122_0102648
540 Ga0496122_0278531
541 Ga0496123_0024320
542 Ga0496123_0095544
543 Ga0496124_0071956
544 Ga0496125_0001020
545 Ga0496125_0014586
546 Ga0496126_0030262
547 Ga0496126_0269906
548 Ga0496126_0274312
549 Ga0501306_000769
550 Ga0501306_014719
551 Ga0501306_016902
552 Ga0501308_003839
553 Ga0501308_010045
554 Ga0501308_012487
555 Ga0501309_004184
556 Ga0501309_012818
557 Ga0501309_015007
558 Ga0501309_017892
559 Ga0501341_00910
560 Ga0501341_00976
561 Ga0501341_01209
562 Ga0501341_02505
563 Ga0501343_000379
564 Ga0501343_000483
565 Ga0501343_001538
566 Ga0501343_003471
567 Ga0501343_003712
568 Ga0501343_005211
569 Ga0501344_00266
570 Ga0501345_00321
571 Ga0501304_005131
572 Ga0501305_000393
573 Ga0501305_000574
574 Ga0501305_001346
575 Ga0501305_003380
576 Ga0501305_006128
577 Ga0501305_006705
578 Ga0501305_009044
579 Ga0501305_012897
580 Ga0501305_013285
581 Ga0501305_022216
582 Ga0501307_001682
583 Ga0501307_012894
584 Ga0501311_002409
585 Ga0501311_003314
586 Ga0501311_010336
587 Ga0501311_014231
588 Ga0501312_002314
589 Ga0501312_003502
590 Ga0501312_003714
591 Ga0501312_010760
592 Ga0501312_010789
593 Ga0501312_013049
594 Ga0501312_015402
595 Ga0501312_015912
596 Ga0501312_020488
597 Ga0501313_000843
598 Ga0501313_002231
599 Ga0501313_002623
600 Ga0501313_006971
601 Ga0501313_011377
602 Ga0501313_011658
603 Ga0501314_006172
604 Ga0501315_000061
605 Ga0501315_002585
606 Ga0501315_002985
607 Ga0501315_003565
608 Ga0501315_005187
609 Ga0501315_008177
610 Ga0501315_008711
611 Ga0501315_008726
612 Ga0501315_010160
613 Ga0501315_011663
614 Ga0501315_015767
615 Ga0501316_000118
616 Ga0501316_001346
617 Ga0501316_001737
618 Ga0501316_001858
619 Ga0501316_001869
620 Ga0501316_003284
621 Ga0501316_004027
622 Ga0501316_011033
623 Ga0501316_012700
624 Ga0501316_012888
625 Ga0501316_013639
626 Ga0501317_000046
627 Ga0501317_000624
628 Ga0501317_000829
629 Ga0501317_000999
630 Ga0501317_003935
631 Ga0501317_007657
632 Ga0501317_008958
633 Ga0501317_013542
634 Ga0501317_015533
635 Ga0501317_016788
636 Ga0501318_002382
637 Ga0501318_002797
638 Ga0501318_003048
639 Ga0501318_005006
640 Ga0501318_005697
641 Ga0501318_009557
642 Ga0501318_010459
643 Ga0501318_011352
644 Ga0501320_004680
645 Ga0501321_000160
646 Ga0501321_000428
647 Ga0501321_001919
648 Ga0501321_002272
649 Ga0501321_003168
650 Ga0501321_005565
651 Ga0501321_009330
652 Ga0501322_004032
653 Ga0501323_003800
654 Ga0501323_004392
655 Ga0501323_008822
656 Ga0501323_008864
657 Ga0501323_011529
658 Ga0501323_015091
659 Ga0501325_002590
660 Ga0501326_01636
661 Ga0501326_02019
662 Ga0501327_01503
663 Ga0501330_000056
664 Ga0501330_000488
665 Ga0501331_00543
666 Ga0501331_01544
667 Ga0501332_00603
668 Ga0501332_02391
669 Ga0501333_000385
670 Ga0501333_000569
671 Ga0501334_01554
672 Ga0501334_01709
673 Ga0501334_02481
674 Ga0501334_03254
675 Ga0501335_000087
676 Ga0501335_000219
677 Ga0501335_001580
678 Ga0501335_006542
679 Ga0501335_006560
680 Ga0501335_007923
681 Ga0501336_000474
682 Ga0501336_001168
683 Ga0501336_003341
684 Ga0501337_002427
685 Ga0501337_002632
686 Ga0501338_00477
687 Ga0501338_01020
688 Ga0501338_02000
689 Ga0501340_002546
690 Ga0501072_0556821
691 Ga0501217_009490
692 Ga0501212_011176
693 Ga0587098_011579
694 2511180283
695 2511701438
696 2512735175
697 2540608633
698 2545557852
699 2553395807
700 2555468594
701 2578932244
702 2587743754
703 2587744027
704 2631983841
705 2644422499
706 2644702439
707 2644715069
708 2644720460
709 2644726455
710 2644738609
711 2651531048
712 2672338672
713 2673820407
714 2674421625
715 2685153294
716 2686998734
717 2687500010
718 2695629393
719 2698319898
720 2705997211
721 2717914911
722 2721508454
723 2738813630
724 2739156899
725 2739209351
726 2739232360
727 2739233769
728 2808870735
729 2809053774
730 2812313923
731 2816865404
732 2819567379
733 2819583617
734 2819670828
735 2819711039
736 2819722933
737 2823529957
738 2831908135
739 2842886400
740 2849141232
741 2849142935
742 2857458399
743 2857473589
744 2857583193
745 2860841445
746 2865008804
747 2877772317
748 2880173167
749 2881646102
750 2888579163
751 2889052302
752 2897113435
753 2904114337
754 2904117520
755 2904528813
756 2904561758
757 2904755998
758 2908667204
759 2916976196
760 2919094780
761 2919148443
762 2919429080
763 2919521788
764 2919724918
765 2919727350
766 2925329631
767 2928098211
768 2929007645
769 2929239005
770 2936363316
771 2938923227
772 2947432096
773 2954776619
774 2956901674
775 2956902377
776 2960321382
777 2960378650
778 2962294686
779 2964375424
780 2965766625
781 2969140613
782 2969144881
783 2969768565
784 2969770912
785 2971416757
786 2971897009
787 2977254998
788 2979088988
789 2980129440
790 2980496448
791 2990275982
792 3001269679
793 3001275024
794 3001898358
795 3006826700
796 3006862468
797 3006883161
798 3006969502
799 3006978017
800 3006980457
801 3006986524
802 3006990850
803 8022626812
804 8022632541
805 8022656903
806 8022798855
807 8022894430
808 8022918458
809 8023441475
810 8023448996
811 8051954069
812 8052175856
813 8054283782
814 8054801620
815 8056536979
816 8057476730
817 8057587754
818 8057636685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01116

F_bP_aldolase

Fructose-bisphosphate aldolase class-II

36

316

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nc7-assembly1.cif.gz_B crystal structure of fructose-bisphosphate aldolases fbac from bacillus methanolicus 0.9911 1 285
7nc7-assembly1.cif.gz_A crystal structure of fructose-bisphosphate aldolases fbac from bacillus methanolicus 0.9884 1 285
3q94-assembly1.cif.gz_B the crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'ames ancestor' 0.9883 1 285
7nc7-assembly1.cif.gz_B crystal structure of fructose-bisphosphate aldolases fbac from bacillus methanolicus 0.9875 1 285
7nc7-assembly1.cif.gz_A crystal structure of fructose-bisphosphate aldolases fbac from bacillus methanolicus 0.9848 1 285
ID Description Score Start End Superfamily
3q94B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9889 3 285 3.20.20.70
3q94B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9816 3 285 3.20.20.70
1gvfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9643 3 285 3.20.20.70
6ofuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9579 3 285 3.20.20.70
1gvfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9574 3 285 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0I9S4J7-F1-model_v4 Fructose-bisphosphate aldolase (EC 4.1.2.13) 1.001 6 125 GO:0004332
GO:0005975
GO:0008270
AF-A0A351H4P6-F1-model_v4 Fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9953 3 112 GO:0004332
GO:0005975
GO:0008270
AF-A0A4P1AQM9-F1-model_v4 deleted 0.9952 3 119
AF-A0A6I0CC42-F1-model_v4 deleted 0.9947 178 285
AF-A0A3C1WT93-F1-model_v4 Fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9924 3 118 GO:0004332
GO:0005975
GO:0008270

Map