F437356
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 410 | 176 | 820 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300047319|Ga0495674_0130590|Ga0495674_0130590_1269_2075 |
| Length | 268 |
| Sequence | LRQVAADGPRNAHINPKEESKGKEEMKIFKAATMVCGIALMGALLAPSAKADDWNRKTVITFSGPVEIPGVHLAGWGVLPAGTYVFKILDSQSDRHIVQIFSKDEKTVYATILAIPNYRLQATDKTVMTFRERPAGEPEALRAWFYPGRNWGEEFVYPKAKAMTLAKTTNTPILFTPAELPVEVTEPTKLASEPIVLEMKRAPIMAFRPTGEEVQLAEVVTPPPAQTEVAVAAEKALPHTASILPLIGLCGLLALGGFVALRVAEKRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 74 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 127 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 136 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 142 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.27 |
| Metatranscriptomes | 10.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.73 |
| Rhizosphere | 99.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495674_0130590 | 3300047319 | Bacteria | 2117 |
| 2 | Ga0070658_10050453 | 3300005327 | Bacteria | 3373 |
| 3 | Ga0070658_10617953 | 3300005327 | Unclassified | 940 |
| 4 | Ga0070683_100000003 | 3300005329 | Bacteria | 375084 |
| 5 | Ga0070683_100443221 | 3300005329 | Bacteria | 1239 |
| 6 | Ga0070690_100488579 | 3300005330 | Bacteria | 919 |
| 7 | Ga0070666_10038300 | 3300005335 | Unclassified | 3190 |
| 8 | Ga0070666_10094919 | 3300005335 | Bacteria | 2052 |
| 9 | Ga0070666_10104725 | 3300005335 | Bacteria | 1953 |
| 10 | Ga0070680_100087204 | 3300005336 | Unclassified | 2581 |
| 11 | Ga0068868_100006891 | 3300005338 | Bacteria | 8071 |
| 12 | Ga0068868_100018117 | 3300005338 | Bacteria | 5258 |
| 13 | Ga0070660_100100635 | 3300005339 | Bacteria | 2289 |
| 14 | Ga0070689_100249781 | 3300005340 | Unclassified | 1463 |
| 15 | Ga0070661_100230302 | 3300005344 | Unclassified | 1424 |
| 16 | Ga0070661_100247719 | 3300005344 | Bacteria | 1374 |
| 17 | Ga0070675_100209189 | 3300005354 | Unclassified | 1695 |
| 18 | Ga0070675_100633154 | 3300005354 | Unclassified | 971 |
| 19 | Ga0070674_100353129 | 3300005356 | Unclassified | 1188 |
| 20 | Ga0070673_100458593 | 3300005364 | Unclassified | 1147 |
| 21 | Ga0070659_100606298 | 3300005366 | Unclassified | 941 |
| 22 | Ga0070667_100022558 | 3300005367 | Bacteria | 5220 |
| 23 | Ga0070667_100133449 | 3300005367 | Bacteria | 2169 |
| 24 | Ga0070667_100200995 | 3300005367 | Bacteria | 1769 |
| 25 | Ga0070709_10014995 | 3300005434 | Bacteria | 4398 |
| 26 | Ga0070709_10025282 | 3300005434 | Bacteria | 3507 |
| 27 | Ga0070709_10181807 | 3300005434 | Unclassified | 1477 |
| 28 | Ga0070714_100005934 | 3300005435 | Bacteria | 9377 |
| 29 | Ga0070714_100036914 | 3300005435 | Bacteria | 4102 |
| 30 | Ga0070714_100097441 | 3300005435 | Unclassified | 2585 |
| 31 | Ga0070713_100014567 | 3300005436 | Bacteria | 5846 |
| 32 | Ga0070713_100020157 | 3300005436 | Bacteria | 5106 |
| 33 | Ga0070713_100037413 | 3300005436 | Bacteria | 3924 |
| 34 | Ga0070713_100094846 | 3300005436 | Bacteria | 2573 |
| 35 | Ga0070713_100127423 | 3300005436 | Bacteria | 2241 |
| 36 | Ga0070711_100171990 | 3300005439 | Bacteria | 1652 |
| 37 | Ga0070678_100726785 | 3300005456 | Bacteria | 896 |
| 38 | Ga0070681_10003879 | 3300005458 | Bacteria | 14074 |
| 39 | Ga0070681_10053222 | 3300005458 | Bacteria | 4034 |
| 40 | Ga0070681_10673350 | 3300005458 | Bacteria | 950 |
| 41 | Ga0070679_100201086 | 3300005530 | Bacteria | 1958 |
| 42 | Ga0070684_100000111 | 3300005535 | Bacteria | 52800 |
| 43 | Ga0070684_100038670 | 3300005535 | Unclassified | 4100 |
| 44 | Ga0068853_100356762 | 3300005539 | Unclassified | 1361 |
| 45 | Ga0068853_100511819 | 3300005539 | Bacteria | 1134 |
| 46 | Ga0070665_100084423 | 3300005548 | Bacteria | 3181 |
| 47 | Ga0070665_100162062 | 3300005548 | Bacteria | 2238 |
| 48 | Ga0068855_100053015 | 3300005563 | Bacteria | 4773 |
| 49 | Ga0068855_100112531 | 3300005563 | Bacteria | 3124 |
| 50 | Ga0068855_100329248 | 3300005563 | Bacteria | 1686 |
| 51 | Ga0070664_100107526 | 3300005564 | Bacteria | 2432 |
| 52 | Ga0070664_100656287 | 3300005564 | Unclassified | 975 |
| 53 | Ga0068857_100001093 | 3300005577 | Bacteria | 21038 |
| 54 | Ga0068857_100014954 | 3300005577 | Bacteria | 6769 |
| 55 | Ga0068857_100031273 | 3300005577 | Unclassified | 4703 |
| 56 | Ga0068857_100655465 | 3300005577 | Bacteria | 995 |
| 57 | Ga0068856_100008645 | 3300005614 | Bacteria | 9905 |
| 58 | Ga0068856_100011376 | 3300005614 | Bacteria | 8632 |
| 59 | Ga0068856_100037945 | 3300005614 | Bacteria | 4728 |
| 60 | Ga0068856_100080093 | 3300005614 | Unclassified | 3239 |
| 61 | Ga0068852_100034073 | 3300005616 | Bacteria | 4235 |
| 62 | Ga0068859_100033777 | 3300005617 | Bacteria | 5136 |
| 63 | Ga0068859_100057540 | 3300005617 | Bacteria | 3916 |
| 64 | Ga0068859_100072218 | 3300005617 | Bacteria | 3488 |
| 65 | Ga0068859_100597317 | 3300005617 | Bacteria | 1197 |
| 66 | Ga0068864_100824518 | 3300005618 | Unclassified | 913 |
| 67 | Ga0068866_10097767 | 3300005718 | Bacteria | 1613 |
| 68 | Ga0068851_10046876 | 3300005834 | Bacteria | 2187 |
| 69 | Ga0068863_100041109 | 3300005841 | Unclassified | 4395 |
| 70 | Ga0068863_100238527 | 3300005841 | Unclassified | 1755 |
| 71 | Ga0068863_100997489 | 3300005841 | Unclassified | 840 |
| 72 | Ga0068858_100024758 | 3300005842 | Bacteria | 5589 |
| 73 | Ga0068858_100063050 | 3300005842 | Unclassified | 3429 |
| 74 | Ga0068858_100664229 | 3300005842 | Bacteria | 1013 |
| 75 | Ga0068858_100924959 | 3300005842 | Unclassified | 853 |
| 76 | Ga0068860_100020263 | 3300005843 | Bacteria | 6442 |
| 77 | Ga0068860_100066791 | 3300005843 | Bacteria | 3417 |
| 78 | Ga0068860_100384632 | 3300005843 | Bacteria | 1386 |
| 79 | Ga0070717_10016555 | 3300006028 | Bacteria | 5718 |
| 80 | Ga0070717_10151564 | 3300006028 | Bacteria | 2006 |
| 81 | Ga0070717_10508904 | 3300006028 | Unclassified | 1089 |
| 82 | Ga0097621_100004273 | 3300006237 | Bacteria | 9923 |
| 83 | Ga0097621_100012110 | 3300006237 | Bacteria | 6382 |
| 84 | Ga0097621_100073433 | 3300006237 | Unclassified | 2831 |
| 85 | Ga0097621_100202212 | 3300006237 | Bacteria | 1725 |
| 86 | Ga0097621_100332434 | 3300006237 | Bacteria | 1348 |
| 87 | Ga0068871_100076331 | 3300006358 | Bacteria | 2767 |
| 88 | Ga0068871_100325531 | 3300006358 | Bacteria | 1354 |
| 89 | Ga0068871_100417210 | 3300006358 | Unclassified | 1198 |
| 90 | Ga0075430_100116452 | 3300006846 | Bacteria | 2227 |
| 91 | Ga0075430_100153151 | 3300006846 | Bacteria | 1919 |
| 92 | Ga0075433_10064776 | 3300006852 | Bacteria | 3204 |
| 93 | Ga0075434_100064226 | 3300006871 | Bacteria | 3655 |
| 94 | Ga0097620_100033777 | 3300006931 | Bacteria | 5136 |
| 95 | Ga0097620_100057540 | 3300006931 | Bacteria | 3916 |
| 96 | Ga0097620_100072220 | 3300006931 | Bacteria | 3488 |
| 97 | Ga0097620_100597264 | 3300006931 | Bacteria | 1197 |
| 98 | Ga0105240_10005118 | 3300009093 | Bacteria | 19622 |
| 99 | Ga0105240_10006790 | 3300009093 | Bacteria | 16739 |
| 100 | Ga0105240_10086676 | 3300009093 | Bacteria | 3835 |
| 101 | Ga0105240_10201379 | 3300009093 | Unclassified | 2333 |
| 102 | Ga0105240_10331567 | 3300009093 | Unclassified | 1731 |
| 103 | Ga0105240_10536851 | 3300009093 | Bacteria | 1296 |
| 104 | Ga0111539_10137497 | 3300009094 | Bacteria | 2861 |
| 105 | Ga0105245_10001801 | 3300009098 | Bacteria | 19532 |
| 106 | Ga0105245_10005351 | 3300009098 | Bacteria | 11273 |
| 107 | Ga0105245_10055140 | 3300009098 | Unclassified | 3570 |
| 108 | Ga0105245_10254432 | 3300009098 | Unclassified | 1707 |
| 109 | Ga0105245_10338831 | 3300009098 | Bacteria | 1486 |
| 110 | Ga0105247_10007526 | 3300009101 | Bacteria | 6674 |
| 111 | Ga0105247_10156692 | 3300009101 | Bacteria | 1505 |
| 112 | Ga0114129_10012043 | 3300009147 | Bacteria | 12302 |
| 113 | Ga0105243_10129143 | 3300009148 | Bacteria | 2142 |
| 114 | Ga0105241_10021543 | 3300009174 | Bacteria | 4766 |
| 115 | Ga0105241_10110385 | 3300009174 | Bacteria | 2200 |
| 116 | Ga0105241_10132560 | 3300009174 | Bacteria | 2019 |
| 117 | Ga0105241_10294706 | 3300009174 | Unclassified | 1390 |
| 118 | Ga0105241_10834333 | 3300009174 | Unclassified | 851 |
| 119 | Ga0105242_10008006 | 3300009176 | Bacteria | 8142 |
| 120 | Ga0105242_10326779 | 3300009176 | Unclassified | 1409 |
| 121 | Ga0105248_10010365 | 3300009177 | Bacteria | 10262 |
| 122 | Ga0105248_10018231 | 3300009177 | Bacteria | 7752 |
| 123 | Ga0105248_10140692 | 3300009177 | Bacteria | 2722 |
| 124 | Ga0105248_10182375 | 3300009177 | Unclassified | 2365 |
| 125 | Ga0105248_10471767 | 3300009177 | Unclassified | 1415 |
| 126 | Ga0105248_10520737 | 3300009177 | Unclassified | 1341 |
| 127 | Ga0105248_10686503 | 3300009177 | Unclassified | 1155 |
| 128 | Ga0105237_10015091 | 3300009545 | Bacteria | 8050 |
| 129 | Ga0105237_10022592 | 3300009545 | Bacteria | 6452 |
| 130 | Ga0105237_10028227 | 3300009545 | Bacteria | 5718 |
| 131 | Ga0105237_10033630 | 3300009545 | Bacteria | 5195 |
| 132 | Ga0105237_10038026 | 3300009545 | Bacteria | 4862 |
| 133 | Ga0105237_10186590 | 3300009545 | Unclassified | 2074 |
| 134 | Ga0105237_10297536 | 3300009545 | Bacteria | 1617 |
| 135 | Ga0105237_10489961 | 3300009545 | Unclassified | 1236 |
| 136 | Ga0105237_10491951 | 3300009545 | Bacteria | 1233 |
| 137 | Ga0105237_10843599 | 3300009545 | Bacteria | 923 |
| 138 | Ga0105238_10001856 | 3300009551 | Bacteria | 21171 |
| 139 | Ga0105238_10006942 | 3300009551 | Bacteria | 11314 |
| 140 | Ga0105238_10012162 | 3300009551 | Bacteria | 8674 |
| 141 | Ga0105238_10118047 | 3300009551 | Unclassified | 2633 |
| 142 | Ga0105238_10249587 | 3300009551 | Bacteria | 1753 |
| 143 | Ga0105238_10254155 | 3300009551 | Unclassified | 1736 |
| 144 | Ga0105249_10391392 | 3300009553 | Unclassified | 1418 |
| 145 | Ga0105239_10012052 | 3300010375 | Bacteria | 9640 |
| 146 | Ga0105239_10014627 | 3300010375 | Bacteria | 8703 |
| 147 | Ga0105239_10026746 | 3300010375 | Bacteria | 6350 |
| 148 | Ga0105239_10133091 | 3300010375 | Bacteria | 2767 |
| 149 | Ga0105246_10072492 | 3300011119 | Unclassified | 2428 |
| 150 | Ga0105246_10466780 | 3300011119 | Bacteria | 1065 |
| 151 | Ga0157373_10266513 | 3300013100 | Bacteria | 1212 |
| 152 | Ga0157370_10289751 | 3300013104 | Bacteria | 1512 |
| 153 | Ga0157370_10299838 | 3300013104 | Bacteria | 1484 |
| 154 | Ga0157370_10386801 | 3300013104 | Unclassified | 1288 |
| 155 | Ga0157369_10000638 | 3300013105 | Bacteria | 45239 |
| 156 | Ga0157369_10075206 | 3300013105 | Unclassified | 3622 |
| 157 | Ga0157369_10335259 | 3300013105 | Bacteria | 1571 |
| 158 | Ga0157369_10509707 | 3300013105 | Bacteria | 1245 |
| 159 | Ga0157374_10004393 | 3300013296 | Bacteria | 11861 |
| 160 | Ga0157374_10208280 | 3300013296 | Bacteria | 1917 |
| 161 | Ga0157374_10313010 | 3300013296 | Unclassified | 1555 |
| 162 | Ga0157378_10008354 | 3300013297 | Bacteria | 9017 |
| 163 | Ga0157378_10593247 | 3300013297 | Unclassified | 1118 |
| 164 | Ga0163162_10110032 | 3300013306 | Unclassified | 2852 |
| 165 | Ga0163162_11103988 | 3300013306 | Bacteria | 899 |
| 166 | Ga0157372_10041622 | 3300013307 | Bacteria | 5081 |
| 167 | Ga0157375_10014927 | 3300013308 | Bacteria | 6945 |
| 168 | Ga0157375_10054177 | 3300013308 | Unclassified | 3950 |
| 169 | Ga0157375_10175755 | 3300013308 | Bacteria | 2290 |
| 170 | Ga0157375_10365994 | 3300013308 | Unclassified | 1608 |
| 171 | Ga0163163_10003294 | 3300014325 | Bacteria | 13699 |
| 172 | Ga0163163_10020764 | 3300014325 | Bacteria | 6191 |
| 173 | Ga0163163_10022226 | 3300014325 | Bacteria | 6001 |
| 174 | Ga0163163_10076256 | 3300014325 | Unclassified | 3347 |
| 175 | Ga0163163_10081498 | 3300014325 | Bacteria | 3238 |
| 176 | Ga0157379_10533623 | 3300014968 | Bacteria | 1090 |
| 177 | Ga0157376_10004178 | 3300014969 | Bacteria | 10016 |
| 178 | Ga0157376_10018783 | 3300014969 | Bacteria | 5311 |
| 179 | Ga0157376_10941283 | 3300014969 | Bacteria | 884 |
| 180 | Ga0184598_118883 | 3300019182 | Bacteria | 978 |
| 181 | Ga0184599_104318 | 3300019188 | Unclassified | 1853 |
| 182 | Ga0184600_140722 | 3300019190 | Unclassified | 1396 |
| 183 | Ga0184603_130569 | 3300019192 | Bacteria | 1522 |
| 184 | Ga0247553_100059 | 3300023672 | Bacteria | 2766 |
| 185 | Ga0247553_103130 | 3300023672 | Unclassified | 796 |
| 186 | Ga0207642_10130108 | 3300025899 | Unclassified | 1312 |
| 187 | Ga0207680_10120709 | 3300025903 | Bacteria | 1713 |
| 188 | Ga0207680_10194633 | 3300025903 | Unclassified | 1378 |
| 189 | Ga0207699_10015856 | 3300025906 | Unclassified | 3926 |
| 190 | Ga0207699_10066350 | 3300025906 | Bacteria | 2191 |
| 191 | Ga0207699_10163715 | 3300025906 | Unclassified | 1483 |
| 192 | Ga0207699_10189933 | 3300025906 | Unclassified | 1386 |
| 193 | Ga0207699_10287884 | 3300025906 | Unclassified | 1144 |
| 194 | Ga0207699_10326627 | 3300025906 | Unclassified | 1078 |
| 195 | Ga0207705_10160103 | 3300025909 | Bacteria | 1691 |
| 196 | Ga0207654_10082123 | 3300025911 | Bacteria | 1943 |
| 197 | Ga0207654_10124078 | 3300025911 | Bacteria | 1626 |
| 198 | Ga0207654_10138413 | 3300025911 | Unclassified | 1549 |
| 199 | Ga0207654_10403404 | 3300025911 | Unclassified | 951 |
| 200 | Ga0207654_10427517 | 3300025911 | Unclassified | 925 |
| 201 | Ga0207707_10002801 | 3300025912 | Bacteria | 15551 |
| 202 | Ga0207707_10091701 | 3300025912 | Bacteria | 2655 |
| 203 | Ga0207707_10250354 | 3300025912 | Bacteria | 1539 |
| 204 | Ga0207707_10269401 | 3300025912 | Bacteria | 1476 |
| 205 | Ga0207707_10571251 | 3300025912 | Unclassified | 959 |
| 206 | Ga0207695_10080451 | 3300025913 | Bacteria | 3300 |
| 207 | Ga0207695_10108035 | 3300025913 | Bacteria | 2767 |
| 208 | Ga0207695_10154864 | 3300025913 | Bacteria | 2227 |
| 209 | Ga0207671_10000310 | 3300025914 | Bacteria | 72022 |
| 210 | Ga0207671_10009865 | 3300025914 | Bacteria | 7939 |
| 211 | Ga0207671_10021296 | 3300025914 | Bacteria | 4920 |
| 212 | Ga0207671_10098554 | 3300025914 | Bacteria | 2211 |
| 213 | Ga0207671_10137697 | 3300025914 | Bacteria | 1878 |
| 214 | Ga0207671_10149505 | 3300025914 | Bacteria | 1804 |
| 215 | Ga0207671_10485400 | 3300025914 | Bacteria | 985 |
| 216 | Ga0207660_10084556 | 3300025917 | Bacteria | 2339 |
| 217 | Ga0207660_10488312 | 3300025917 | Bacteria | 998 |
| 218 | Ga0207657_10006822 | 3300025919 | Bacteria | 11781 |
| 219 | Ga0207649_10062913 | 3300025920 | Bacteria | 2341 |
| 220 | Ga0207652_10081480 | 3300025921 | Unclassified | 2831 |
| 221 | Ga0207652_10681660 | 3300025921 | Bacteria | 918 |
| 222 | Ga0207694_10021787 | 3300025924 | Unclassified | 4857 |
| 223 | Ga0207694_10029879 | 3300025924 | Bacteria | 4161 |
| 224 | Ga0207694_10053300 | 3300025924 | Bacteria | 3136 |
| 225 | Ga0207694_10193604 | 3300025924 | Unclassified | 1652 |
| 226 | Ga0207694_10580993 | 3300025924 | Unclassified | 942 |
| 227 | Ga0207659_10156502 | 3300025926 | Unclassified | 1785 |
| 228 | Ga0207687_10001326 | 3300025927 | Bacteria | 16914 |
| 229 | Ga0207687_10400757 | 3300025927 | Unclassified | 1128 |
| 230 | Ga0207700_10005568 | 3300025928 | Bacteria | 7557 |
| 231 | Ga0207700_10026818 | 3300025928 | Bacteria | 4024 |
| 232 | Ga0207700_10050712 | 3300025928 | Unclassified | 3094 |
| 233 | Ga0207700_10110301 | 3300025928 | Bacteria | 2212 |
| 234 | Ga0207664_10008455 | 3300025929 | Bacteria | 7181 |
| 235 | Ga0207664_10032187 | 3300025929 | Bacteria | 4017 |
| 236 | Ga0207664_10201148 | 3300025929 | Unclassified | 1719 |
| 237 | Ga0207686_10003586 | 3300025934 | Bacteria | 8325 |
| 238 | Ga0207686_10023569 | 3300025934 | Bacteria | 3557 |
| 239 | Ga0207686_10091658 | 3300025934 | Unclassified | 2008 |
| 240 | Ga0207709_10284257 | 3300025935 | Unclassified | 1223 |
| 241 | Ga0207709_10615868 | 3300025935 | Unclassified | 861 |
| 242 | Ga0207670_10206614 | 3300025936 | Unclassified | 1495 |
| 243 | Ga0207704_10365850 | 3300025938 | Bacteria | 1127 |
| 244 | Ga0207711_10009097 | 3300025941 | Bacteria | 8293 |
| 245 | Ga0207711_10017813 | 3300025941 | Bacteria | 5901 |
| 246 | Ga0207711_10036407 | 3300025941 | Unclassified | 4176 |
| 247 | Ga0207711_10216080 | 3300025941 | Unclassified | 1752 |
| 248 | Ga0207711_10350770 | 3300025941 | Unclassified | 1366 |
| 249 | Ga0207711_10400414 | 3300025941 | Bacteria | 1275 |
| 250 | Ga0207689_10188167 | 3300025942 | Bacteria | 1703 |
| 251 | Ga0207689_10283435 | 3300025942 | Bacteria | 1372 |
| 252 | Ga0207661_10000014 | 3300025944 | Bacteria | 322246 |
| 253 | Ga0207661_10171089 | 3300025944 | Unclassified | 1891 |
| 254 | Ga0207679_10292418 | 3300025945 | Unclassified | 1401 |
| 255 | Ga0207667_10053344 | 3300025949 | Bacteria | 4255 |
| 256 | Ga0207667_10124376 | 3300025949 | Unclassified | 2657 |
| 257 | Ga0207667_10176033 | 3300025949 | Bacteria | 2198 |
| 258 | Ga0207667_10204360 | 3300025949 | Bacteria | 2026 |
| 259 | Ga0207667_10260346 | 3300025949 | Unclassified | 1774 |
| 260 | Ga0207667_10324104 | 3300025949 | Bacteria | 1573 |
| 261 | Ga0207667_10403174 | 3300025949 | Unclassified | 1392 |
| 262 | Ga0207651_10415501 | 3300025960 | Unclassified | 1147 |
| 263 | Ga0207712_10316907 | 3300025961 | Unclassified | 1285 |
| 264 | Ga0207658_10046041 | 3300025986 | Bacteria | 3183 |
| 265 | Ga0207658_10194179 | 3300025986 | Bacteria | 1690 |
| 266 | Ga0207677_10004709 | 3300026023 | Bacteria | 7350 |
| 267 | Ga0207677_10014548 | 3300026023 | Unclassified | 4599 |
| 268 | Ga0207677_10046463 | 3300026023 | Bacteria | 2907 |
| 269 | Ga0207703_10001119 | 3300026035 | Bacteria | 25314 |
| 270 | Ga0207703_10005137 | 3300026035 | Bacteria | 10590 |
| 271 | Ga0207703_10833321 | 3300026035 | Bacteria | 882 |
| 272 | Ga0207639_10115300 | 3300026041 | Bacteria | 2197 |
| 273 | Ga0207639_10125031 | 3300026041 | Bacteria | 2120 |
| 274 | Ga0207639_10242501 | 3300026041 | Unclassified | 1568 |
| 275 | Ga0207702_10018038 | 3300026078 | Bacteria | 5840 |
| 276 | Ga0207702_10061821 | 3300026078 | Bacteria | 3196 |
| 277 | Ga0207702_10178456 | 3300026078 | Unclassified | 1954 |
| 278 | Ga0207702_10258022 | 3300026078 | Bacteria | 1640 |
| 279 | Ga0207641_10023883 | 3300026088 | Bacteria | 5040 |
| 280 | Ga0207641_11072735 | 3300026088 | Unclassified | 804 |
| 281 | Ga0207648_10015813 | 3300026089 | Bacteria | 6918 |
| 282 | Ga0207676_10066089 | 3300026095 | Unclassified | 2882 |
| 283 | Ga0207674_10010112 | 3300026116 | Bacteria | 10725 |
| 284 | Ga0207674_10013101 | 3300026116 | Bacteria | 9229 |
| 285 | Ga0207683_10377224 | 3300026121 | Unclassified | 1303 |
| 286 | Ga0207698_10038250 | 3300026142 | Bacteria | 3543 |
| 287 | Ga0207698_10076985 | 3300026142 | Bacteria | 2673 |
| 288 | Ga0268266_10005912 | 3300028379 | Bacteria | 11316 |
| 289 | Ga0268266_10032905 | 3300028379 | Unclassified | 4406 |
| 290 | Ga0268264_10010002 | 3300028381 | Bacteria | 7852 |
| 291 | Ga0265323_10000765 | 3300028653 | Bacteria | 17241 |
| 292 | Ga0265336_10018881 | 3300028666 | Bacteria | 2229 |
| 293 | Ga0265338_10044851 | 3300028800 | Unclassified | 4074 |
| 294 | Ga0265338_10127888 | 3300028800 | Unclassified | 2012 |
| 295 | Ga0265338_10340353 | 3300028800 | Bacteria | 1081 |
| 296 | Ga0265324_10077974 | 3300029957 | Bacteria | 1127 |
| 297 | Ga0265775_100392 | 3300030762 | Bacteria | 1742 |
| 298 | Ga0265775_100684 | 3300030762 | Unclassified | 1439 |
| 299 | Ga0265775_101238 | 3300030762 | Bacteria | 1185 |
| 300 | Ga0265775_102566 | 3300030762 | Unclassified | 945 |
| 301 | Ga0265777_100163 | 3300030877 | Bacteria | 2590 |
| 302 | Ga0265777_101331 | 3300030877 | Bacteria | 1307 |
| 303 | Ga0265777_101594 | 3300030877 | Bacteria | 1234 |
| 304 | Ga0265777_102184 | 3300030877 | Bacteria | 1113 |
| 305 | Ga0265777_102684 | 3300030877 | Unclassified | 1046 |
| 306 | Ga0265777_103306 | 3300030877 | Unclassified | 985 |
| 307 | Ga0265777_105678 | 3300030877 | Unclassified | 831 |
| 308 | Ga0265776_100046 | 3300030880 | Unclassified | 3026 |
| 309 | Ga0265776_102121 | 3300030880 | Unclassified | 896 |
| 310 | Ga0265779_102498 | 3300031043 | Bacteria | 886 |
| 311 | Ga0265330_10190329 | 3300031235 | Bacteria | 868 |
| 312 | Ga0265320_10006153 | 3300031240 | Bacteria | 7597 |
| 313 | Ga0265325_10027693 | 3300031241 | Bacteria | 3061 |
| 314 | Ga0265329_10072903 | 3300031242 | Bacteria | 1087 |
| 315 | Ga0265340_10007136 | 3300031247 | Bacteria | 6088 |
| 316 | Ga0265339_10036544 | 3300031249 | Bacteria | 2749 |
| 317 | Ga0265331_10020092 | 3300031250 | Bacteria | 3435 |
| 318 | Ga0265331_10044365 | 3300031250 | Bacteria | 2151 |
| 319 | Ga0265316_10000822 | 3300031344 | Bacteria | 34339 |
| 320 | Ga0265316_10003015 | 3300031344 | Bacteria | 17212 |
| 321 | Ga0265316_10093231 | 3300031344 | Bacteria | 2295 |
| 322 | Ga0265316_10210657 | 3300031344 | Bacteria | 1437 |
| 323 | Ga0265316_10527540 | 3300031344 | Bacteria | 842 |
| 324 | Ga0265314_10008248 | 3300031711 | Bacteria | 8945 |
| 325 | Ga0265342_10017824 | 3300031712 | Bacteria | 4611 |
| 326 | Ga0265342_10106654 | 3300031712 | Bacteria | 1590 |
| 327 | Ga0316053_100743 | 3300032120 | Bacteria | 1575 |
| 328 | Ga0373926_0135367 | 3300035083 | Bacteria | 934 |
| 329 | Ga0373941_0167462 | 3300035115 | Unclassified | 817 |
| 330 | Ga0373954_0044159 | 3300035118 | Bacteria | 2079 |
| 331 | Ga0373956_0057907 | 3300035119 | Unclassified | 1752 |
| 332 | Ga0373955_0081277 | 3300035172 | Bacteria | 1832 |
| 333 | Ga0373935_0020448 | 3300035692 | Unclassified | 4046 |
| 334 | Ga0373935_0155864 | 3300035692 | Unclassified | 1553 |
| 335 | Ga0373935_0180334 | 3300035692 | Bacteria | 1450 |
| 336 | Ga0373935_0478824 | 3300035692 | Unclassified | 902 |
| 337 | Ga0373927_0002103 | 3300035695 | Bacteria | 14698 |
| 338 | Ga0373927_0008117 | 3300035695 | Bacteria | 7082 |
| 339 | Ga0373933_0146649 | 3300035724 | Unclassified | 1493 |
| 340 | Ga0373933_0313842 | 3300035724 | Bacteria | 1016 |
| 341 | Ga0373947_0056424 | 3300035725 | Bacteria | 2374 |
| 342 | Ga0373947_0060033 | 3300035725 | Unclassified | 2308 |
| 343 | Ga0373947_0187385 | 3300035725 | Bacteria | 1349 |
| 344 | Ga0373937_0001592 | 3300036401 | Bacteria | 19082 |
| 345 | Ga0373937_0040050 | 3300036401 | Bacteria | 4271 |
| 346 | Ga0373937_0133112 | 3300036401 | Bacteria | 2323 |
| 347 | Ga0373937_0255758 | 3300036401 | Bacteria | 1651 |
| 348 | Ga0373937_0388304 | 3300036401 | Bacteria | 1324 |
| 349 | Ga0265778_000233 | 3300036457 | Bacteria | 4008 |
| 350 | Ga0265778_000702 | 3300036457 | Bacteria | 2742 |
| 351 | Ga0265778_001039 | 3300036457 | Bacteria | 2413 |
| 352 | Ga0265778_001409 | 3300036457 | Bacteria | 2188 |
| 353 | Ga0265778_002303 | 3300036457 | Bacteria | 1831 |
| 354 | Ga0265778_002807 | 3300036457 | Bacteria | 1712 |
| 355 | Ga0265778_002873 | 3300036457 | Bacteria | 1703 |
| 356 | Ga0265778_003071 | 3300036457 | Unclassified | 1664 |
| 357 | Ga0265778_004713 | 3300036457 | Bacteria | 1421 |
| 358 | Ga0265778_005756 | 3300036457 | Bacteria | 1319 |
| 359 | Ga0265778_006581 | 3300036457 | Unclassified | 1255 |
| 360 | Ga0265778_008031 | 3300036457 | Unclassified | 1168 |
| 361 | Ga0265778_008275 | 3300036457 | Unclassified | 1154 |
| 362 | Ga0265778_009063 | 3300036457 | Unclassified | 1115 |
| 363 | Ga0265778_009120 | 3300036457 | Bacteria | 1113 |
| 364 | Ga0265778_010619 | 3300036457 | Bacteria | 1051 |
| 365 | Ga0265778_013133 | 3300036457 | Unclassified | 968 |
| 366 | Ga0265778_013903 | 3300036457 | Bacteria | 947 |
| 367 | Ga0265778_015384 | 3300036457 | Unclassified | 909 |
| 368 | Ga0265778_016230 | 3300036457 | Unclassified | 891 |
| 369 | Ga0265778_018874 | 3300036457 | Unclassified | 840 |
| 370 | Ga0265778_020245 | 3300036457 | Bacteria | 818 |
| 371 | Ga0373925_0014412 | 3300037068 | Bacteria | 5715 |
| 372 | Ga0373925_0079528 | 3300037068 | Bacteria | 2491 |
| 373 | Ga0373925_0386389 | 3300037068 | Unclassified | 1140 |
| 374 | Ga0453684_0386143 | 3300044712 | Bacteria | 1571 |
| 375 | Ga0451576_0247771 | 3300045051 | Unclassified | 1862 |
| 376 | Ga0451576_0498234 | 3300045051 | Unclassified | 1280 |
| 377 | Ga0451576_0513319 | 3300045051 | Unclassified | 1259 |
| 378 | Ga0495651_0025480 | 3300046462 | Bacteria | 4604 |
| 379 | Ga0495580_0272513 | 3300046472 | Bacteria | 1155 |
| 380 | Ga0495664_0141955 | 3300046477 | Bacteria | 1456 |
| 381 | Ga0495618_0256565 | 3300046514 | Unclassified | 1096 |
| 382 | Ga0495628_0422013 | 3300046516 | Unclassified | 972 |
| 383 | Ga0495640_0117948 | 3300046533 | Bacteria | 1727 |
| 384 | Ga0495599_0191146 | 3300046678 | Unclassified | 1259 |
| 385 | Ga0495623_0185285 | 3300046679 | Unclassified | 1206 |
| 386 | Ga0495658_0253965 | 3300046683 | Unclassified | 1106 |
| 387 | Ga0495669_0009353 | 3300046684 | Unclassified | 4129 |
| 388 | Ga0495613_0080223 | 3300046689 | Unclassified | 2372 |
| 389 | Ga0495581_0133615 | 3300047315 | Unclassified | 1446 |
| 390 | Ga0495604_0095430 | 3300047317 | Bacteria | 2197 |
| 391 | Ga0495636_0043010 | 3300047318 | Unclassified | 1878 |
| 392 | Ga0495674_0558974 | 3300047319 | Bacteria | 910 |
| 393 | Ga0495680_0404578 | 3300047322 | Unclassified | 942 |
| 394 | Ga0495684_0000289 | 3300047471 | Bacteria | 40819 |
| 395 | Ga0495684_0085731 | 3300047471 | Bacteria | 2388 |
| 396 | Ga0495684_0492443 | 3300047471 | Bacteria | 844 |
| 397 | Ga0495602_0090286 | 3300048088 | Bacteria | 2545 |
| 398 | Ga0496104_0134655 | 3300048907 | Unclassified | 2374 |
| 399 | Ga0496104_0388035 | 3300048907 | Bacteria | 1309 |
| 400 | Ga0496112_0267370 | 3300048915 | Unclassified | 1659 |
| 401 | nmdc:mga05p37_2165_c1 | 3300050507 | Bacteria | 22891 |
| 402 | nmdc:mga0qj67_101610_c1 | 3300050509 | Bacteria | 2318 |
| 403 | nmdc:mga0qj67_96477_c1 | 3300050509 | Bacteria | 2380 |
| 404 | nmdc:mga06r32_89886_c1 | 3300050510 | Bacteria | 2999 |
| 405 | nmdc:mga0rr50_135201_c1 | 3300050513 | Bacteria | 1978 |
| 406 | nmdc:mga0a205_96124_c1 | 3300050515 | Bacteria | 2861 |
| 407 | Ga0495601_0527149 | 3300053077 | Bacteria | 761 |
| 408 | Ga0495612_0111894 | 3300053078 | Bacteria | 1169 |
| 409 | Ga0495619_0125280 | 3300053085 | Unclassified | 1763 |
| 410 | Ga0587114_028100 | 3300059655 | Bacteria | 842 |
| 411 | Ga0495674_0130590 | |||
| 412 | Ga0070658_10050453 | |||
| 413 | Ga0070658_10617953 | |||
| 414 | Ga0070683_100000003 | |||
| 415 | Ga0070683_100443221 | |||
| 416 | Ga0070690_100488579 | |||
| 417 | Ga0070666_10038300 | |||
| 418 | Ga0070666_10094919 | |||
| 419 | Ga0070666_10104725 | |||
| 420 | Ga0070680_100087204 | |||
| 421 | Ga0068868_100006891 | |||
| 422 | Ga0068868_100018117 | |||
| 423 | Ga0070660_100100635 | |||
| 424 | Ga0070689_100249781 | |||
| 425 | Ga0070661_100230302 | |||
| 426 | Ga0070661_100247719 | |||
| 427 | Ga0070675_100209189 | |||
| 428 | Ga0070675_100633154 | |||
| 429 | Ga0070674_100353129 | |||
| 430 | Ga0070673_100458593 | |||
| 431 | Ga0070659_100606298 | |||
| 432 | Ga0070667_100022558 | |||
| 433 | Ga0070667_100133449 | |||
| 434 | Ga0070667_100200995 | |||
| 435 | Ga0070709_10014995 | |||
| 436 | Ga0070709_10025282 | |||
| 437 | Ga0070709_10181807 | |||
| 438 | Ga0070714_100005934 | |||
| 439 | Ga0070714_100036914 | |||
| 440 | Ga0070714_100097441 | |||
| 441 | Ga0070713_100014567 | |||
| 442 | Ga0070713_100020157 | |||
| 443 | Ga0070713_100037413 | |||
| 444 | Ga0070713_100094846 | |||
| 445 | Ga0070713_100127423 | |||
| 446 | Ga0070711_100171990 | |||
| 447 | Ga0070678_100726785 | |||
| 448 | Ga0070681_10003879 | |||
| 449 | Ga0070681_10053222 | |||
| 450 | Ga0070681_10673350 | |||
| 451 | Ga0070679_100201086 | |||
| 452 | Ga0070684_100000111 | |||
| 453 | Ga0070684_100038670 | |||
| 454 | Ga0068853_100356762 | |||
| 455 | Ga0068853_100511819 | |||
| 456 | Ga0070665_100084423 | |||
| 457 | Ga0070665_100162062 | |||
| 458 | Ga0068855_100053015 | |||
| 459 | Ga0068855_100112531 | |||
| 460 | Ga0068855_100329248 | |||
| 461 | Ga0070664_100107526 | |||
| 462 | Ga0070664_100656287 | |||
| 463 | Ga0068857_100001093 | |||
| 464 | Ga0068857_100014954 | |||
| 465 | Ga0068857_100031273 | |||
| 466 | Ga0068857_100655465 | |||
| 467 | Ga0068856_100008645 | |||
| 468 | Ga0068856_100011376 | |||
| 469 | Ga0068856_100037945 | |||
| 470 | Ga0068856_100080093 | |||
| 471 | Ga0068852_100034073 | |||
| 472 | Ga0068859_100033777 | |||
| 473 | Ga0068859_100057540 | |||
| 474 | Ga0068859_100072218 | |||
| 475 | Ga0068859_100597317 | |||
| 476 | Ga0068864_100824518 | |||
| 477 | Ga0068866_10097767 | |||
| 478 | Ga0068851_10046876 | |||
| 479 | Ga0068863_100041109 | |||
| 480 | Ga0068863_100238527 | |||
| 481 | Ga0068863_100997489 | |||
| 482 | Ga0068858_100024758 | |||
| 483 | Ga0068858_100063050 | |||
| 484 | Ga0068858_100664229 | |||
| 485 | Ga0068858_100924959 | |||
| 486 | Ga0068860_100020263 | |||
| 487 | Ga0068860_100066791 | |||
| 488 | Ga0068860_100384632 | |||
| 489 | Ga0070717_10016555 | |||
| 490 | Ga0070717_10151564 | |||
| 491 | Ga0070717_10508904 | |||
| 492 | Ga0097621_100004273 | |||
| 493 | Ga0097621_100012110 | |||
| 494 | Ga0097621_100073433 | |||
| 495 | Ga0097621_100202212 | |||
| 496 | Ga0097621_100332434 | |||
| 497 | Ga0068871_100076331 | |||
| 498 | Ga0068871_100325531 | |||
| 499 | Ga0068871_100417210 | |||
| 500 | Ga0075430_100116452 | |||
| 501 | Ga0075430_100153151 | |||
| 502 | Ga0075433_10064776 | |||
| 503 | Ga0075434_100064226 | |||
| 504 | Ga0097620_100033777 | |||
| 505 | Ga0097620_100057540 | |||
| 506 | Ga0097620_100072220 | |||
| 507 | Ga0097620_100597264 | |||
| 508 | Ga0105240_10005118 | |||
| 509 | Ga0105240_10006790 | |||
| 510 | Ga0105240_10086676 | |||
| 511 | Ga0105240_10201379 | |||
| 512 | Ga0105240_10331567 | |||
| 513 | Ga0105240_10536851 | |||
| 514 | Ga0111539_10137497 | |||
| 515 | Ga0105245_10001801 | |||
| 516 | Ga0105245_10005351 | |||
| 517 | Ga0105245_10055140 | |||
| 518 | Ga0105245_10254432 | |||
| 519 | Ga0105245_10338831 | |||
| 520 | Ga0105247_10007526 | |||
| 521 | Ga0105247_10156692 | |||
| 522 | Ga0114129_10012043 | |||
| 523 | Ga0105243_10129143 | |||
| 524 | Ga0105241_10021543 | |||
| 525 | Ga0105241_10110385 | |||
| 526 | Ga0105241_10132560 | |||
| 527 | Ga0105241_10294706 | |||
| 528 | Ga0105241_10834333 | |||
| 529 | Ga0105242_10008006 | |||
| 530 | Ga0105242_10326779 | |||
| 531 | Ga0105248_10010365 | |||
| 532 | Ga0105248_10018231 | |||
| 533 | Ga0105248_10140692 | |||
| 534 | Ga0105248_10182375 | |||
| 535 | Ga0105248_10471767 | |||
| 536 | Ga0105248_10520737 | |||
| 537 | Ga0105248_10686503 | |||
| 538 | Ga0105237_10015091 | |||
| 539 | Ga0105237_10022592 | |||
| 540 | Ga0105237_10028227 | |||
| 541 | Ga0105237_10033630 | |||
| 542 | Ga0105237_10038026 | |||
| 543 | Ga0105237_10186590 | |||
| 544 | Ga0105237_10297536 | |||
| 545 | Ga0105237_10489961 | |||
| 546 | Ga0105237_10491951 | |||
| 547 | Ga0105237_10843599 | |||
| 548 | Ga0105238_10001856 | |||
| 549 | Ga0105238_10006942 | |||
| 550 | Ga0105238_10012162 | |||
| 551 | Ga0105238_10118047 | |||
| 552 | Ga0105238_10249587 | |||
| 553 | Ga0105238_10254155 | |||
| 554 | Ga0105249_10391392 | |||
| 555 | Ga0105239_10012052 | |||
| 556 | Ga0105239_10014627 | |||
| 557 | Ga0105239_10026746 | |||
| 558 | Ga0105239_10133091 | |||
| 559 | Ga0105246_10072492 | |||
| 560 | Ga0105246_10466780 | |||
| 561 | Ga0157373_10266513 | |||
| 562 | Ga0157370_10289751 | |||
| 563 | Ga0157370_10299838 | |||
| 564 | Ga0157370_10386801 | |||
| 565 | Ga0157369_10000638 | |||
| 566 | Ga0157369_10075206 | |||
| 567 | Ga0157369_10335259 | |||
| 568 | Ga0157369_10509707 | |||
| 569 | Ga0157374_10004393 | |||
| 570 | Ga0157374_10208280 | |||
| 571 | Ga0157374_10313010 | |||
| 572 | Ga0157378_10008354 | |||
| 573 | Ga0157378_10593247 | |||
| 574 | Ga0163162_10110032 | |||
| 575 | Ga0163162_11103988 | |||
| 576 | Ga0157372_10041622 | |||
| 577 | Ga0157375_10014927 | |||
| 578 | Ga0157375_10054177 | |||
| 579 | Ga0157375_10175755 | |||
| 580 | Ga0157375_10365994 | |||
| 581 | Ga0163163_10003294 | |||
| 582 | Ga0163163_10020764 | |||
| 583 | Ga0163163_10022226 | |||
| 584 | Ga0163163_10076256 | |||
| 585 | Ga0163163_10081498 | |||
| 586 | Ga0157379_10533623 | |||
| 587 | Ga0157376_10004178 | |||
| 588 | Ga0157376_10018783 | |||
| 589 | Ga0157376_10941283 | |||
| 590 | Ga0184598_118883 | |||
| 591 | Ga0184599_104318 | |||
| 592 | Ga0184600_140722 | |||
| 593 | Ga0184603_130569 | |||
| 594 | Ga0247553_100059 | |||
| 595 | Ga0247553_103130 | |||
| 596 | Ga0207642_10130108 | |||
| 597 | Ga0207680_10120709 | |||
| 598 | Ga0207680_10194633 | |||
| 599 | Ga0207699_10015856 | |||
| 600 | Ga0207699_10066350 | |||
| 601 | Ga0207699_10163715 | |||
| 602 | Ga0207699_10189933 | |||
| 603 | Ga0207699_10287884 | |||
| 604 | Ga0207699_10326627 | |||
| 605 | Ga0207705_10160103 | |||
| 606 | Ga0207654_10082123 | |||
| 607 | Ga0207654_10124078 | |||
| 608 | Ga0207654_10138413 | |||
| 609 | Ga0207654_10403404 | |||
| 610 | Ga0207654_10427517 | |||
| 611 | Ga0207707_10002801 | |||
| 612 | Ga0207707_10091701 | |||
| 613 | Ga0207707_10250354 | |||
| 614 | Ga0207707_10269401 | |||
| 615 | Ga0207707_10571251 | |||
| 616 | Ga0207695_10080451 | |||
| 617 | Ga0207695_10108035 | |||
| 618 | Ga0207695_10154864 | |||
| 619 | Ga0207671_10000310 | |||
| 620 | Ga0207671_10009865 | |||
| 621 | Ga0207671_10021296 | |||
| 622 | Ga0207671_10098554 | |||
| 623 | Ga0207671_10137697 | |||
| 624 | Ga0207671_10149505 | |||
| 625 | Ga0207671_10485400 | |||
| 626 | Ga0207660_10084556 | |||
| 627 | Ga0207660_10488312 | |||
| 628 | Ga0207657_10006822 | |||
| 629 | Ga0207649_10062913 | |||
| 630 | Ga0207652_10081480 | |||
| 631 | Ga0207652_10681660 | |||
| 632 | Ga0207694_10021787 | |||
| 633 | Ga0207694_10029879 | |||
| 634 | Ga0207694_10053300 | |||
| 635 | Ga0207694_10193604 | |||
| 636 | Ga0207694_10580993 | |||
| 637 | Ga0207659_10156502 | |||
| 638 | Ga0207687_10001326 | |||
| 639 | Ga0207687_10400757 | |||
| 640 | Ga0207700_10005568 | |||
| 641 | Ga0207700_10026818 | |||
| 642 | Ga0207700_10050712 | |||
| 643 | Ga0207700_10110301 | |||
| 644 | Ga0207664_10008455 | |||
| 645 | Ga0207664_10032187 | |||
| 646 | Ga0207664_10201148 | |||
| 647 | Ga0207686_10003586 | |||
| 648 | Ga0207686_10023569 | |||
| 649 | Ga0207686_10091658 | |||
| 650 | Ga0207709_10284257 | |||
| 651 | Ga0207709_10615868 | |||
| 652 | Ga0207670_10206614 | |||
| 653 | Ga0207704_10365850 | |||
| 654 | Ga0207711_10009097 | |||
| 655 | Ga0207711_10017813 | |||
| 656 | Ga0207711_10036407 | |||
| 657 | Ga0207711_10216080 | |||
| 658 | Ga0207711_10350770 | |||
| 659 | Ga0207711_10400414 | |||
| 660 | Ga0207689_10188167 | |||
| 661 | Ga0207689_10283435 | |||
| 662 | Ga0207661_10000014 | |||
| 663 | Ga0207661_10171089 | |||
| 664 | Ga0207679_10292418 | |||
| 665 | Ga0207667_10053344 | |||
| 666 | Ga0207667_10124376 | |||
| 667 | Ga0207667_10176033 | |||
| 668 | Ga0207667_10204360 | |||
| 669 | Ga0207667_10260346 | |||
| 670 | Ga0207667_10324104 | |||
| 671 | Ga0207667_10403174 | |||
| 672 | Ga0207651_10415501 | |||
| 673 | Ga0207712_10316907 | |||
| 674 | Ga0207658_10046041 | |||
| 675 | Ga0207658_10194179 | |||
| 676 | Ga0207677_10004709 | |||
| 677 | Ga0207677_10014548 | |||
| 678 | Ga0207677_10046463 | |||
| 679 | Ga0207703_10001119 | |||
| 680 | Ga0207703_10005137 | |||
| 681 | Ga0207703_10833321 | |||
| 682 | Ga0207639_10115300 | |||
| 683 | Ga0207639_10125031 | |||
| 684 | Ga0207639_10242501 | |||
| 685 | Ga0207702_10018038 | |||
| 686 | Ga0207702_10061821 | |||
| 687 | Ga0207702_10178456 | |||
| 688 | Ga0207702_10258022 | |||
| 689 | Ga0207641_10023883 | |||
| 690 | Ga0207641_11072735 | |||
| 691 | Ga0207648_10015813 | |||
| 692 | Ga0207676_10066089 | |||
| 693 | Ga0207674_10010112 | |||
| 694 | Ga0207674_10013101 | |||
| 695 | Ga0207683_10377224 | |||
| 696 | Ga0207698_10038250 | |||
| 697 | Ga0207698_10076985 | |||
| 698 | Ga0268266_10005912 | |||
| 699 | Ga0268266_10032905 | |||
| 700 | Ga0268264_10010002 | |||
| 701 | Ga0265323_10000765 | |||
| 702 | Ga0265336_10018881 | |||
| 703 | Ga0265338_10044851 | |||
| 704 | Ga0265338_10127888 | |||
| 705 | Ga0265338_10340353 | |||
| 706 | Ga0265324_10077974 | |||
| 707 | Ga0265775_100392 | |||
| 708 | Ga0265775_100684 | |||
| 709 | Ga0265775_101238 | |||
| 710 | Ga0265775_102566 | |||
| 711 | Ga0265777_100163 | |||
| 712 | Ga0265777_101331 | |||
| 713 | Ga0265777_101594 | |||
| 714 | Ga0265777_102184 | |||
| 715 | Ga0265777_102684 | |||
| 716 | Ga0265777_103306 | |||
| 717 | Ga0265777_105678 | |||
| 718 | Ga0265776_100046 | |||
| 719 | Ga0265776_102121 | |||
| 720 | Ga0265779_102498 | |||
| 721 | Ga0265330_10190329 | |||
| 722 | Ga0265320_10006153 | |||
| 723 | Ga0265325_10027693 | |||
| 724 | Ga0265329_10072903 | |||
| 725 | Ga0265340_10007136 | |||
| 726 | Ga0265339_10036544 | |||
| 727 | Ga0265331_10020092 | |||
| 728 | Ga0265331_10044365 | |||
| 729 | Ga0265316_10000822 | |||
| 730 | Ga0265316_10003015 | |||
| 731 | Ga0265316_10093231 | |||
| 732 | Ga0265316_10210657 | |||
| 733 | Ga0265316_10527540 | |||
| 734 | Ga0265314_10008248 | |||
| 735 | Ga0265342_10017824 | |||
| 736 | Ga0265342_10106654 | |||
| 737 | Ga0316053_100743 | |||
| 738 | Ga0373926_0135367 | |||
| 739 | Ga0373941_0167462 | |||
| 740 | Ga0373954_0044159 | |||
| 741 | Ga0373956_0057907 | |||
| 742 | Ga0373955_0081277 | |||
| 743 | Ga0373935_0020448 | |||
| 744 | Ga0373935_0155864 | |||
| 745 | Ga0373935_0180334 | |||
| 746 | Ga0373935_0478824 | |||
| 747 | Ga0373927_0002103 | |||
| 748 | Ga0373927_0008117 | |||
| 749 | Ga0373933_0146649 | |||
| 750 | Ga0373933_0313842 | |||
| 751 | Ga0373947_0056424 | |||
| 752 | Ga0373947_0060033 | |||
| 753 | Ga0373947_0187385 | |||
| 754 | Ga0373937_0001592 | |||
| 755 | Ga0373937_0040050 | |||
| 756 | Ga0373937_0133112 | |||
| 757 | Ga0373937_0255758 | |||
| 758 | Ga0373937_0388304 | |||
| 759 | Ga0265778_000233 | |||
| 760 | Ga0265778_000702 | |||
| 761 | Ga0265778_001039 | |||
| 762 | Ga0265778_001409 | |||
| 763 | Ga0265778_002303 | |||
| 764 | Ga0265778_002807 | |||
| 765 | Ga0265778_002873 | |||
| 766 | Ga0265778_003071 | |||
| 767 | Ga0265778_004713 | |||
| 768 | Ga0265778_005756 | |||
| 769 | Ga0265778_006581 | |||
| 770 | Ga0265778_008031 | |||
| 771 | Ga0265778_008275 | |||
| 772 | Ga0265778_009063 | |||
| 773 | Ga0265778_009120 | |||
| 774 | Ga0265778_010619 | |||
| 775 | Ga0265778_013133 | |||
| 776 | Ga0265778_013903 | |||
| 777 | Ga0265778_015384 | |||
| 778 | Ga0265778_016230 | |||
| 779 | Ga0265778_018874 | |||
| 780 | Ga0265778_020245 | |||
| 781 | Ga0373925_0014412 | |||
| 782 | Ga0373925_0079528 | |||
| 783 | Ga0373925_0386389 | |||
| 784 | Ga0453684_0386143 | |||
| 785 | Ga0451576_0247771 | |||
| 786 | Ga0451576_0498234 | |||
| 787 | Ga0451576_0513319 | |||
| 788 | Ga0495651_0025480 | |||
| 789 | Ga0495580_0272513 | |||
| 790 | Ga0495664_0141955 | |||
| 791 | Ga0495618_0256565 | |||
| 792 | Ga0495628_0422013 | |||
| 793 | Ga0495640_0117948 | |||
| 794 | Ga0495599_0191146 | |||
| 795 | Ga0495623_0185285 | |||
| 796 | Ga0495658_0253965 | |||
| 797 | Ga0495669_0009353 | |||
| 798 | Ga0495613_0080223 | |||
| 799 | Ga0495581_0133615 | |||
| 800 | Ga0495604_0095430 | |||
| 801 | Ga0495636_0043010 | |||
| 802 | Ga0495674_0558974 | |||
| 803 | Ga0495680_0404578 | |||
| 804 | Ga0495684_0000289 | |||
| 805 | Ga0495684_0085731 | |||
| 806 | Ga0495684_0492443 | |||
| 807 | Ga0495602_0090286 | |||
| 808 | Ga0496104_0134655 | |||
| 809 | Ga0496104_0388035 | |||
| 810 | Ga0496112_0267370 | |||
| 811 | nmdc:mga05p37_2165_c1 | |||
| 812 | nmdc:mga0qj67_101610_c1 | |||
| 813 | nmdc:mga0qj67_96477_c1 | |||
| 814 | nmdc:mga06r32_89886_c1 | |||
| 815 | nmdc:mga0rr50_135201_c1 | |||
| 816 | nmdc:mga0a205_96124_c1 | |||
| 817 | Ga0495601_0527149 | |||
| 818 | Ga0495612_0111894 | |||
| 819 | Ga0495619_0125280 | |||
| 820 | Ga0587114_028100 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4cw7-assembly2.cif.gz_B | structure of the fap7-rps14 complex in complex with atp | 0.6568 | 66 | 88 |
| 2ess-assembly1.cif.gz_A-2 | crystal structure of an acyl-acp thioesterase (np_810988.1) from bacteroides thetaiotaomicron vpi-5482 at 1.90 a resolution | 0.6267 | 32 | 90 |
| 3t90-assembly1.cif.gz_A-2 | crystal structure of glucosamine-6-phosphate n-acetyltransferase from arabidopsis thaliana | 0.5825 | 69 | 92 |
| 4a12-assembly1.cif.gz_B | structure of the global transcription regulator fapr from staphylococcus aureus in complex with dna operator | 0.5541 | 53 | 86 |
| 4a0y-assembly1.cif.gz_B-2 | structure of the global transcription regulator fapr from staphylococcus aureus | 0.5476 | 53 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2essA02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.7123 | 53 | 90 | 3.10.129.10 |
| 3kh8B02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.6697 | 55 | 84 | 3.10.129.10 |
| 3khpB02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.6449 | 55 | 84 | 3.10.129.10 |
| af_Q75IA9_394_500_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.6311 | 63 | 91 | 3.30.200.20 |
| af_Q54XZ0_160_288_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.6306 | 55 | 90 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W0B4V3-F1-model_v4 | Uncharacterized protein | 0.89 | 32 | 130 |
|
| AF-A0A2V9GZP4-F1-model_v4 | Uncharacterized protein | 0.8824 | 32 | 134 |
|
| AF-A0A2V9E5N2-F1-model_v4 | Uncharacterized protein | 0.8818 | 29 | 135 |
|
| AF-A0A2V8P0M9-F1-model_v4 | Uncharacterized protein | 0.8534 | 25 | 136 |
|
| AF-A0A2V8N729-F1-model_v4 | Uncharacterized protein | 0.8338 | 30 | 141 |
|