F437356

General Info

Members Datasets Scaffolds Average Seq Length
410 176 820 229

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0130590|Ga0495674_0130590_1269_2075
Length 268
Sequence LRQVAADGPRNAHINPKEESKGKEEMKIFKAATMVCGIALMGALLAPSAKADDWNRKTVITFSGPVEIPGVHLAGWGVLPAGTYVFKILDSQSDRHIVQIFSKDEKTVYATILAIPNYRLQATDKTVMTFRERPAGEPEALRAWFYPGRNWGEEFVYPKAKAMTLAKTTNTPILFTPAELPVEVTEPTKLASEPIVLEMKRAPIMAFRPTGEEVQLAEVVTPPPAQTEVAVAAEKALPHTASILPLIGLCGLLALGGFVALRVAEKRV

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.27
Metatranscriptomes 10.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.73
Rhizosphere 99.27
Stem 0
Stem Tuber 0
Unclassified 33.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0130590 3300047319 Bacteria 2117
2 Ga0070658_10050453 3300005327 Bacteria 3373
3 Ga0070658_10617953 3300005327 Unclassified 940
4 Ga0070683_100000003 3300005329 Bacteria 375084
5 Ga0070683_100443221 3300005329 Bacteria 1239
6 Ga0070690_100488579 3300005330 Bacteria 919
7 Ga0070666_10038300 3300005335 Unclassified 3190
8 Ga0070666_10094919 3300005335 Bacteria 2052
9 Ga0070666_10104725 3300005335 Bacteria 1953
10 Ga0070680_100087204 3300005336 Unclassified 2581
11 Ga0068868_100006891 3300005338 Bacteria 8071
12 Ga0068868_100018117 3300005338 Bacteria 5258
13 Ga0070660_100100635 3300005339 Bacteria 2289
14 Ga0070689_100249781 3300005340 Unclassified 1463
15 Ga0070661_100230302 3300005344 Unclassified 1424
16 Ga0070661_100247719 3300005344 Bacteria 1374
17 Ga0070675_100209189 3300005354 Unclassified 1695
18 Ga0070675_100633154 3300005354 Unclassified 971
19 Ga0070674_100353129 3300005356 Unclassified 1188
20 Ga0070673_100458593 3300005364 Unclassified 1147
21 Ga0070659_100606298 3300005366 Unclassified 941
22 Ga0070667_100022558 3300005367 Bacteria 5220
23 Ga0070667_100133449 3300005367 Bacteria 2169
24 Ga0070667_100200995 3300005367 Bacteria 1769
25 Ga0070709_10014995 3300005434 Bacteria 4398
26 Ga0070709_10025282 3300005434 Bacteria 3507
27 Ga0070709_10181807 3300005434 Unclassified 1477
28 Ga0070714_100005934 3300005435 Bacteria 9377
29 Ga0070714_100036914 3300005435 Bacteria 4102
30 Ga0070714_100097441 3300005435 Unclassified 2585
31 Ga0070713_100014567 3300005436 Bacteria 5846
32 Ga0070713_100020157 3300005436 Bacteria 5106
33 Ga0070713_100037413 3300005436 Bacteria 3924
34 Ga0070713_100094846 3300005436 Bacteria 2573
35 Ga0070713_100127423 3300005436 Bacteria 2241
36 Ga0070711_100171990 3300005439 Bacteria 1652
37 Ga0070678_100726785 3300005456 Bacteria 896
38 Ga0070681_10003879 3300005458 Bacteria 14074
39 Ga0070681_10053222 3300005458 Bacteria 4034
40 Ga0070681_10673350 3300005458 Bacteria 950
41 Ga0070679_100201086 3300005530 Bacteria 1958
42 Ga0070684_100000111 3300005535 Bacteria 52800
43 Ga0070684_100038670 3300005535 Unclassified 4100
44 Ga0068853_100356762 3300005539 Unclassified 1361
45 Ga0068853_100511819 3300005539 Bacteria 1134
46 Ga0070665_100084423 3300005548 Bacteria 3181
47 Ga0070665_100162062 3300005548 Bacteria 2238
48 Ga0068855_100053015 3300005563 Bacteria 4773
49 Ga0068855_100112531 3300005563 Bacteria 3124
50 Ga0068855_100329248 3300005563 Bacteria 1686
51 Ga0070664_100107526 3300005564 Bacteria 2432
52 Ga0070664_100656287 3300005564 Unclassified 975
53 Ga0068857_100001093 3300005577 Bacteria 21038
54 Ga0068857_100014954 3300005577 Bacteria 6769
55 Ga0068857_100031273 3300005577 Unclassified 4703
56 Ga0068857_100655465 3300005577 Bacteria 995
57 Ga0068856_100008645 3300005614 Bacteria 9905
58 Ga0068856_100011376 3300005614 Bacteria 8632
59 Ga0068856_100037945 3300005614 Bacteria 4728
60 Ga0068856_100080093 3300005614 Unclassified 3239
61 Ga0068852_100034073 3300005616 Bacteria 4235
62 Ga0068859_100033777 3300005617 Bacteria 5136
63 Ga0068859_100057540 3300005617 Bacteria 3916
64 Ga0068859_100072218 3300005617 Bacteria 3488
65 Ga0068859_100597317 3300005617 Bacteria 1197
66 Ga0068864_100824518 3300005618 Unclassified 913
67 Ga0068866_10097767 3300005718 Bacteria 1613
68 Ga0068851_10046876 3300005834 Bacteria 2187
69 Ga0068863_100041109 3300005841 Unclassified 4395
70 Ga0068863_100238527 3300005841 Unclassified 1755
71 Ga0068863_100997489 3300005841 Unclassified 840
72 Ga0068858_100024758 3300005842 Bacteria 5589
73 Ga0068858_100063050 3300005842 Unclassified 3429
74 Ga0068858_100664229 3300005842 Bacteria 1013
75 Ga0068858_100924959 3300005842 Unclassified 853
76 Ga0068860_100020263 3300005843 Bacteria 6442
77 Ga0068860_100066791 3300005843 Bacteria 3417
78 Ga0068860_100384632 3300005843 Bacteria 1386
79 Ga0070717_10016555 3300006028 Bacteria 5718
80 Ga0070717_10151564 3300006028 Bacteria 2006
81 Ga0070717_10508904 3300006028 Unclassified 1089
82 Ga0097621_100004273 3300006237 Bacteria 9923
83 Ga0097621_100012110 3300006237 Bacteria 6382
84 Ga0097621_100073433 3300006237 Unclassified 2831
85 Ga0097621_100202212 3300006237 Bacteria 1725
86 Ga0097621_100332434 3300006237 Bacteria 1348
87 Ga0068871_100076331 3300006358 Bacteria 2767
88 Ga0068871_100325531 3300006358 Bacteria 1354
89 Ga0068871_100417210 3300006358 Unclassified 1198
90 Ga0075430_100116452 3300006846 Bacteria 2227
91 Ga0075430_100153151 3300006846 Bacteria 1919
92 Ga0075433_10064776 3300006852 Bacteria 3204
93 Ga0075434_100064226 3300006871 Bacteria 3655
94 Ga0097620_100033777 3300006931 Bacteria 5136
95 Ga0097620_100057540 3300006931 Bacteria 3916
96 Ga0097620_100072220 3300006931 Bacteria 3488
97 Ga0097620_100597264 3300006931 Bacteria 1197
98 Ga0105240_10005118 3300009093 Bacteria 19622
99 Ga0105240_10006790 3300009093 Bacteria 16739
100 Ga0105240_10086676 3300009093 Bacteria 3835
101 Ga0105240_10201379 3300009093 Unclassified 2333
102 Ga0105240_10331567 3300009093 Unclassified 1731
103 Ga0105240_10536851 3300009093 Bacteria 1296
104 Ga0111539_10137497 3300009094 Bacteria 2861
105 Ga0105245_10001801 3300009098 Bacteria 19532
106 Ga0105245_10005351 3300009098 Bacteria 11273
107 Ga0105245_10055140 3300009098 Unclassified 3570
108 Ga0105245_10254432 3300009098 Unclassified 1707
109 Ga0105245_10338831 3300009098 Bacteria 1486
110 Ga0105247_10007526 3300009101 Bacteria 6674
111 Ga0105247_10156692 3300009101 Bacteria 1505
112 Ga0114129_10012043 3300009147 Bacteria 12302
113 Ga0105243_10129143 3300009148 Bacteria 2142
114 Ga0105241_10021543 3300009174 Bacteria 4766
115 Ga0105241_10110385 3300009174 Bacteria 2200
116 Ga0105241_10132560 3300009174 Bacteria 2019
117 Ga0105241_10294706 3300009174 Unclassified 1390
118 Ga0105241_10834333 3300009174 Unclassified 851
119 Ga0105242_10008006 3300009176 Bacteria 8142
120 Ga0105242_10326779 3300009176 Unclassified 1409
121 Ga0105248_10010365 3300009177 Bacteria 10262
122 Ga0105248_10018231 3300009177 Bacteria 7752
123 Ga0105248_10140692 3300009177 Bacteria 2722
124 Ga0105248_10182375 3300009177 Unclassified 2365
125 Ga0105248_10471767 3300009177 Unclassified 1415
126 Ga0105248_10520737 3300009177 Unclassified 1341
127 Ga0105248_10686503 3300009177 Unclassified 1155
128 Ga0105237_10015091 3300009545 Bacteria 8050
129 Ga0105237_10022592 3300009545 Bacteria 6452
130 Ga0105237_10028227 3300009545 Bacteria 5718
131 Ga0105237_10033630 3300009545 Bacteria 5195
132 Ga0105237_10038026 3300009545 Bacteria 4862
133 Ga0105237_10186590 3300009545 Unclassified 2074
134 Ga0105237_10297536 3300009545 Bacteria 1617
135 Ga0105237_10489961 3300009545 Unclassified 1236
136 Ga0105237_10491951 3300009545 Bacteria 1233
137 Ga0105237_10843599 3300009545 Bacteria 923
138 Ga0105238_10001856 3300009551 Bacteria 21171
139 Ga0105238_10006942 3300009551 Bacteria 11314
140 Ga0105238_10012162 3300009551 Bacteria 8674
141 Ga0105238_10118047 3300009551 Unclassified 2633
142 Ga0105238_10249587 3300009551 Bacteria 1753
143 Ga0105238_10254155 3300009551 Unclassified 1736
144 Ga0105249_10391392 3300009553 Unclassified 1418
145 Ga0105239_10012052 3300010375 Bacteria 9640
146 Ga0105239_10014627 3300010375 Bacteria 8703
147 Ga0105239_10026746 3300010375 Bacteria 6350
148 Ga0105239_10133091 3300010375 Bacteria 2767
149 Ga0105246_10072492 3300011119 Unclassified 2428
150 Ga0105246_10466780 3300011119 Bacteria 1065
151 Ga0157373_10266513 3300013100 Bacteria 1212
152 Ga0157370_10289751 3300013104 Bacteria 1512
153 Ga0157370_10299838 3300013104 Bacteria 1484
154 Ga0157370_10386801 3300013104 Unclassified 1288
155 Ga0157369_10000638 3300013105 Bacteria 45239
156 Ga0157369_10075206 3300013105 Unclassified 3622
157 Ga0157369_10335259 3300013105 Bacteria 1571
158 Ga0157369_10509707 3300013105 Bacteria 1245
159 Ga0157374_10004393 3300013296 Bacteria 11861
160 Ga0157374_10208280 3300013296 Bacteria 1917
161 Ga0157374_10313010 3300013296 Unclassified 1555
162 Ga0157378_10008354 3300013297 Bacteria 9017
163 Ga0157378_10593247 3300013297 Unclassified 1118
164 Ga0163162_10110032 3300013306 Unclassified 2852
165 Ga0163162_11103988 3300013306 Bacteria 899
166 Ga0157372_10041622 3300013307 Bacteria 5081
167 Ga0157375_10014927 3300013308 Bacteria 6945
168 Ga0157375_10054177 3300013308 Unclassified 3950
169 Ga0157375_10175755 3300013308 Bacteria 2290
170 Ga0157375_10365994 3300013308 Unclassified 1608
171 Ga0163163_10003294 3300014325 Bacteria 13699
172 Ga0163163_10020764 3300014325 Bacteria 6191
173 Ga0163163_10022226 3300014325 Bacteria 6001
174 Ga0163163_10076256 3300014325 Unclassified 3347
175 Ga0163163_10081498 3300014325 Bacteria 3238
176 Ga0157379_10533623 3300014968 Bacteria 1090
177 Ga0157376_10004178 3300014969 Bacteria 10016
178 Ga0157376_10018783 3300014969 Bacteria 5311
179 Ga0157376_10941283 3300014969 Bacteria 884
180 Ga0184598_118883 3300019182 Bacteria 978
181 Ga0184599_104318 3300019188 Unclassified 1853
182 Ga0184600_140722 3300019190 Unclassified 1396
183 Ga0184603_130569 3300019192 Bacteria 1522
184 Ga0247553_100059 3300023672 Bacteria 2766
185 Ga0247553_103130 3300023672 Unclassified 796
186 Ga0207642_10130108 3300025899 Unclassified 1312
187 Ga0207680_10120709 3300025903 Bacteria 1713
188 Ga0207680_10194633 3300025903 Unclassified 1378
189 Ga0207699_10015856 3300025906 Unclassified 3926
190 Ga0207699_10066350 3300025906 Bacteria 2191
191 Ga0207699_10163715 3300025906 Unclassified 1483
192 Ga0207699_10189933 3300025906 Unclassified 1386
193 Ga0207699_10287884 3300025906 Unclassified 1144
194 Ga0207699_10326627 3300025906 Unclassified 1078
195 Ga0207705_10160103 3300025909 Bacteria 1691
196 Ga0207654_10082123 3300025911 Bacteria 1943
197 Ga0207654_10124078 3300025911 Bacteria 1626
198 Ga0207654_10138413 3300025911 Unclassified 1549
199 Ga0207654_10403404 3300025911 Unclassified 951
200 Ga0207654_10427517 3300025911 Unclassified 925
201 Ga0207707_10002801 3300025912 Bacteria 15551
202 Ga0207707_10091701 3300025912 Bacteria 2655
203 Ga0207707_10250354 3300025912 Bacteria 1539
204 Ga0207707_10269401 3300025912 Bacteria 1476
205 Ga0207707_10571251 3300025912 Unclassified 959
206 Ga0207695_10080451 3300025913 Bacteria 3300
207 Ga0207695_10108035 3300025913 Bacteria 2767
208 Ga0207695_10154864 3300025913 Bacteria 2227
209 Ga0207671_10000310 3300025914 Bacteria 72022
210 Ga0207671_10009865 3300025914 Bacteria 7939
211 Ga0207671_10021296 3300025914 Bacteria 4920
212 Ga0207671_10098554 3300025914 Bacteria 2211
213 Ga0207671_10137697 3300025914 Bacteria 1878
214 Ga0207671_10149505 3300025914 Bacteria 1804
215 Ga0207671_10485400 3300025914 Bacteria 985
216 Ga0207660_10084556 3300025917 Bacteria 2339
217 Ga0207660_10488312 3300025917 Bacteria 998
218 Ga0207657_10006822 3300025919 Bacteria 11781
219 Ga0207649_10062913 3300025920 Bacteria 2341
220 Ga0207652_10081480 3300025921 Unclassified 2831
221 Ga0207652_10681660 3300025921 Bacteria 918
222 Ga0207694_10021787 3300025924 Unclassified 4857
223 Ga0207694_10029879 3300025924 Bacteria 4161
224 Ga0207694_10053300 3300025924 Bacteria 3136
225 Ga0207694_10193604 3300025924 Unclassified 1652
226 Ga0207694_10580993 3300025924 Unclassified 942
227 Ga0207659_10156502 3300025926 Unclassified 1785
228 Ga0207687_10001326 3300025927 Bacteria 16914
229 Ga0207687_10400757 3300025927 Unclassified 1128
230 Ga0207700_10005568 3300025928 Bacteria 7557
231 Ga0207700_10026818 3300025928 Bacteria 4024
232 Ga0207700_10050712 3300025928 Unclassified 3094
233 Ga0207700_10110301 3300025928 Bacteria 2212
234 Ga0207664_10008455 3300025929 Bacteria 7181
235 Ga0207664_10032187 3300025929 Bacteria 4017
236 Ga0207664_10201148 3300025929 Unclassified 1719
237 Ga0207686_10003586 3300025934 Bacteria 8325
238 Ga0207686_10023569 3300025934 Bacteria 3557
239 Ga0207686_10091658 3300025934 Unclassified 2008
240 Ga0207709_10284257 3300025935 Unclassified 1223
241 Ga0207709_10615868 3300025935 Unclassified 861
242 Ga0207670_10206614 3300025936 Unclassified 1495
243 Ga0207704_10365850 3300025938 Bacteria 1127
244 Ga0207711_10009097 3300025941 Bacteria 8293
245 Ga0207711_10017813 3300025941 Bacteria 5901
246 Ga0207711_10036407 3300025941 Unclassified 4176
247 Ga0207711_10216080 3300025941 Unclassified 1752
248 Ga0207711_10350770 3300025941 Unclassified 1366
249 Ga0207711_10400414 3300025941 Bacteria 1275
250 Ga0207689_10188167 3300025942 Bacteria 1703
251 Ga0207689_10283435 3300025942 Bacteria 1372
252 Ga0207661_10000014 3300025944 Bacteria 322246
253 Ga0207661_10171089 3300025944 Unclassified 1891
254 Ga0207679_10292418 3300025945 Unclassified 1401
255 Ga0207667_10053344 3300025949 Bacteria 4255
256 Ga0207667_10124376 3300025949 Unclassified 2657
257 Ga0207667_10176033 3300025949 Bacteria 2198
258 Ga0207667_10204360 3300025949 Bacteria 2026
259 Ga0207667_10260346 3300025949 Unclassified 1774
260 Ga0207667_10324104 3300025949 Bacteria 1573
261 Ga0207667_10403174 3300025949 Unclassified 1392
262 Ga0207651_10415501 3300025960 Unclassified 1147
263 Ga0207712_10316907 3300025961 Unclassified 1285
264 Ga0207658_10046041 3300025986 Bacteria 3183
265 Ga0207658_10194179 3300025986 Bacteria 1690
266 Ga0207677_10004709 3300026023 Bacteria 7350
267 Ga0207677_10014548 3300026023 Unclassified 4599
268 Ga0207677_10046463 3300026023 Bacteria 2907
269 Ga0207703_10001119 3300026035 Bacteria 25314
270 Ga0207703_10005137 3300026035 Bacteria 10590
271 Ga0207703_10833321 3300026035 Bacteria 882
272 Ga0207639_10115300 3300026041 Bacteria 2197
273 Ga0207639_10125031 3300026041 Bacteria 2120
274 Ga0207639_10242501 3300026041 Unclassified 1568
275 Ga0207702_10018038 3300026078 Bacteria 5840
276 Ga0207702_10061821 3300026078 Bacteria 3196
277 Ga0207702_10178456 3300026078 Unclassified 1954
278 Ga0207702_10258022 3300026078 Bacteria 1640
279 Ga0207641_10023883 3300026088 Bacteria 5040
280 Ga0207641_11072735 3300026088 Unclassified 804
281 Ga0207648_10015813 3300026089 Bacteria 6918
282 Ga0207676_10066089 3300026095 Unclassified 2882
283 Ga0207674_10010112 3300026116 Bacteria 10725
284 Ga0207674_10013101 3300026116 Bacteria 9229
285 Ga0207683_10377224 3300026121 Unclassified 1303
286 Ga0207698_10038250 3300026142 Bacteria 3543
287 Ga0207698_10076985 3300026142 Bacteria 2673
288 Ga0268266_10005912 3300028379 Bacteria 11316
289 Ga0268266_10032905 3300028379 Unclassified 4406
290 Ga0268264_10010002 3300028381 Bacteria 7852
291 Ga0265323_10000765 3300028653 Bacteria 17241
292 Ga0265336_10018881 3300028666 Bacteria 2229
293 Ga0265338_10044851 3300028800 Unclassified 4074
294 Ga0265338_10127888 3300028800 Unclassified 2012
295 Ga0265338_10340353 3300028800 Bacteria 1081
296 Ga0265324_10077974 3300029957 Bacteria 1127
297 Ga0265775_100392 3300030762 Bacteria 1742
298 Ga0265775_100684 3300030762 Unclassified 1439
299 Ga0265775_101238 3300030762 Bacteria 1185
300 Ga0265775_102566 3300030762 Unclassified 945
301 Ga0265777_100163 3300030877 Bacteria 2590
302 Ga0265777_101331 3300030877 Bacteria 1307
303 Ga0265777_101594 3300030877 Bacteria 1234
304 Ga0265777_102184 3300030877 Bacteria 1113
305 Ga0265777_102684 3300030877 Unclassified 1046
306 Ga0265777_103306 3300030877 Unclassified 985
307 Ga0265777_105678 3300030877 Unclassified 831
308 Ga0265776_100046 3300030880 Unclassified 3026
309 Ga0265776_102121 3300030880 Unclassified 896
310 Ga0265779_102498 3300031043 Bacteria 886
311 Ga0265330_10190329 3300031235 Bacteria 868
312 Ga0265320_10006153 3300031240 Bacteria 7597
313 Ga0265325_10027693 3300031241 Bacteria 3061
314 Ga0265329_10072903 3300031242 Bacteria 1087
315 Ga0265340_10007136 3300031247 Bacteria 6088
316 Ga0265339_10036544 3300031249 Bacteria 2749
317 Ga0265331_10020092 3300031250 Bacteria 3435
318 Ga0265331_10044365 3300031250 Bacteria 2151
319 Ga0265316_10000822 3300031344 Bacteria 34339
320 Ga0265316_10003015 3300031344 Bacteria 17212
321 Ga0265316_10093231 3300031344 Bacteria 2295
322 Ga0265316_10210657 3300031344 Bacteria 1437
323 Ga0265316_10527540 3300031344 Bacteria 842
324 Ga0265314_10008248 3300031711 Bacteria 8945
325 Ga0265342_10017824 3300031712 Bacteria 4611
326 Ga0265342_10106654 3300031712 Bacteria 1590
327 Ga0316053_100743 3300032120 Bacteria 1575
328 Ga0373926_0135367 3300035083 Bacteria 934
329 Ga0373941_0167462 3300035115 Unclassified 817
330 Ga0373954_0044159 3300035118 Bacteria 2079
331 Ga0373956_0057907 3300035119 Unclassified 1752
332 Ga0373955_0081277 3300035172 Bacteria 1832
333 Ga0373935_0020448 3300035692 Unclassified 4046
334 Ga0373935_0155864 3300035692 Unclassified 1553
335 Ga0373935_0180334 3300035692 Bacteria 1450
336 Ga0373935_0478824 3300035692 Unclassified 902
337 Ga0373927_0002103 3300035695 Bacteria 14698
338 Ga0373927_0008117 3300035695 Bacteria 7082
339 Ga0373933_0146649 3300035724 Unclassified 1493
340 Ga0373933_0313842 3300035724 Bacteria 1016
341 Ga0373947_0056424 3300035725 Bacteria 2374
342 Ga0373947_0060033 3300035725 Unclassified 2308
343 Ga0373947_0187385 3300035725 Bacteria 1349
344 Ga0373937_0001592 3300036401 Bacteria 19082
345 Ga0373937_0040050 3300036401 Bacteria 4271
346 Ga0373937_0133112 3300036401 Bacteria 2323
347 Ga0373937_0255758 3300036401 Bacteria 1651
348 Ga0373937_0388304 3300036401 Bacteria 1324
349 Ga0265778_000233 3300036457 Bacteria 4008
350 Ga0265778_000702 3300036457 Bacteria 2742
351 Ga0265778_001039 3300036457 Bacteria 2413
352 Ga0265778_001409 3300036457 Bacteria 2188
353 Ga0265778_002303 3300036457 Bacteria 1831
354 Ga0265778_002807 3300036457 Bacteria 1712
355 Ga0265778_002873 3300036457 Bacteria 1703
356 Ga0265778_003071 3300036457 Unclassified 1664
357 Ga0265778_004713 3300036457 Bacteria 1421
358 Ga0265778_005756 3300036457 Bacteria 1319
359 Ga0265778_006581 3300036457 Unclassified 1255
360 Ga0265778_008031 3300036457 Unclassified 1168
361 Ga0265778_008275 3300036457 Unclassified 1154
362 Ga0265778_009063 3300036457 Unclassified 1115
363 Ga0265778_009120 3300036457 Bacteria 1113
364 Ga0265778_010619 3300036457 Bacteria 1051
365 Ga0265778_013133 3300036457 Unclassified 968
366 Ga0265778_013903 3300036457 Bacteria 947
367 Ga0265778_015384 3300036457 Unclassified 909
368 Ga0265778_016230 3300036457 Unclassified 891
369 Ga0265778_018874 3300036457 Unclassified 840
370 Ga0265778_020245 3300036457 Bacteria 818
371 Ga0373925_0014412 3300037068 Bacteria 5715
372 Ga0373925_0079528 3300037068 Bacteria 2491
373 Ga0373925_0386389 3300037068 Unclassified 1140
374 Ga0453684_0386143 3300044712 Bacteria 1571
375 Ga0451576_0247771 3300045051 Unclassified 1862
376 Ga0451576_0498234 3300045051 Unclassified 1280
377 Ga0451576_0513319 3300045051 Unclassified 1259
378 Ga0495651_0025480 3300046462 Bacteria 4604
379 Ga0495580_0272513 3300046472 Bacteria 1155
380 Ga0495664_0141955 3300046477 Bacteria 1456
381 Ga0495618_0256565 3300046514 Unclassified 1096
382 Ga0495628_0422013 3300046516 Unclassified 972
383 Ga0495640_0117948 3300046533 Bacteria 1727
384 Ga0495599_0191146 3300046678 Unclassified 1259
385 Ga0495623_0185285 3300046679 Unclassified 1206
386 Ga0495658_0253965 3300046683 Unclassified 1106
387 Ga0495669_0009353 3300046684 Unclassified 4129
388 Ga0495613_0080223 3300046689 Unclassified 2372
389 Ga0495581_0133615 3300047315 Unclassified 1446
390 Ga0495604_0095430 3300047317 Bacteria 2197
391 Ga0495636_0043010 3300047318 Unclassified 1878
392 Ga0495674_0558974 3300047319 Bacteria 910
393 Ga0495680_0404578 3300047322 Unclassified 942
394 Ga0495684_0000289 3300047471 Bacteria 40819
395 Ga0495684_0085731 3300047471 Bacteria 2388
396 Ga0495684_0492443 3300047471 Bacteria 844
397 Ga0495602_0090286 3300048088 Bacteria 2545
398 Ga0496104_0134655 3300048907 Unclassified 2374
399 Ga0496104_0388035 3300048907 Bacteria 1309
400 Ga0496112_0267370 3300048915 Unclassified 1659
401 nmdc:mga05p37_2165_c1 3300050507 Bacteria 22891
402 nmdc:mga0qj67_101610_c1 3300050509 Bacteria 2318
403 nmdc:mga0qj67_96477_c1 3300050509 Bacteria 2380
404 nmdc:mga06r32_89886_c1 3300050510 Bacteria 2999
405 nmdc:mga0rr50_135201_c1 3300050513 Bacteria 1978
406 nmdc:mga0a205_96124_c1 3300050515 Bacteria 2861
407 Ga0495601_0527149 3300053077 Bacteria 761
408 Ga0495612_0111894 3300053078 Bacteria 1169
409 Ga0495619_0125280 3300053085 Unclassified 1763
410 Ga0587114_028100 3300059655 Bacteria 842
411 Ga0495674_0130590
412 Ga0070658_10050453
413 Ga0070658_10617953
414 Ga0070683_100000003
415 Ga0070683_100443221
416 Ga0070690_100488579
417 Ga0070666_10038300
418 Ga0070666_10094919
419 Ga0070666_10104725
420 Ga0070680_100087204
421 Ga0068868_100006891
422 Ga0068868_100018117
423 Ga0070660_100100635
424 Ga0070689_100249781
425 Ga0070661_100230302
426 Ga0070661_100247719
427 Ga0070675_100209189
428 Ga0070675_100633154
429 Ga0070674_100353129
430 Ga0070673_100458593
431 Ga0070659_100606298
432 Ga0070667_100022558
433 Ga0070667_100133449
434 Ga0070667_100200995
435 Ga0070709_10014995
436 Ga0070709_10025282
437 Ga0070709_10181807
438 Ga0070714_100005934
439 Ga0070714_100036914
440 Ga0070714_100097441
441 Ga0070713_100014567
442 Ga0070713_100020157
443 Ga0070713_100037413
444 Ga0070713_100094846
445 Ga0070713_100127423
446 Ga0070711_100171990
447 Ga0070678_100726785
448 Ga0070681_10003879
449 Ga0070681_10053222
450 Ga0070681_10673350
451 Ga0070679_100201086
452 Ga0070684_100000111
453 Ga0070684_100038670
454 Ga0068853_100356762
455 Ga0068853_100511819
456 Ga0070665_100084423
457 Ga0070665_100162062
458 Ga0068855_100053015
459 Ga0068855_100112531
460 Ga0068855_100329248
461 Ga0070664_100107526
462 Ga0070664_100656287
463 Ga0068857_100001093
464 Ga0068857_100014954
465 Ga0068857_100031273
466 Ga0068857_100655465
467 Ga0068856_100008645
468 Ga0068856_100011376
469 Ga0068856_100037945
470 Ga0068856_100080093
471 Ga0068852_100034073
472 Ga0068859_100033777
473 Ga0068859_100057540
474 Ga0068859_100072218
475 Ga0068859_100597317
476 Ga0068864_100824518
477 Ga0068866_10097767
478 Ga0068851_10046876
479 Ga0068863_100041109
480 Ga0068863_100238527
481 Ga0068863_100997489
482 Ga0068858_100024758
483 Ga0068858_100063050
484 Ga0068858_100664229
485 Ga0068858_100924959
486 Ga0068860_100020263
487 Ga0068860_100066791
488 Ga0068860_100384632
489 Ga0070717_10016555
490 Ga0070717_10151564
491 Ga0070717_10508904
492 Ga0097621_100004273
493 Ga0097621_100012110
494 Ga0097621_100073433
495 Ga0097621_100202212
496 Ga0097621_100332434
497 Ga0068871_100076331
498 Ga0068871_100325531
499 Ga0068871_100417210
500 Ga0075430_100116452
501 Ga0075430_100153151
502 Ga0075433_10064776
503 Ga0075434_100064226
504 Ga0097620_100033777
505 Ga0097620_100057540
506 Ga0097620_100072220
507 Ga0097620_100597264
508 Ga0105240_10005118
509 Ga0105240_10006790
510 Ga0105240_10086676
511 Ga0105240_10201379
512 Ga0105240_10331567
513 Ga0105240_10536851
514 Ga0111539_10137497
515 Ga0105245_10001801
516 Ga0105245_10005351
517 Ga0105245_10055140
518 Ga0105245_10254432
519 Ga0105245_10338831
520 Ga0105247_10007526
521 Ga0105247_10156692
522 Ga0114129_10012043
523 Ga0105243_10129143
524 Ga0105241_10021543
525 Ga0105241_10110385
526 Ga0105241_10132560
527 Ga0105241_10294706
528 Ga0105241_10834333
529 Ga0105242_10008006
530 Ga0105242_10326779
531 Ga0105248_10010365
532 Ga0105248_10018231
533 Ga0105248_10140692
534 Ga0105248_10182375
535 Ga0105248_10471767
536 Ga0105248_10520737
537 Ga0105248_10686503
538 Ga0105237_10015091
539 Ga0105237_10022592
540 Ga0105237_10028227
541 Ga0105237_10033630
542 Ga0105237_10038026
543 Ga0105237_10186590
544 Ga0105237_10297536
545 Ga0105237_10489961
546 Ga0105237_10491951
547 Ga0105237_10843599
548 Ga0105238_10001856
549 Ga0105238_10006942
550 Ga0105238_10012162
551 Ga0105238_10118047
552 Ga0105238_10249587
553 Ga0105238_10254155
554 Ga0105249_10391392
555 Ga0105239_10012052
556 Ga0105239_10014627
557 Ga0105239_10026746
558 Ga0105239_10133091
559 Ga0105246_10072492
560 Ga0105246_10466780
561 Ga0157373_10266513
562 Ga0157370_10289751
563 Ga0157370_10299838
564 Ga0157370_10386801
565 Ga0157369_10000638
566 Ga0157369_10075206
567 Ga0157369_10335259
568 Ga0157369_10509707
569 Ga0157374_10004393
570 Ga0157374_10208280
571 Ga0157374_10313010
572 Ga0157378_10008354
573 Ga0157378_10593247
574 Ga0163162_10110032
575 Ga0163162_11103988
576 Ga0157372_10041622
577 Ga0157375_10014927
578 Ga0157375_10054177
579 Ga0157375_10175755
580 Ga0157375_10365994
581 Ga0163163_10003294
582 Ga0163163_10020764
583 Ga0163163_10022226
584 Ga0163163_10076256
585 Ga0163163_10081498
586 Ga0157379_10533623
587 Ga0157376_10004178
588 Ga0157376_10018783
589 Ga0157376_10941283
590 Ga0184598_118883
591 Ga0184599_104318
592 Ga0184600_140722
593 Ga0184603_130569
594 Ga0247553_100059
595 Ga0247553_103130
596 Ga0207642_10130108
597 Ga0207680_10120709
598 Ga0207680_10194633
599 Ga0207699_10015856
600 Ga0207699_10066350
601 Ga0207699_10163715
602 Ga0207699_10189933
603 Ga0207699_10287884
604 Ga0207699_10326627
605 Ga0207705_10160103
606 Ga0207654_10082123
607 Ga0207654_10124078
608 Ga0207654_10138413
609 Ga0207654_10403404
610 Ga0207654_10427517
611 Ga0207707_10002801
612 Ga0207707_10091701
613 Ga0207707_10250354
614 Ga0207707_10269401
615 Ga0207707_10571251
616 Ga0207695_10080451
617 Ga0207695_10108035
618 Ga0207695_10154864
619 Ga0207671_10000310
620 Ga0207671_10009865
621 Ga0207671_10021296
622 Ga0207671_10098554
623 Ga0207671_10137697
624 Ga0207671_10149505
625 Ga0207671_10485400
626 Ga0207660_10084556
627 Ga0207660_10488312
628 Ga0207657_10006822
629 Ga0207649_10062913
630 Ga0207652_10081480
631 Ga0207652_10681660
632 Ga0207694_10021787
633 Ga0207694_10029879
634 Ga0207694_10053300
635 Ga0207694_10193604
636 Ga0207694_10580993
637 Ga0207659_10156502
638 Ga0207687_10001326
639 Ga0207687_10400757
640 Ga0207700_10005568
641 Ga0207700_10026818
642 Ga0207700_10050712
643 Ga0207700_10110301
644 Ga0207664_10008455
645 Ga0207664_10032187
646 Ga0207664_10201148
647 Ga0207686_10003586
648 Ga0207686_10023569
649 Ga0207686_10091658
650 Ga0207709_10284257
651 Ga0207709_10615868
652 Ga0207670_10206614
653 Ga0207704_10365850
654 Ga0207711_10009097
655 Ga0207711_10017813
656 Ga0207711_10036407
657 Ga0207711_10216080
658 Ga0207711_10350770
659 Ga0207711_10400414
660 Ga0207689_10188167
661 Ga0207689_10283435
662 Ga0207661_10000014
663 Ga0207661_10171089
664 Ga0207679_10292418
665 Ga0207667_10053344
666 Ga0207667_10124376
667 Ga0207667_10176033
668 Ga0207667_10204360
669 Ga0207667_10260346
670 Ga0207667_10324104
671 Ga0207667_10403174
672 Ga0207651_10415501
673 Ga0207712_10316907
674 Ga0207658_10046041
675 Ga0207658_10194179
676 Ga0207677_10004709
677 Ga0207677_10014548
678 Ga0207677_10046463
679 Ga0207703_10001119
680 Ga0207703_10005137
681 Ga0207703_10833321
682 Ga0207639_10115300
683 Ga0207639_10125031
684 Ga0207639_10242501
685 Ga0207702_10018038
686 Ga0207702_10061821
687 Ga0207702_10178456
688 Ga0207702_10258022
689 Ga0207641_10023883
690 Ga0207641_11072735
691 Ga0207648_10015813
692 Ga0207676_10066089
693 Ga0207674_10010112
694 Ga0207674_10013101
695 Ga0207683_10377224
696 Ga0207698_10038250
697 Ga0207698_10076985
698 Ga0268266_10005912
699 Ga0268266_10032905
700 Ga0268264_10010002
701 Ga0265323_10000765
702 Ga0265336_10018881
703 Ga0265338_10044851
704 Ga0265338_10127888
705 Ga0265338_10340353
706 Ga0265324_10077974
707 Ga0265775_100392
708 Ga0265775_100684
709 Ga0265775_101238
710 Ga0265775_102566
711 Ga0265777_100163
712 Ga0265777_101331
713 Ga0265777_101594
714 Ga0265777_102184
715 Ga0265777_102684
716 Ga0265777_103306
717 Ga0265777_105678
718 Ga0265776_100046
719 Ga0265776_102121
720 Ga0265779_102498
721 Ga0265330_10190329
722 Ga0265320_10006153
723 Ga0265325_10027693
724 Ga0265329_10072903
725 Ga0265340_10007136
726 Ga0265339_10036544
727 Ga0265331_10020092
728 Ga0265331_10044365
729 Ga0265316_10000822
730 Ga0265316_10003015
731 Ga0265316_10093231
732 Ga0265316_10210657
733 Ga0265316_10527540
734 Ga0265314_10008248
735 Ga0265342_10017824
736 Ga0265342_10106654
737 Ga0316053_100743
738 Ga0373926_0135367
739 Ga0373941_0167462
740 Ga0373954_0044159
741 Ga0373956_0057907
742 Ga0373955_0081277
743 Ga0373935_0020448
744 Ga0373935_0155864
745 Ga0373935_0180334
746 Ga0373935_0478824
747 Ga0373927_0002103
748 Ga0373927_0008117
749 Ga0373933_0146649
750 Ga0373933_0313842
751 Ga0373947_0056424
752 Ga0373947_0060033
753 Ga0373947_0187385
754 Ga0373937_0001592
755 Ga0373937_0040050
756 Ga0373937_0133112
757 Ga0373937_0255758
758 Ga0373937_0388304
759 Ga0265778_000233
760 Ga0265778_000702
761 Ga0265778_001039
762 Ga0265778_001409
763 Ga0265778_002303
764 Ga0265778_002807
765 Ga0265778_002873
766 Ga0265778_003071
767 Ga0265778_004713
768 Ga0265778_005756
769 Ga0265778_006581
770 Ga0265778_008031
771 Ga0265778_008275
772 Ga0265778_009063
773 Ga0265778_009120
774 Ga0265778_010619
775 Ga0265778_013133
776 Ga0265778_013903
777 Ga0265778_015384
778 Ga0265778_016230
779 Ga0265778_018874
780 Ga0265778_020245
781 Ga0373925_0014412
782 Ga0373925_0079528
783 Ga0373925_0386389
784 Ga0453684_0386143
785 Ga0451576_0247771
786 Ga0451576_0498234
787 Ga0451576_0513319
788 Ga0495651_0025480
789 Ga0495580_0272513
790 Ga0495664_0141955
791 Ga0495618_0256565
792 Ga0495628_0422013
793 Ga0495640_0117948
794 Ga0495599_0191146
795 Ga0495623_0185285
796 Ga0495658_0253965
797 Ga0495669_0009353
798 Ga0495613_0080223
799 Ga0495581_0133615
800 Ga0495604_0095430
801 Ga0495636_0043010
802 Ga0495674_0558974
803 Ga0495680_0404578
804 Ga0495684_0000289
805 Ga0495684_0085731
806 Ga0495684_0492443
807 Ga0495602_0090286
808 Ga0496104_0134655
809 Ga0496104_0388035
810 Ga0496112_0267370
811 nmdc:mga05p37_2165_c1
812 nmdc:mga0qj67_101610_c1
813 nmdc:mga0qj67_96477_c1
814 nmdc:mga06r32_89886_c1
815 nmdc:mga0rr50_135201_c1
816 nmdc:mga0a205_96124_c1
817 Ga0495601_0527149
818 Ga0495612_0111894
819 Ga0495619_0125280
820 Ga0587114_028100

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cw7-assembly2.cif.gz_B structure of the fap7-rps14 complex in complex with atp 0.6568 66 88
2ess-assembly1.cif.gz_A-2 crystal structure of an acyl-acp thioesterase (np_810988.1) from bacteroides thetaiotaomicron vpi-5482 at 1.90 a resolution 0.6267 32 90
3t90-assembly1.cif.gz_A-2 crystal structure of glucosamine-6-phosphate n-acetyltransferase from arabidopsis thaliana 0.5825 69 92
4a12-assembly1.cif.gz_B structure of the global transcription regulator fapr from staphylococcus aureus in complex with dna operator 0.5541 53 86
4a0y-assembly1.cif.gz_B-2 structure of the global transcription regulator fapr from staphylococcus aureus 0.5476 53 86
ID Description Score Start End Superfamily
2essA02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7123 53 90 3.10.129.10
3kh8B02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6697 55 84 3.10.129.10
3khpB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6449 55 84 3.10.129.10
af_Q75IA9_394_500_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6311 63 91 3.30.200.20
af_Q54XZ0_160_288_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6306 55 90 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2W0B4V3-F1-model_v4 Uncharacterized protein 0.89 32 130
AF-A0A2V9GZP4-F1-model_v4 Uncharacterized protein 0.8824 32 134
AF-A0A2V9E5N2-F1-model_v4 Uncharacterized protein 0.8818 29 135
AF-A0A2V8P0M9-F1-model_v4 Uncharacterized protein 0.8534 25 136
AF-A0A2V8N729-F1-model_v4 Uncharacterized protein 0.8338 30 141

Map