F437240

General Info

Members Datasets Scaffolds Average Seq Length
410 151 820 127

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10000662|Ga0157371_1000066219
Length 140
Sequence MNLPLKKISINMSYELTGKLLIKFDTTQRTESFKTREFVVEKSEDVNGKLITNYIKFQCVQDRTGIIDRVNVGDEIKVHFNIRGSKWEKDGRVSYFNNLDAWRIEQILKPGKEANIDNDYFEPLDTFTSSSEDAIDDLPF

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
149 2818991444 Filimonas endophytica 3197 Isolate Unclassified
150 2914759650 Rhizosphaericola mali Isolate Rhizosphere
151 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.24
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0
Rhizoplane 0.98
Rhizosphere 94.88
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10000662 3300013102 Bacteria 40921
2 JGI24740J21852_10013887 3300001979 Bacteria 2989
3 JGI25406J46586_10005674 3300003203 Bacteria 5771
4 JGI25406J46586_10198956 3300003203 Bacteria 585
5 rootH1_10070738 3300003316 Bacteria 3360
6 rootH2_10012131 3300003320 Bacteria 2884
7 rootH2_10014527 3300003320 Bacteria 3040
8 rootH2_10041320 3300003320 Bacteria 5752
9 rootL2_10276175 3300003322 Bacteria 1308
10 rootH1_10062208 3300003323 Bacteria 4262
11 Ga0065714_10078610 3300005288 Bacteria 2583
12 Ga0065714_10428002 3300005288 Bacteria 550
13 Ga0070658_10012727 3300005327 Bacteria 6748
14 Ga0070658_10027448 3300005327 Bacteria 4569
15 Ga0070658_10058682 3300005327 Bacteria 3133
16 Ga0070658_10069502 3300005327 Bacteria 2881
17 Ga0070658_10162438 3300005327 Bacteria 1874
18 Ga0070658_10319208 3300005327 Unclassified 1326
19 Ga0070658_10463435 3300005327 Bacteria 1093
20 Ga0070658_11333244 3300005327 Unclassified 623
21 Ga0070676_10168413 3300005328 Bacteria 1415
22 Ga0070683_100330554 3300005329 Bacteria 1451
23 Ga0070683_101196545 3300005329 Bacteria 730
24 Ga0070683_101816925 3300005329 Bacteria 586
25 Ga0070683_101819705 3300005329 Bacteria 585
26 Ga0070690_100051879 3300005330 Bacteria 2620
27 Ga0070670_100227291 3300005331 Bacteria 1624
28 Ga0070670_100359381 3300005331 Bacteria 1280
29 Ga0068869_100243956 3300005334 Bacteria 1432
30 Ga0068869_100539871 3300005334 Bacteria 978
31 Ga0068869_101187212 3300005334 Bacteria 670
32 Ga0068869_101580475 3300005334 Bacteria 584
33 Ga0070680_100002379 3300005336 Bacteria 13909
34 Ga0070680_100014825 3300005336 Bacteria 6096
35 Ga0070680_100074822 3300005336 Bacteria 2787
36 Ga0070680_100127590 3300005336 Bacteria 2126
37 Ga0070680_100739824 3300005336 Bacteria 847
38 Ga0070680_100915712 3300005336 Bacteria 757
39 Ga0070682_100183314 3300005337 Bacteria 1464
40 Ga0068868_101925138 3300005338 Bacteria 560
41 Ga0070660_100019225 3300005339 Bacteria 5001
42 Ga0070660_100023271 3300005339 Bacteria 4590
43 Ga0070660_100118692 3300005339 Bacteria 2109
44 Ga0070660_100150527 3300005339 Bacteria 1871
45 Ga0070660_100166678 3300005339 Bacteria 1778
46 Ga0070660_100185621 3300005339 Bacteria 1684
47 Ga0070660_101577151 3300005339 Bacteria 559
48 Ga0070691_10251012 3300005341 Bacteria 949
49 Ga0070692_10309140 3300005345 Unclassified 968
50 Ga0070668_100766354 3300005347 Unclassified 855
51 Ga0070668_102150224 3300005347 Unclassified 515
52 Ga0070675_101071574 3300005354 Bacteria 741
53 Ga0070671_100000785 3300005355 Bacteria 22867
54 Ga0070671_100138693 3300005355 Bacteria 2051
55 Ga0070674_100380461 3300005356 Bacteria 1148
56 Ga0070673_101185457 3300005364 Bacteria 715
57 Ga0070673_102328812 3300005364 Unclassified 509
58 Ga0070688_101803260 3300005365 Bacteria 502
59 Ga0070659_100072004 3300005366 Bacteria 2750
60 Ga0070659_100302682 3300005366 Bacteria 1334
61 Ga0070659_100468549 3300005366 Bacteria 1071
62 Ga0070667_100117700 3300005367 Bacteria 2308
63 Ga0070667_100195680 3300005367 Bacteria 1792
64 Ga0070667_101143989 3300005367 Bacteria 728
65 Ga0070667_101983494 3300005367 Bacteria 548
66 Ga0070714_102502905 3300005435 Bacteria 501
67 Ga0070663_100016842 3300005455 Bacteria 4755
68 Ga0070663_100427518 3300005455 Bacteria 1087
69 Ga0070663_100865235 3300005455 Bacteria 779
70 Ga0070678_100308216 3300005456 Bacteria 1348
71 Ga0070681_10020569 3300005458 Bacteria 6613
72 Ga0070681_10084634 3300005458 Bacteria 3124
73 Ga0070681_10093481 3300005458 Bacteria 2956
74 Ga0070681_10492030 3300005458 Bacteria 1139
75 Ga0068867_100067106 3300005459 Bacteria 2673
76 Ga0068867_100104018 3300005459 Bacteria 2172
77 Ga0068867_101142303 3300005459 Bacteria 713
78 Ga0070679_100001044 3300005530 Bacteria 24138
79 Ga0070679_100011298 3300005530 Bacteria 8514
80 Ga0070679_100034114 3300005530 Bacteria 5042
81 Ga0070679_100046740 3300005530 Bacteria 4315
82 Ga0070679_100129146 3300005530 Bacteria 2508
83 Ga0070679_100137462 3300005530 Bacteria 2425
84 Ga0070679_100482068 3300005530 Bacteria 1184
85 Ga0070679_100534169 3300005530 Bacteria 1116
86 Ga0070679_100549639 3300005530 Bacteria 1098
87 Ga0070684_100991553 3300005535 Unclassified 788
88 Ga0068853_100008616 3300005539 Bacteria 8201
89 Ga0068853_100114586 3300005539 Bacteria 2398
90 Ga0068853_100144933 3300005539 Bacteria 2134
91 Ga0068853_100185560 3300005539 Bacteria 1888
92 Ga0068853_100235363 3300005539 Bacteria 1677
93 Ga0068853_100386049 3300005539 Bacteria 1308
94 Ga0068853_100493837 3300005539 Bacteria 1155
95 Ga0068853_100705481 3300005539 Bacteria 963
96 Ga0068853_101460258 3300005539 Bacteria 662
97 Ga0068853_101536752 3300005539 Bacteria 645
98 Ga0070686_100230747 3300005544 Bacteria 1343
99 Ga0070686_100621579 3300005544 Bacteria 853
100 Ga0070693_100151549 3300005547 Bacteria 1469
101 Ga0070665_100437324 3300005548 Bacteria 1317
102 Ga0068855_100008220 3300005563 Bacteria 12614
103 Ga0068855_100008491 3300005563 Bacteria 12417
104 Ga0068855_100011897 3300005563 Bacteria 10520
105 Ga0068855_100070196 3300005563 Bacteria 4076
106 Ga0068855_100251350 3300005563 Bacteria 1972
107 Ga0068855_100476673 3300005563 Bacteria 1359
108 Ga0068855_100503443 3300005563 Bacteria 1316
109 Ga0068855_100625865 3300005563 Bacteria 1158
110 Ga0070664_102358298 3300005564 Bacteria 505
111 Ga0068857_100183117 3300005577 Bacteria 1906
112 Ga0068854_100439089 3300005578 Bacteria 1088
113 Ga0068854_100586707 3300005578 Bacteria 950
114 Ga0068856_100201186 3300005614 Bacteria 2006
115 Ga0068856_101326428 3300005614 Bacteria 735
116 Ga0070702_101196970 3300005615 Unclassified 612
117 Ga0068852_100022706 3300005616 Bacteria 5037
118 Ga0068852_100257682 3300005616 Unclassified 1674
119 Ga0068852_100307224 3300005616 Bacteria 1537
120 Ga0068852_100364170 3300005616 Bacteria 1415
121 Ga0068852_100393876 3300005616 Bacteria 1361
122 Ga0068859_100001558 3300005617 Bacteria 23386
123 Ga0068859_100362845 3300005617 Bacteria 1544
124 Ga0068859_101699566 3300005617 Bacteria 697
125 Ga0068859_101955701 3300005617 Bacteria 647
126 Ga0068864_100015801 3300005618 Bacteria 6279
127 Ga0068864_100191452 3300005618 Bacteria 1875
128 Ga0068861_100062105 3300005719 Bacteria 2869
129 Ga0068863_100361854 3300005841 Bacteria 1414
130 Ga0068863_101345720 3300005841 Bacteria 721
131 Ga0068863_101404366 3300005841 Bacteria 706
132 Ga0068863_101899934 3300005841 Bacteria 605
133 Ga0068860_100002053 3300005843 Bacteria 21203
134 Ga0068860_100027928 3300005843 Bacteria 5433
135 Ga0068860_100077442 3300005843 Bacteria 3162
136 Ga0068862_100003587 3300005844 Bacteria 13289
137 Ga0068862_100228032 3300005844 Bacteria 1689
138 Ga0081539_10001245 3300005985 Bacteria 45262
139 Ga0081539_10249490 3300005985 Bacteria 789
140 Ga0075366_10130876 3300006195 Bacteria 1514
141 Ga0097621_100000250 3300006237 Bacteria 36249
142 Ga0097621_100019616 3300006237 Bacteria 5194
143 Ga0097621_100077476 3300006237 Bacteria 2760
144 Ga0068871_100003780 3300006358 Bacteria 10422
145 Ga0068871_100004139 3300006358 Bacteria 10033
146 Ga0068871_100661141 3300006358 Bacteria 955
147 Ga0068871_101392992 3300006358 Unclassified 661
148 Ga0097620_100001558 3300006931 Bacteria 23386
149 Ga0097620_100362845 3300006931 Bacteria 1544
150 Ga0097620_101699265 3300006931 Bacteria 697
151 Ga0097620_101956555 3300006931 Bacteria 647
152 Ga0105241_10140036 3300009174 Bacteria 1969
153 Ga0105241_10979739 3300009174 Bacteria 790
154 Ga0105242_10117749 3300009176 Bacteria 2275
155 Ga0105242_12949004 3300009176 Bacteria 526
156 Ga0105242_13173475 3300009176 Unclassified 510
157 Ga0105248_10919358 3300009177 Unclassified 988
158 Ga0105237_10003332 3300009545 Bacteria 19129
159 Ga0105237_10080859 3300009545 Bacteria 3240
160 Ga0105249_10026481 3300009553 Bacteria 5226
161 Ga0105249_10093115 3300009553 Bacteria 2822
162 Ga0105239_10003986 3300010375 Bacteria 17885
163 Ga0105239_10243129 3300010375 Bacteria 2020
164 Ga0105239_11446496 3300010375 Bacteria 794
165 Ga0157373_10007183 3300013100 Bacteria 8310
166 Ga0157373_10009227 3300013100 Bacteria 7293
167 Ga0157373_10064063 3300013100 Unclassified 2602
168 Ga0157373_10223547 3300013100 Bacteria 1328
169 Ga0157373_10248410 3300013100 Bacteria 1258
170 Ga0157373_10249359 3300013100 Bacteria 1256
171 Ga0157373_10290249 3300013100 Bacteria 1160
172 Ga0157371_10000451 3300013102 Bacteria 50405
173 Ga0157371_10001053 3300013102 Bacteria 30233
174 Ga0157371_10003101 3300013102 Bacteria 15388
175 Ga0157371_10031829 3300013102 Unclassified 3798
176 Ga0157371_10047760 3300013102 Bacteria 3043
177 Ga0157371_10049610 3300013102 Bacteria 2981
178 Ga0157371_10153194 3300013102 Bacteria 1644
179 Ga0157371_10217775 3300013102 Bacteria 1371
180 Ga0157371_10226116 3300013102 Bacteria 1344
181 Ga0157371_10392276 3300013102 Bacteria 1015
182 Ga0157371_10542581 3300013102 Bacteria 861
183 Ga0157371_10650882 3300013102 Unclassified 786
184 Ga0157370_10000549 3300013104 Bacteria 46792
185 Ga0157370_10003429 3300013104 Bacteria 18615
186 Ga0157370_10004119 3300013104 Bacteria 16851
187 Ga0157370_10121307 3300013104 Bacteria 2440
188 Ga0157370_10142381 3300013104 Bacteria 2234
189 Ga0157370_10150959 3300013104 Bacteria 2162
190 Ga0157370_10302640 3300013104 Bacteria 1476
191 Ga0157370_10887310 3300013104 Bacteria 809
192 Ga0157370_11230221 3300013104 Bacteria 675
193 Ga0157370_11481585 3300013104 Bacteria 610
194 Ga0157369_10048410 3300013105 Bacteria 4613
195 Ga0157369_10049281 3300013105 Bacteria 4567
196 Ga0157369_10083466 3300013105 Bacteria 3417
197 Ga0157369_10132366 3300013105 Bacteria 2642
198 Ga0157369_10143004 3300013105 Bacteria 2530
199 Ga0157374_10268775 3300013296 Bacteria 1681
200 Ga0157374_12193434 3300013296 Unclassified 579
201 Ga0157378_10012950 3300013297 Bacteria 7296
202 Ga0157378_10239773 3300013297 Bacteria 1732
203 Ga0157378_10281285 3300013297 Unclassified 1604
204 Ga0157378_10300764 3300013297 Bacteria 1553
205 Ga0157378_10565551 3300013297 Bacteria 1144
206 Ga0157378_10928735 3300013297 Bacteria 902
207 Ga0163162_10002870 3300013306 Bacteria 16405
208 Ga0163162_10007751 3300013306 Bacteria 10460
209 Ga0163162_10014865 3300013306 Bacteria 7601
210 Ga0163162_10132577 3300013306 Bacteria 2601
211 Ga0163162_10370232 3300013306 Bacteria 1566
212 Ga0163162_10470431 3300013306 Unclassified 1388
213 Ga0157372_10010677 3300013307 Bacteria 9770
214 Ga0157372_10027246 3300013307 Bacteria 6221
215 Ga0157372_10051139 3300013307 Bacteria 4597
216 Ga0157372_10105154 3300013307 Bacteria 3229
217 Ga0157372_10131611 3300013307 Bacteria 2878
218 Ga0157372_10140734 3300013307 Bacteria 2779
219 Ga0157372_10166996 3300013307 Bacteria 2545
220 Ga0157372_10198441 3300013307 Bacteria 2324
221 Ga0157372_10363543 3300013307 Bacteria 1686
222 Ga0157372_10598131 3300013307 Bacteria 1286
223 Ga0157372_10630374 3300013307 Bacteria 1249
224 Ga0157372_10756088 3300013307 Bacteria 1130
225 Ga0157372_11375995 3300013307 Bacteria 814
226 Ga0157375_10000483 3300013308 Bacteria 36292
227 Ga0157375_10299587 3300013308 Bacteria 1771
228 Ga0163163_10000668 3300014325 Bacteria 29354
229 Ga0157377_10267849 3300014745 Bacteria 1114
230 Ga0157379_10142140 3300014968 Bacteria 2163
231 Ga0157379_11631384 3300014968 Unclassified 630
232 Ga0157376_10000353 3300014969 Bacteria 30588
233 Ga0157376_12613769 3300014969 Unclassified 545
234 Ga0163161_10001881 3300017792 Bacteria 15314
235 Ga0163161_10049472 3300017792 Bacteria 3038
236 Ga0163161_10120123 3300017792 Bacteria 1974
237 Ga0163161_10268984 3300017792 Bacteria 1333
238 Ga0206350_10589836 3300020080 Bacteria 3426
239 Ga0207656_10202129 3300025321 Bacteria 960
240 Ga0207656_10291359 3300025321 Bacteria 807
241 Ga0207642_10275819 3300025899 Unclassified 965
242 Ga0207680_10193521 3300025903 Bacteria 1382
243 Ga0207647_10032880 3300025904 Bacteria 3327
244 Ga0207647_10117455 3300025904 Bacteria 1570
245 Ga0207645_10156648 3300025907 Bacteria 1488
246 Ga0207643_10760699 3300025908 Bacteria 627
247 Ga0207705_10023272 3300025909 Bacteria 4420
248 Ga0207705_10046428 3300025909 Bacteria 3121
249 Ga0207705_10093812 3300025909 Bacteria 2201
250 Ga0207705_10119874 3300025909 Bacteria 1951
251 Ga0207705_10144084 3300025909 Bacteria 1781
252 Ga0207705_10144363 3300025909 Unclassified 1779
253 Ga0207705_10484356 3300025909 Bacteria 960
254 Ga0207654_10568464 3300025911 Bacteria 807
255 Ga0207707_10218551 3300025912 Bacteria 1659
256 Ga0207707_10412698 3300025912 Bacteria 1158
257 Ga0207707_11355659 3300025912 Bacteria 569
258 Ga0207695_10107232 3300025913 Bacteria 2779
259 Ga0207671_10017572 3300025914 Bacteria 5508
260 Ga0207671_10800129 3300025914 Bacteria 748
261 Ga0207660_10015871 3300025917 Unclassified 4978
262 Ga0207660_10056201 3300025917 Bacteria 2815
263 Ga0207660_10129297 3300025917 Bacteria 1921
264 Ga0207660_10532828 3300025917 Bacteria 954
265 Ga0207660_10690587 3300025917 Bacteria 833
266 Ga0207657_10012404 3300025919 Bacteria 8422
267 Ga0207657_10033950 3300025919 Bacteria 4594
268 Ga0207657_10107799 3300025919 Bacteria 2304
269 Ga0207657_10129197 3300025919 Bacteria 2072
270 Ga0207657_11476936 3300025919 Unclassified 508
271 Ga0207652_10000051 3300025921 Bacteria 120327
272 Ga0207652_10000791 3300025921 Bacteria 30182
273 Ga0207652_10005441 3300025921 Bacteria 10333
274 Ga0207652_10009408 3300025921 Bacteria 7857
275 Ga0207652_10097909 3300025921 Bacteria 2586
276 Ga0207652_10305990 3300025921 Bacteria 1435
277 Ga0207652_10558647 3300025921 Bacteria 1028
278 Ga0207650_10080474 3300025925 Bacteria 2470
279 Ga0207650_11112603 3300025925 Bacteria 672
280 Ga0207650_11613290 3300025925 Bacteria 550
281 Ga0207659_10490615 3300025926 Bacteria 1039
282 Ga0207644_10012734 3300025931 Bacteria 5592
283 Ga0207644_11194842 3300025931 Bacteria 639
284 Ga0207690_10210687 3300025932 Bacteria 1481
285 Ga0207706_10706452 3300025933 Unclassified 861
286 Ga0207670_11045504 3300025936 Bacteria 688
287 Ga0207670_11816466 3300025936 Bacteria 518
288 Ga0207704_10342063 3300025938 Bacteria 1162
289 Ga0207689_10100667 3300025942 Bacteria 2374
290 Ga0207689_10480446 3300025942 Bacteria 1040
291 Ga0207667_10002789 3300025949 Bacteria 21642
292 Ga0207667_10018668 3300025949 Bacteria 7770
293 Ga0207667_10199838 3300025949 Bacteria 2051
294 Ga0207667_10201613 3300025949 Bacteria 2041
295 Ga0207667_10223946 3300025949 Bacteria 1927
296 Ga0207651_11474147 3300025960 Bacteria 613
297 Ga0207712_10016607 3300025961 Bacteria 4771
298 Ga0207712_10546226 3300025961 Bacteria 996
299 Ga0207640_10871885 3300025981 Bacteria 784
300 Ga0207640_11972690 3300025981 Bacteria 529
301 Ga0207658_10052779 3300025986 Bacteria 3001
302 Ga0207658_10246901 3300025986 Bacteria 1515
303 Ga0207677_10794722 3300026023 Bacteria 847
304 Ga0207677_11647531 3300026023 Bacteria 594
305 Ga0207639_10038312 3300026041 Bacteria 3565
306 Ga0207639_10065293 3300026041 Unclassified 2825
307 Ga0207639_10069707 3300026041 Bacteria 2744
308 Ga0207639_10226490 3300026041 Bacteria 1618
309 Ga0207639_10308146 3300026041 Bacteria 1402
310 Ga0207639_10364201 3300026041 Unclassified 1294
311 Ga0207639_10803691 3300026041 Bacteria 876
312 Ga0207639_11364682 3300026041 Bacteria 665
313 Ga0207678_10096804 3300026067 Bacteria 2522
314 Ga0207678_10374528 3300026067 Bacteria 1230
315 Ga0207678_10783362 3300026067 Unclassified 841
316 Ga0207702_10015165 3300026078 Bacteria 6389
317 Ga0207702_10413556 3300026078 Unclassified 1303
318 Ga0207702_10859840 3300026078 Bacteria 898
319 Ga0207641_10114220 3300026088 Bacteria 2399
320 Ga0207641_10119400 3300026088 Bacteria 2350
321 Ga0207641_10569841 3300026088 Bacteria 1106
322 Ga0207641_11839181 3300026088 Bacteria 607
323 Ga0207648_10077330 3300026089 Bacteria 2901
324 Ga0207648_10110979 3300026089 Bacteria 2408
325 Ga0207648_10937155 3300026089 Bacteria 810
326 Ga0207676_10069566 3300026095 Bacteria 2819
327 Ga0207676_11241910 3300026095 Bacteria 739
328 Ga0207674_10088524 3300026116 Bacteria 3089
329 Ga0207674_10452966 3300026116 Bacteria 1240
330 Ga0207675_100164353 3300026118 Bacteria 2119
331 Ga0207683_10042382 3300026121 Unclassified 3975
332 Ga0207683_10495978 3300026121 Unclassified 1128
333 Ga0207698_10137279 3300026142 Bacteria 2100
334 Ga0207698_10721771 3300026142 Bacteria 993
335 Ga0207698_11410102 3300026142 Unclassified 712
336 Ga0268266_10503768 3300028379 Bacteria 1156
337 Ga0268265_10007380 3300028380 Bacteria 7423
338 Ga0268265_10983431 3300028380 Bacteria 833
339 Ga0268264_10011948 3300028381 Bacteria 7150
340 Ga0268264_10019642 3300028381 Bacteria 5520
341 Ga0268264_10330409 3300028381 Bacteria 1445
342 Ga0265327_10000099 3300031251 Bacteria 190474
343 Ga0265327_10175332 3300031251 Bacteria 983
344 Ga0307414_10032414 3300032004 Bacteria 3440
345 Ga0395899_0001331 3300037312 Bacteria 21200
346 Ga0395899_0035366 3300037312 Bacteria 3750
347 Ga0395899_0046152 3300037312 Bacteria 3245
348 Ga0395899_0047724 3300037312 Bacteria 3187
349 Ga0395899_0056147 3300037312 Unclassified 2910
350 Ga0395899_0519099 3300037312 Bacteria 770
351 Ga0395900_0003358 3300037418 Bacteria 17293
352 Ga0395900_0003696 3300037418 Bacteria 16441
353 Ga0395900_0010950 3300037418 Bacteria 9275
354 Ga0395900_0033454 3300037418 Bacteria 5290
355 Ga0395900_0295502 3300037418 Bacteria 1607
356 Ga0395900_0333533 3300037418 Bacteria 1494
357 Ga0395900_0513659 3300037418 Bacteria 1147
358 Ga0395900_0595051 3300037418 Bacteria 1047
359 Ga0395900_1147443 3300037418 Bacteria 693
360 Ga0395898_0001339 3300037466 Bacteria 35580
361 Ga0395898_0001697 3300037466 Bacteria 29404
362 Ga0395898_0008641 3300037466 Bacteria 10744
363 Ga0395898_0031983 3300037466 Bacteria 5252
364 Ga0395898_0035964 3300037466 Bacteria 4922
365 Ga0395898_0036325 3300037466 Bacteria 4892
366 Ga0395898_0038531 3300037466 Bacteria 4736
367 Ga0395898_0102916 3300037466 Bacteria 2740
368 Ga0395898_0305985 3300037466 Unclassified 1516
369 Ga0395898_0812487 3300037466 Bacteria 875
370 Ga0395905_0019516 3300037471 Bacteria 6425
371 Ga0395905_0127838 3300037471 Bacteria 2390
372 Ga0395905_0458661 3300037471 Bacteria 1173
373 Ga0395901_0001525 3300038443 Bacteria 24028
374 Ga0395901_0084169 3300038443 Bacteria 3324
375 Ga0395901_0091319 3300038443 Bacteria 3187
376 Ga0395901_0116538 3300038443 Bacteria 2806
377 Ga0395901_0239594 3300038443 Bacteria 1892
378 Ga0395901_0691973 3300038443 Bacteria 1018
379 Ga0395901_1674097 3300038443 Bacteria 588
380 Ga0451793_1496773 3300041452 Bacteria 509
381 Ga0451839_1310818 3300041496 Bacteria 569
382 Ga0466967_0567976 3300045976 Bacteria 1117
383 Ga0495672_0084276 3300047320 Bacteria 1763
384 Ga0496106_0395336 3300048909 Bacteria 1111
385 Ga0496109_1502204 3300048912 Unclassified 609
386 Ga0496115_0000638 3300048918 Bacteria 26337
387 Ga0501032_0130724 3300049569 Bacteria 1657
388 Ga0501033_0066473 3300049570 Unclassified 2651
389 Ga0501033_0134336 3300049570 Bacteria 1791
390 Ga0501034_0098969 3300049571 Bacteria 2911
391 Ga0501034_0240634 3300049571 Bacteria 1756
392 Ga0501034_1348870 3300049571 Bacteria 589
393 Ga0501037_0311916 3300049573 Unclassified 1090
394 Ga0501047_0449721 3300049581 Bacteria 1118
395 Ga0501070_0626110 3300049586 Bacteria 856
396 Ga0501080_0763460 3300049742 Bacteria 850
397 Ga0501035_0027980 3300049822 Bacteria 5150
398 Ga0501035_0094815 3300049822 Bacteria 2624
399 Ga0501035_0570945 3300049822 Unclassified 925
400 Ga0501044_0084805 3300049823 Bacteria 3201
401 Ga0500644_0001543 3300053088 Bacteria 6051
402 Ga0500562_000015 3300053108 Bacteria 143120
403 Ga0500568_0058795 3300053139 Bacteria 1493
404 Ga0500616_0071051 3300053153 Unclassified 1774
405 Ga0500622_0002217 3300053156 Bacteria 14324
406 Ga0500645_056732 3300053730 Unclassified 1136
407 Ga0500661_011162 3300055283 Unclassified 1628
408 2819589933 2818991444 Bacteria 6968812
409 2914759760 2914759650 Bacteria 4701441
410 2929160203 2929154850 Bacteria 6753285
411 Ga0157371_10000662
412 JGI24740J21852_10013887
413 JGI25406J46586_10005674
414 JGI25406J46586_10198956
415 rootH1_10070738
416 rootH2_10012131
417 rootH2_10014527
418 rootH2_10041320
419 rootL2_10276175
420 rootH1_10062208
421 Ga0065714_10078610
422 Ga0065714_10428002
423 Ga0070658_10012727
424 Ga0070658_10027448
425 Ga0070658_10058682
426 Ga0070658_10069502
427 Ga0070658_10162438
428 Ga0070658_10319208
429 Ga0070658_10463435
430 Ga0070658_11333244
431 Ga0070676_10168413
432 Ga0070683_100330554
433 Ga0070683_101196545
434 Ga0070683_101816925
435 Ga0070683_101819705
436 Ga0070690_100051879
437 Ga0070670_100227291
438 Ga0070670_100359381
439 Ga0068869_100243956
440 Ga0068869_100539871
441 Ga0068869_101187212
442 Ga0068869_101580475
443 Ga0070680_100002379
444 Ga0070680_100014825
445 Ga0070680_100074822
446 Ga0070680_100127590
447 Ga0070680_100739824
448 Ga0070680_100915712
449 Ga0070682_100183314
450 Ga0068868_101925138
451 Ga0070660_100019225
452 Ga0070660_100023271
453 Ga0070660_100118692
454 Ga0070660_100150527
455 Ga0070660_100166678
456 Ga0070660_100185621
457 Ga0070660_101577151
458 Ga0070691_10251012
459 Ga0070692_10309140
460 Ga0070668_100766354
461 Ga0070668_102150224
462 Ga0070675_101071574
463 Ga0070671_100000785
464 Ga0070671_100138693
465 Ga0070674_100380461
466 Ga0070673_101185457
467 Ga0070673_102328812
468 Ga0070688_101803260
469 Ga0070659_100072004
470 Ga0070659_100302682
471 Ga0070659_100468549
472 Ga0070667_100117700
473 Ga0070667_100195680
474 Ga0070667_101143989
475 Ga0070667_101983494
476 Ga0070714_102502905
477 Ga0070663_100016842
478 Ga0070663_100427518
479 Ga0070663_100865235
480 Ga0070678_100308216
481 Ga0070681_10020569
482 Ga0070681_10084634
483 Ga0070681_10093481
484 Ga0070681_10492030
485 Ga0068867_100067106
486 Ga0068867_100104018
487 Ga0068867_101142303
488 Ga0070679_100001044
489 Ga0070679_100011298
490 Ga0070679_100034114
491 Ga0070679_100046740
492 Ga0070679_100129146
493 Ga0070679_100137462
494 Ga0070679_100482068
495 Ga0070679_100534169
496 Ga0070679_100549639
497 Ga0070684_100991553
498 Ga0068853_100008616
499 Ga0068853_100114586
500 Ga0068853_100144933
501 Ga0068853_100185560
502 Ga0068853_100235363
503 Ga0068853_100386049
504 Ga0068853_100493837
505 Ga0068853_100705481
506 Ga0068853_101460258
507 Ga0068853_101536752
508 Ga0070686_100230747
509 Ga0070686_100621579
510 Ga0070693_100151549
511 Ga0070665_100437324
512 Ga0068855_100008220
513 Ga0068855_100008491
514 Ga0068855_100011897
515 Ga0068855_100070196
516 Ga0068855_100251350
517 Ga0068855_100476673
518 Ga0068855_100503443
519 Ga0068855_100625865
520 Ga0070664_102358298
521 Ga0068857_100183117
522 Ga0068854_100439089
523 Ga0068854_100586707
524 Ga0068856_100201186
525 Ga0068856_101326428
526 Ga0070702_101196970
527 Ga0068852_100022706
528 Ga0068852_100257682
529 Ga0068852_100307224
530 Ga0068852_100364170
531 Ga0068852_100393876
532 Ga0068859_100001558
533 Ga0068859_100362845
534 Ga0068859_101699566
535 Ga0068859_101955701
536 Ga0068864_100015801
537 Ga0068864_100191452
538 Ga0068861_100062105
539 Ga0068863_100361854
540 Ga0068863_101345720
541 Ga0068863_101404366
542 Ga0068863_101899934
543 Ga0068860_100002053
544 Ga0068860_100027928
545 Ga0068860_100077442
546 Ga0068862_100003587
547 Ga0068862_100228032
548 Ga0081539_10001245
549 Ga0081539_10249490
550 Ga0075366_10130876
551 Ga0097621_100000250
552 Ga0097621_100019616
553 Ga0097621_100077476
554 Ga0068871_100003780
555 Ga0068871_100004139
556 Ga0068871_100661141
557 Ga0068871_101392992
558 Ga0097620_100001558
559 Ga0097620_100362845
560 Ga0097620_101699265
561 Ga0097620_101956555
562 Ga0105241_10140036
563 Ga0105241_10979739
564 Ga0105242_10117749
565 Ga0105242_12949004
566 Ga0105242_13173475
567 Ga0105248_10919358
568 Ga0105237_10003332
569 Ga0105237_10080859
570 Ga0105249_10026481
571 Ga0105249_10093115
572 Ga0105239_10003986
573 Ga0105239_10243129
574 Ga0105239_11446496
575 Ga0157373_10007183
576 Ga0157373_10009227
577 Ga0157373_10064063
578 Ga0157373_10223547
579 Ga0157373_10248410
580 Ga0157373_10249359
581 Ga0157373_10290249
582 Ga0157371_10000451
583 Ga0157371_10001053
584 Ga0157371_10003101
585 Ga0157371_10031829
586 Ga0157371_10047760
587 Ga0157371_10049610
588 Ga0157371_10153194
589 Ga0157371_10217775
590 Ga0157371_10226116
591 Ga0157371_10392276
592 Ga0157371_10542581
593 Ga0157371_10650882
594 Ga0157370_10000549
595 Ga0157370_10003429
596 Ga0157370_10004119
597 Ga0157370_10121307
598 Ga0157370_10142381
599 Ga0157370_10150959
600 Ga0157370_10302640
601 Ga0157370_10887310
602 Ga0157370_11230221
603 Ga0157370_11481585
604 Ga0157369_10048410
605 Ga0157369_10049281
606 Ga0157369_10083466
607 Ga0157369_10132366
608 Ga0157369_10143004
609 Ga0157374_10268775
610 Ga0157374_12193434
611 Ga0157378_10012950
612 Ga0157378_10239773
613 Ga0157378_10281285
614 Ga0157378_10300764
615 Ga0157378_10565551
616 Ga0157378_10928735
617 Ga0163162_10002870
618 Ga0163162_10007751
619 Ga0163162_10014865
620 Ga0163162_10132577
621 Ga0163162_10370232
622 Ga0163162_10470431
623 Ga0157372_10010677
624 Ga0157372_10027246
625 Ga0157372_10051139
626 Ga0157372_10105154
627 Ga0157372_10131611
628 Ga0157372_10140734
629 Ga0157372_10166996
630 Ga0157372_10198441
631 Ga0157372_10363543
632 Ga0157372_10598131
633 Ga0157372_10630374
634 Ga0157372_10756088
635 Ga0157372_11375995
636 Ga0157375_10000483
637 Ga0157375_10299587
638 Ga0163163_10000668
639 Ga0157377_10267849
640 Ga0157379_10142140
641 Ga0157379_11631384
642 Ga0157376_10000353
643 Ga0157376_12613769
644 Ga0163161_10001881
645 Ga0163161_10049472
646 Ga0163161_10120123
647 Ga0163161_10268984
648 Ga0206350_10589836
649 Ga0207656_10202129
650 Ga0207656_10291359
651 Ga0207642_10275819
652 Ga0207680_10193521
653 Ga0207647_10032880
654 Ga0207647_10117455
655 Ga0207645_10156648
656 Ga0207643_10760699
657 Ga0207705_10023272
658 Ga0207705_10046428
659 Ga0207705_10093812
660 Ga0207705_10119874
661 Ga0207705_10144084
662 Ga0207705_10144363
663 Ga0207705_10484356
664 Ga0207654_10568464
665 Ga0207707_10218551
666 Ga0207707_10412698
667 Ga0207707_11355659
668 Ga0207695_10107232
669 Ga0207671_10017572
670 Ga0207671_10800129
671 Ga0207660_10015871
672 Ga0207660_10056201
673 Ga0207660_10129297
674 Ga0207660_10532828
675 Ga0207660_10690587
676 Ga0207657_10012404
677 Ga0207657_10033950
678 Ga0207657_10107799
679 Ga0207657_10129197
680 Ga0207657_11476936
681 Ga0207652_10000051
682 Ga0207652_10000791
683 Ga0207652_10005441
684 Ga0207652_10009408
685 Ga0207652_10097909
686 Ga0207652_10305990
687 Ga0207652_10558647
688 Ga0207650_10080474
689 Ga0207650_11112603
690 Ga0207650_11613290
691 Ga0207659_10490615
692 Ga0207644_10012734
693 Ga0207644_11194842
694 Ga0207690_10210687
695 Ga0207706_10706452
696 Ga0207670_11045504
697 Ga0207670_11816466
698 Ga0207704_10342063
699 Ga0207689_10100667
700 Ga0207689_10480446
701 Ga0207667_10002789
702 Ga0207667_10018668
703 Ga0207667_10199838
704 Ga0207667_10201613
705 Ga0207667_10223946
706 Ga0207651_11474147
707 Ga0207712_10016607
708 Ga0207712_10546226
709 Ga0207640_10871885
710 Ga0207640_11972690
711 Ga0207658_10052779
712 Ga0207658_10246901
713 Ga0207677_10794722
714 Ga0207677_11647531
715 Ga0207639_10038312
716 Ga0207639_10065293
717 Ga0207639_10069707
718 Ga0207639_10226490
719 Ga0207639_10308146
720 Ga0207639_10364201
721 Ga0207639_10803691
722 Ga0207639_11364682
723 Ga0207678_10096804
724 Ga0207678_10374528
725 Ga0207678_10783362
726 Ga0207702_10015165
727 Ga0207702_10413556
728 Ga0207702_10859840
729 Ga0207641_10114220
730 Ga0207641_10119400
731 Ga0207641_10569841
732 Ga0207641_11839181
733 Ga0207648_10077330
734 Ga0207648_10110979
735 Ga0207648_10937155
736 Ga0207676_10069566
737 Ga0207676_11241910
738 Ga0207674_10088524
739 Ga0207674_10452966
740 Ga0207675_100164353
741 Ga0207683_10042382
742 Ga0207683_10495978
743 Ga0207698_10137279
744 Ga0207698_10721771
745 Ga0207698_11410102
746 Ga0268266_10503768
747 Ga0268265_10007380
748 Ga0268265_10983431
749 Ga0268264_10011948
750 Ga0268264_10019642
751 Ga0268264_10330409
752 Ga0265327_10000099
753 Ga0265327_10175332
754 Ga0307414_10032414
755 Ga0395899_0001331
756 Ga0395899_0035366
757 Ga0395899_0046152
758 Ga0395899_0047724
759 Ga0395899_0056147
760 Ga0395899_0519099
761 Ga0395900_0003358
762 Ga0395900_0003696
763 Ga0395900_0010950
764 Ga0395900_0033454
765 Ga0395900_0295502
766 Ga0395900_0333533
767 Ga0395900_0513659
768 Ga0395900_0595051
769 Ga0395900_1147443
770 Ga0395898_0001339
771 Ga0395898_0001697
772 Ga0395898_0008641
773 Ga0395898_0031983
774 Ga0395898_0035964
775 Ga0395898_0036325
776 Ga0395898_0038531
777 Ga0395898_0102916
778 Ga0395898_0305985
779 Ga0395898_0812487
780 Ga0395905_0019516
781 Ga0395905_0127838
782 Ga0395905_0458661
783 Ga0395901_0001525
784 Ga0395901_0084169
785 Ga0395901_0091319
786 Ga0395901_0116538
787 Ga0395901_0239594
788 Ga0395901_0691973
789 Ga0395901_1674097
790 Ga0451793_1496773
791 Ga0451839_1310818
792 Ga0466967_0567976
793 Ga0495672_0084276
794 Ga0496106_0395336
795 Ga0496109_1502204
796 Ga0496115_0000638
797 Ga0501032_0130724
798 Ga0501033_0066473
799 Ga0501033_0134336
800 Ga0501034_0098969
801 Ga0501034_0240634
802 Ga0501034_1348870
803 Ga0501037_0311916
804 Ga0501047_0449721
805 Ga0501070_0626110
806 Ga0501080_0763460
807 Ga0501035_0027980
808 Ga0501035_0094815
809 Ga0501035_0570945
810 Ga0501044_0084805
811 Ga0500644_0001543
812 Ga0500562_000015
813 Ga0500568_0058795
814 Ga0500616_0071051
815 Ga0500622_0002217
816 Ga0500645_056732
817 Ga0500661_011162
818 2819589933
819 2914759760
820 2929160203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11325

DUF3127

Domain of unknown function (DUF3127)

15

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ull-assembly1.cif.gz_A-2 human mitochondrial single-stranded dna binding protein 0.8131 2 96
3klw-assembly1.cif.gz_B crystal structure of primosomal replication protein n from bordetella pertussis. northeast structural genomics consortium target ber132. 0.7929 2 96
1ue7-assembly2.cif.gz_D-3 crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis 0.779 1 96
3klw-assembly1.cif.gz_B crystal structure of primosomal replication protein n from bordetella pertussis. northeast structural genomics consortium target ber132. 0.77 2 96
5odn-assembly1.cif.gz_C salinibacter ruber single-strand binding protein 0.7674 2 96
ID Description Score Start End Superfamily
3ullA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8131 2 96 2.40.50.140
af_A0A368UGE2_620_739_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7866 69 89 3.30.40.10
3e0eA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7766 1 96 2.40.50.140
af_C4J9S9_72_176_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.765 2 100 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7545 2 96 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7C1KJY3-F1-model_v4 DUF3127 domain-containing protein 0.9725 1 96
AF-A0A1G0WRE7-F1-model_v4 DUF3127 domain-containing protein 0.9692 1 101
AF-A0A7C1KJY3-F1-model_v4 DUF3127 domain-containing protein 0.9627 1 96
AF-A0A1G0WRE7-F1-model_v4 DUF3127 domain-containing protein 0.9599 1 101
AF-A0A522FM15-F1-model_v4 DUF3127 domain-containing protein 0.9573 1 102

Map