F437190

General Info

Members Datasets Scaffolds Average Seq Length
410 235 820 160

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100074034|Ga0068853_1000740343
Length 173
Sequence VRTGDILEAMHDQTPVQIAWVTRDLDATEKVLTAVMGAKKWVRMPEVHFGPGTCTHRGRAADFVADISLSYAGETQLELIRPIRGDSIYTDFLDTAGPGLHHVCVEAADVETFDAMVRDAERGGAPVVAQGVMPGGMRFAYVSAADSGVPYLEIAHVPPEIRAFFDYVKQEQQ

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
233 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
234 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
235 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.27
Nodule 0
Rhizoplane 8.78
Rhizosphere 69.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100074034 3300005539 Bacteria 2971
2 CNXas_1000711 3300000545 Bacteria 2167
3 JGI24737J22298_10032169 3300001990 Bacteria 1635
4 JGI24743J22301_10000651 3300001991 Bacteria 4237
5 JGI24738J21930_10041108 3300002075 Bacteria 940
6 JGI24744J21845_10000045 3300002077 Bacteria 14251
7 JGI24742J22300_10001857 3300002244 Bacteria 3361
8 JGI24742J22300_10079924 3300002244 Bacteria 617
9 JGI24751J29686_10016762 3300002459 Bacteria 1512
10 Ga0055540_1003269 3300003792 Bacteria 7925
11 Ga0070676_10059246 3300005328 Bacteria 2271
12 Ga0070690_100116318 3300005330 Bacteria 1790
13 Ga0070690_100622117 3300005330 Bacteria 822
14 Ga0068869_100017466 3300005334 Bacteria 4863
15 Ga0068869_100042036 3300005334 Bacteria 3276
16 Ga0070666_10166769 3300005335 Bacteria 1541
17 Ga0070680_100723169 3300005336 Bacteria 857
18 Ga0070682_100076500 3300005337 Bacteria 2155
19 Ga0068868_100010437 3300005338 Bacteria 6724
20 Ga0068868_100165362 3300005338 Bacteria 1829
21 Ga0070689_100143679 3300005340 Bacteria 1920
22 Ga0070691_10003824 3300005341 Bacteria 6797
23 Ga0070661_100484866 3300005344 Bacteria 988
24 Ga0070692_10177290 3300005345 Bacteria 1233
25 Ga0070668_100187250 3300005347 Bacteria 1694
26 Ga0070675_100026864 3300005354 Bacteria 4621
27 Ga0070671_100003738 3300005355 Bacteria 11950
28 Ga0070671_100560575 3300005355 Bacteria 986
29 Ga0070674_100000313 3300005356 Bacteria 23878
30 Ga0070674_100209623 3300005356 Bacteria 1509
31 Ga0070673_100100375 3300005364 Bacteria 2382
32 Ga0070688_100737694 3300005365 Bacteria 766
33 Ga0070659_100469463 3300005366 Bacteria 1069
34 Ga0070709_10073109 3300005434 Bacteria 2219
35 Ga0070714_100193617 3300005435 Bacteria 1857
36 Ga0070701_10281591 3300005438 Bacteria 1015
37 Ga0070711_100001408 3300005439 Bacteria 13194
38 Ga0070711_100020900 3300005439 Bacteria 4226
39 Ga0070705_100056050 3300005440 Bacteria 2319
40 Ga0070705_100455710 3300005440 Bacteria 961
41 Ga0070700_100034041 3300005441 Bacteria 3073
42 Ga0070694_100016335 3300005444 Bacteria 4672
43 Ga0070663_100062683 3300005455 Bacteria 2681
44 Ga0070663_100182243 3300005455 Bacteria 1630
45 Ga0070678_100000286 3300005456 Bacteria 23425
46 Ga0070678_100081571 3300005456 Bacteria 2452
47 Ga0070662_100022312 3300005457 Bacteria 4332
48 Ga0068867_100008047 3300005459 Bacteria 7451
49 Ga0068867_100319722 3300005459 Bacteria 1285
50 Ga0070685_10245745 3300005466 Bacteria 1183
51 Ga0070685_10853175 3300005466 Bacteria 675
52 Ga0070706_100906801 3300005467 Bacteria 814
53 Ga0070707_100163502 3300005468 Bacteria 2169
54 Ga0068853_100047167 3300005539 Bacteria 3697
55 Ga0068853_100141169 3300005539 Bacteria 2162
56 Ga0070672_100313968 3300005543 Bacteria 1331
57 Ga0070686_100811796 3300005544 Bacteria 755
58 Ga0070686_100881599 3300005544 Bacteria 727
59 Ga0070696_100272866 3300005546 Bacteria 1286
60 Ga0070665_100007256 3300005548 Bacteria 11264
61 Ga0070665_100028131 3300005548 Bacteria 5661
62 Ga0070665_100059516 3300005548 Bacteria 3829
63 Ga0070704_100008834 3300005549 Bacteria 6062
64 Ga0068855_100546156 3300005563 Bacteria 1255
65 Ga0068855_101695092 3300005563 Bacteria 645
66 Ga0068854_100052996 3300005578 Bacteria 2911
67 Ga0068854_100059773 3300005578 Bacteria 2755
68 Ga0068856_100099930 3300005614 Bacteria 2893
69 Ga0070702_100001755 3300005615 Bacteria 9017
70 Ga0070702_100104897 3300005615 Bacteria 1741
71 Ga0070702_100636773 3300005615 Bacteria 804
72 Ga0070702_100873343 3300005615 Bacteria 702
73 Ga0068852_100184730 3300005616 Bacteria 1963
74 Ga0068859_100015509 3300005617 Bacteria 7655
75 Ga0068859_100216025 3300005617 Bacteria 2005
76 Ga0068859_100340012 3300005617 Bacteria 1595
77 Ga0068859_100480897 3300005617 Bacteria 1337
78 Ga0068864_100037500 3300005618 Bacteria 4136
79 Ga0068866_10017198 3300005718 Bacteria 3247
80 Ga0068861_100000265 3300005719 Bacteria 29212
81 Ga0068861_100017362 3300005719 Bacteria 5107
82 Ga0068861_100160094 3300005719 Bacteria 1856
83 Ga0068861_100361191 3300005719 Bacteria 1277
84 Ga0068870_10456639 3300005840 Bacteria 843
85 Ga0068863_100001259 3300005841 Bacteria 25248
86 Ga0068858_100000762 3300005842 Bacteria 33735
87 Ga0068858_100162258 3300005842 Bacteria 2104
88 Ga0068860_100041448 3300005843 Bacteria 4397
89 Ga0068860_100286482 3300005843 Bacteria 1611
90 Ga0068862_100034236 3300005844 Bacteria 4297
91 Ga0068862_100052389 3300005844 Bacteria 3491
92 Ga0068862_100333915 3300005844 Bacteria 1402
93 Ga0081455_10017757 3300005937 Bacteria 6805
94 Ga0075365_10015622 3300006038 Bacteria 4596
95 Ga0075365_10109586 3300006038 Bacteria 1897
96 Ga0075365_10116156 3300006038 Bacteria 1843
97 Ga0075365_10153652 3300006038 Bacteria 1601
98 Ga0075365_10305809 3300006038 Bacteria 1119
99 Ga0075365_10485589 3300006038 Bacteria 873
100 Ga0075365_10518177 3300006038 Bacteria 843
101 Ga0075365_10625603 3300006038 Bacteria 761
102 Ga0075368_10177839 3300006042 Bacteria 896
103 Ga0075363_100011212 3300006048 Bacteria 4286
104 Ga0075363_100011593 3300006048 Bacteria 4226
105 Ga0075363_100012599 3300006048 Bacteria 4080
106 Ga0075363_100028850 3300006048 Bacteria 2859
107 Ga0075363_100034633 3300006048 Bacteria 2637
108 Ga0075363_100124418 3300006048 Bacteria 1442
109 Ga0075363_100127100 3300006048 Bacteria 1428
110 Ga0075363_100287591 3300006048 Bacteria 952
111 Ga0075364_10000578 3300006051 Bacteria 18885
112 Ga0075364_10024971 3300006051 Bacteria 3800
113 Ga0075364_10080537 3300006051 Bacteria 2152
114 Ga0075364_10204850 3300006051 Bacteria 1337
115 Ga0075364_10477712 3300006051 Bacteria 852
116 Ga0070715_10041425 3300006163 Bacteria 1930
117 Ga0070716_100092620 3300006173 Bacteria 1833
118 Ga0070712_100409906 3300006175 Bacteria 1121
119 Ga0075362_10007670 3300006177 Bacteria 4099
120 Ga0075362_10025608 3300006177 Bacteria 2513
121 Ga0075362_10094098 3300006177 Bacteria 1394
122 Ga0075367_10249679 3300006178 Bacteria 1113
123 Ga0075369_10000374 3300006186 Bacteria 13419
124 Ga0075369_10007061 3300006186 Bacteria 4269
125 Ga0075369_10029098 3300006186 Bacteria 2319
126 Ga0075369_10059715 3300006186 Bacteria 1662
127 Ga0075369_10074171 3300006186 Bacteria 1501
128 Ga0075369_10172593 3300006186 Bacteria 993
129 Ga0075369_10187435 3300006186 Bacteria 953
130 Ga0075369_10282425 3300006186 Bacteria 773
131 Ga0075369_10410352 3300006186 Bacteria 639
132 Ga0075366_10251126 3300006195 Bacteria 1079
133 Ga0097621_100119173 3300006237 Bacteria 2237
134 Ga0075370_10002189 3300006353 Bacteria 8975
135 Ga0075370_10020841 3300006353 Bacteria 3587
136 Ga0075370_10075024 3300006353 Bacteria 1939
137 Ga0075370_10075780 3300006353 Bacteria 1929
138 Ga0075370_10282962 3300006353 Bacteria 985
139 Ga0075370_10528139 3300006353 Bacteria 713
140 Ga0068871_100089407 3300006358 Bacteria 2563
141 Ga0068871_100348956 3300006358 Bacteria 1308
142 Ga0075428_100091830 3300006844 Bacteria 3310
143 Ga0075430_100306617 3300006846 Bacteria 1313
144 Ga0068865_100004829 3300006881 Bacteria 8146
145 Ga0097620_100015509 3300006931 Bacteria 7655
146 Ga0097620_100216022 3300006931 Bacteria 2005
147 Ga0097620_100340014 3300006931 Bacteria 1595
148 Ga0097620_100480892 3300006931 Bacteria 1337
149 Ga0099795_10010854 3300007788 Bacteria 2699
150 Ga0105244_10328826 3300009036 Bacteria 705
151 Ga0105240_10813445 3300009093 Bacteria 1011
152 Ga0105245_10000924 3300009098 Bacteria 26664
153 Ga0105245_10911971 3300009098 Bacteria 921
154 Ga0105247_10006056 3300009101 Bacteria 7523
155 Ga0105247_10124639 3300009101 Bacteria 1673
156 Ga0114129_10041366 3300009147 Bacteria 6495
157 Ga0105243_10000904 3300009148 Bacteria 27915
158 Ga0105243_10097297 3300009148 Bacteria 2436
159 Ga0105242_10003759 3300009176 Bacteria 11796
160 Ga0105242_10116469 3300009176 Bacteria 2286
161 Ga0105248_10018160 3300009177 Bacteria 7766
162 Ga0105237_10002602 3300009545 Bacteria 22241
163 Ga0105237_10149010 3300009545 Bacteria 2336
164 Ga0105237_10305475 3300009545 Bacteria 1594
165 Ga0105238_10431437 3300009551 Bacteria 1313
166 Ga0105238_11065897 3300009551 Bacteria 830
167 Ga0105249_10006853 3300009553 Bacteria 9936
168 Ga0105249_10123764 3300009553 Bacteria 2460
169 Ga0105249_10126816 3300009553 Bacteria 2431
170 Ga0105239_10003573 3300010375 Bacteria 19012
171 Ga0105239_10016822 3300010375 Bacteria 8084
172 Ga0105239_10300473 3300010375 Bacteria 1808
173 Ga0105239_10682301 3300010375 Bacteria 1174
174 Ga0105246_10141632 3300011119 Bacteria 1809
175 Ga0157374_10019756 3300013296 Bacteria 5968
176 Ga0157378_10038166 3300013297 Bacteria 4256
177 Ga0157378_10063635 3300013297 Bacteria 3296
178 Ga0163162_10002821 3300013306 Bacteria 16521
179 Ga0163162_10059180 3300013306 Bacteria 3862
180 Ga0163162_10067058 3300013306 Bacteria 3638
181 Ga0163162_10557828 3300013306 Bacteria 1273
182 Ga0163162_11978293 3300013306 Bacteria 668
183 Ga0157372_10014845 3300013307 Bacteria 8340
184 Ga0157375_10029076 3300013308 Bacteria 5192
185 Ga0157380_10007334 3300014326 Bacteria 7829
186 Ga0157380_10351718 3300014326 Bacteria 1379
187 Ga0157377_10062676 3300014745 Bacteria 2128
188 Ga0157377_10264144 3300014745 Bacteria 1121
189 Ga0157379_10011857 3300014968 Bacteria 7616
190 Ga0163161_10000661 3300017792 Bacteria 27527
191 Ga0163161_10115109 3300017792 Bacteria 2015
192 Ga0209673_1025372 3300025273 Bacteria 1972
193 Ga0209051_1004937 3300025303 Bacteria 7978
194 Ga0209051_1063093 3300025303 Bacteria 1155
195 Ga0207696_1047997 3300025711 Bacteria 1229
196 Ga0207692_10002288 3300025898 Bacteria 7349
197 Ga0207642_10002299 3300025899 Bacteria 5953
198 Ga0207710_10017652 3300025900 Bacteria 3027
199 Ga0207710_10048265 3300025900 Bacteria 1905
200 Ga0207688_10004505 3300025901 Bacteria 7588
201 Ga0207688_10008585 3300025901 Bacteria 5561
202 Ga0207688_10351541 3300025901 Bacteria 908
203 Ga0207680_10465883 3300025903 Bacteria 898
204 Ga0207647_10019845 3300025904 Bacteria 4514
205 Ga0207647_10030725 3300025904 Bacteria 3462
206 Ga0207685_10015628 3300025905 Bacteria 2409
207 Ga0207699_10680927 3300025906 Bacteria 752
208 Ga0207645_10045116 3300025907 Bacteria 2818
209 Ga0207654_10100470 3300025911 Bacteria 1781
210 Ga0207671_10004760 3300025914 Bacteria 12811
211 Ga0207693_10000790 3300025915 Bacteria 28276
212 Ga0207693_10004869 3300025915 Bacteria 11292
213 Ga0207693_10326642 3300025915 Bacteria 1201
214 Ga0207663_10004393 3300025916 Bacteria 7000
215 Ga0207649_10838769 3300025920 Bacteria 719
216 Ga0207650_10190458 3300025925 Bacteria 1639
217 Ga0207687_10000563 3300025927 Bacteria 25044
218 Ga0207687_10025441 3300025927 Bacteria 3960
219 Ga0207664_10290743 3300025929 Bacteria 1436
220 Ga0207644_10029395 3300025931 Bacteria 3812
221 Ga0207644_10439230 3300025931 Bacteria 1071
222 Ga0207690_10045390 3300025932 Bacteria 2903
223 Ga0207690_10087029 3300025932 Bacteria 2197
224 Ga0207706_10021577 3300025933 Bacteria 5782
225 Ga0207706_10026046 3300025933 Bacteria 5236
226 Ga0207686_10044376 3300025934 Bacteria 2729
227 Ga0207709_10017290 3300025935 Bacteria 4024
228 Ga0207670_10794485 3300025936 Bacteria 788
229 Ga0207669_10000203 3300025937 Bacteria 27213
230 Ga0207704_10076527 3300025938 Bacteria 2144
231 Ga0207665_10093669 3300025939 Bacteria 2086
232 Ga0207689_10053963 3300025942 Bacteria 3311
233 Ga0207667_10339363 3300025949 Bacteria 1533
234 Ga0207712_10005855 3300025961 Bacteria 7747
235 Ga0207712_10179636 3300025961 Bacteria 1661
236 Ga0207668_10000661 3300025972 Bacteria 21173
237 Ga0207640_10012136 3300025981 Bacteria 4898
238 Ga0207658_10036335 3300025986 Bacteria 3531
239 Ga0207658_10159479 3300025986 Bacteria 1847
240 Ga0207658_10634077 3300025986 Bacteria 962
241 Ga0207677_10030581 3300026023 Bacteria 3439
242 Ga0207677_10077705 3300026023 Bacteria 2368
243 Ga0207703_10020348 3300026035 Bacteria 5188
244 Ga0207703_10073349 3300026035 Bacteria 2832
245 Ga0207639_10008073 3300026041 Bacteria 7197
246 Ga0207678_10006516 3300026067 Bacteria 10354
247 Ga0207678_10060908 3300026067 Bacteria 3246
248 Ga0207678_10167174 3300026067 Bacteria 1878
249 Ga0207708_10003570 3300026075 Bacteria 11474
250 Ga0207708_10133119 3300026075 Bacteria 1945
251 Ga0207648_10019389 3300026089 Bacteria 6139
252 Ga0207648_10081800 3300026089 Bacteria 2816
253 Ga0207676_10088312 3300026095 Bacteria 2538
254 Ga0207675_100002734 3300026118 Bacteria 17365
255 Ga0207675_100013004 3300026118 Bacteria 7769
256 Ga0207675_100213744 3300026118 Bacteria 1856
257 Ga0207675_100349600 3300026118 Bacteria 1449
258 Ga0207683_10000819 3300026121 Bacteria 28484
259 Ga0207683_10018317 3300026121 Bacteria 5974
260 Ga0207698_10063046 3300026142 Bacteria 2898
261 Ga0268266_10005952 3300028379 Bacteria 11275
262 Ga0268266_10015201 3300028379 Bacteria 6610
263 Ga0268266_10096532 3300028379 Bacteria 2598
264 Ga0268265_10012113 3300028380 Bacteria 5839
265 Ga0268265_10047749 3300028380 Bacteria 3210
266 Ga0268264_11001169 3300028381 Bacteria 842
267 Ga0307413_10340149 3300031824 Bacteria 1154
268 Ga0307409_100597961 3300031995 Bacteria 1090
269 Ga0307416_100045720 3300032002 Bacteria 3449
270 Ga0307415_100131658 3300032126 Bacteria 1895
271 Ga0373938_0039594 3300034957 Bacteria 1043
272 Ga0373949_0025543 3300035090 Bacteria 1379
273 Ga0373931_0128133 3300035691 Bacteria 1458
274 Ga0439461_0004842 3300041410 Bacteria 2267
275 Ga0439466_0004524 3300041411 Bacteria 5343
276 Ga0439466_0009093 3300041411 Bacteria 3727
277 Ga0439465_0006013 3300041413 Bacteria 3857
278 Ga0439465_0173242 3300041413 Bacteria 778
279 Ga0451795_0662872 3300041456 Bacteria 896
280 Ga0439431_0206633 3300041997 Bacteria 573
281 Ga0439442_003721 3300042002 Bacteria 3021
282 Ga0439434_0004189 3300042435 Bacteria 4210
283 Ga0466969_0089109 3300044656 Bacteria 1464
284 Ga0466972_0002163 3300044658 Bacteria 9645
285 Ga0466972_0002766 3300044658 Bacteria 8689
286 Ga0466972_0005443 3300044658 Bacteria 6378
287 Ga0466972_0013967 3300044658 Bacteria 4028
288 Ga0466972_0028465 3300044658 Bacteria 2756
289 Ga0466972_0171768 3300044658 Bacteria 1017
290 Ga0466965_0000568 3300044683 Bacteria 13385
291 Ga0466965_0004981 3300044683 Bacteria 5948
292 Ga0466965_0037021 3300044683 Bacteria 2395
293 Ga0466965_0056488 3300044683 Bacteria 1955
294 Ga0466966_0013817 3300044684 Bacteria 5343
295 Ga0466961_0011289 3300044693 Bacteria 5712
296 Ga0466964_0011900 3300044706 Bacteria 3288
297 Ga0466964_0166228 3300044706 Bacteria 1035
298 Ga0466971_0003229 3300044719 Bacteria 6957
299 Ga0466971_0186564 3300044719 Bacteria 976
300 Ga0466968_0066692 3300044735 Bacteria 1559
301 Ga0466968_0074811 3300044735 Bacteria 1479
302 Ga0466968_0117444 3300044735 Bacteria 1201
303 Ga0466970_0008901 3300044765 Bacteria 5061
304 Ga0466970_0027969 3300044765 Bacteria 2961
305 Ga0466970_0115031 3300044765 Bacteria 1470
306 Ga0466957_0019569 3300044842 Bacteria 3983
307 Ga0466957_0028067 3300044842 Bacteria 3349
308 Ga0466957_0052730 3300044842 Bacteria 2477
309 Ga0466960_0000012 3300044901 Bacteria 60091
310 Ga0466959_0015127 3300045049 Bacteria 5619
311 Ga0466959_0110171 3300045049 Bacteria 1965
312 Ga0466958_0013732 3300045836 Bacteria 4615
313 Ga0466967_0273830 3300045976 Bacteria 1618
314 Ga0466967_0705869 3300045976 Bacteria 999
315 Ga0495638_0102070 3300046460 Bacteria 1714
316 Ga0495596_0194760 3300046500 Bacteria 788
317 Ga0495672_0160352 3300047320 Bacteria 1157
318 Ga0495686_0002396 3300047472 Bacteria 17811
319 Ga0496100_0054423 3300048903 Bacteria 2610
320 Ga0496100_0268035 3300048903 Bacteria 1269
321 Ga0496101_0006586 3300048904 Bacteria 7483
322 Ga0496101_0442190 3300048904 Bacteria 1026
323 Ga0496102_0001886 3300048905 Bacteria 18065
324 Ga0496102_0007365 3300048905 Bacteria 9402
325 Ga0496102_0119868 3300048905 Bacteria 2457
326 Ga0496102_0576022 3300048905 Bacteria 1048
327 Ga0496103_0013002 3300048906 Bacteria 4936
328 Ga0496104_0059798 3300048907 Bacteria 3608
329 Ga0496104_0293181 3300048907 Bacteria 1539
330 Ga0496104_0589654 3300048907 Bacteria 1022
331 Ga0496105_0009953 3300048908 Bacteria 7459
332 Ga0496105_0055491 3300048908 Bacteria 3271
333 Ga0496106_0008940 3300048909 Bacteria 7403
334 Ga0496106_0051213 3300048909 Bacteria 3113
335 Ga0496106_0147398 3300048909 Bacteria 1855
336 Ga0496107_0010912 3300048910 Bacteria 6319
337 Ga0496107_0197433 3300048910 Bacteria 1495
338 Ga0496108_0000268 3300048911 Bacteria 44819
339 Ga0496108_0900841 3300048911 Bacteria 759
340 Ga0496109_0047289 3300048912 Bacteria 3912
341 Ga0496109_1008863 3300048912 Bacteria 770
342 Ga0496110_0024821 3300048913 Bacteria 5115
343 Ga0496111_0247056 3300048914 Bacteria 1325
344 Ga0496111_0275873 3300048914 Bacteria 1247
345 Ga0496112_0038609 3300048915 Bacteria 4663
346 Ga0496112_0134180 3300048915 Bacteria 2446
347 Ga0496112_0202821 3300048915 Bacteria 1942
348 Ga0496112_0338614 3300048915 Bacteria 1448
349 Ga0496113_0015875 3300048916 Bacteria 5189
350 Ga0496113_0236333 3300048916 Bacteria 1458
351 Ga0496114_0051527 3300048917 Bacteria 3427
352 Ga0496115_0018274 3300048918 Bacteria 5379
353 Ga0496115_0923264 3300048918 Bacteria 672
354 Ga0496122_0056020 3300048925 Bacteria 2943
355 Ga0496123_0027928 3300048926 Bacteria 4189
356 Ga0496125_0369637 3300048928 Bacteria 849
357 Ga0496126_0058924 3300048929 Bacteria 3460
358 Ga0496126_0069080 3300048929 Bacteria 3152
359 Ga0501034_0111701 3300049571 Bacteria 2723
360 Ga0501036_0007552 3300049572 Bacteria 8870
361 Ga0501038_0001720 3300049574 Bacteria 20347
362 Ga0501039_0001136 3300049575 Bacteria 19618
363 Ga0501043_0003707 3300049579 Bacteria 12555
364 Ga0501068_0700803 3300049584 Bacteria 662
365 Ga0501070_0000247 3300049586 Bacteria 50837
366 Ga0501070_0108800 3300049586 Bacteria 2290
367 Ga0501073_0238872 3300049589 Bacteria 1255
368 Ga0501077_0697541 3300049593 Bacteria 652
369 Ga0501044_0002179 3300049823 Bacteria 22462
370 nmdc:mga03n38_142594_c1 3300050490 Bacteria 1198
371 nmdc:mga03n38_219875_c1 3300050490 Bacteria 991
372 nmdc:mga03n38_283359_c1 3300050490 Bacteria 885
373 nmdc:mga03n38_286821_c1 3300050490 Bacteria 880
374 nmdc:mga03n38_38972_c1 3300050490 Bacteria 2059
375 nmdc:mga03n38_40864_c1 3300050490 Bacteria 2018
376 nmdc:mga03n38_766776_c1 3300050490 Bacteria 560
377 nmdc:mga03n38_90261_c1 3300050490 Bacteria 1457
378 nmdc:mga00v17_115085_c1 3300050491 Bacteria 1709
379 nmdc:mga00v17_235089_c1 3300050491 Bacteria 1188
380 nmdc:mga00v17_41607_c1 3300050491 Bacteria 2760
381 nmdc:mga00v17_599173_c1 3300050491 Bacteria 710
382 nmdc:mga0yw44_19044_c1 3300050492 Bacteria 3776
383 nmdc:mga0yw44_230535_c1 3300050492 Bacteria 1229
384 nmdc:mga0yw44_553843_c1 3300050492 Bacteria 781
385 nmdc:mga06z11_60287_c1 3300050494 Bacteria 1975
386 nmdc:mga04h51_519944_c1 3300050495 Bacteria 510
387 nmdc:mga07m45_12776_c1 3300050496 Bacteria 4441
388 nmdc:mga07m45_22811_c1 3300050496 Bacteria 3419
389 nmdc:mga07m45_80220_c1 3300050496 Bacteria 1863
390 nmdc:mga05p37_540611_c1 3300050507 Bacteria 1328
391 nmdc:mga0qj67_295392_c1 3300050509 Bacteria 1313
392 nmdc:mga06r32_92150_c1 3300050510 Bacteria 2962
393 nmdc:mga0sz30_122780_c1 3300050516 Bacteria 1142
394 nmdc:mga0sz30_15221_c1 3300050516 Bacteria 3039
395 nmdc:mga0sz30_16967_c1 3300050516 Bacteria 1897
396 nmdc:mga0sz30_7230_c1 3300050516 Bacteria 920
397 Ga0500650_0147115 3300053098 Bacteria 1091
398 Ga0500642_0150328 3300053130 Bacteria 1093
399 Ga0500559_0138587 3300053136 Bacteria 1139
400 Ga0500568_0118309 3300053139 Bacteria 988
401 Ga0500616_0083699 3300053153 Bacteria 1597
402 Ga0500627_0008955 3300053158 Bacteria 3582
403 Ga0500634_0188990 3300053161 Bacteria 918
404 Ga0500645_000006 3300053730 Bacteria 276677
405 Ga0500645_055199 3300053730 Bacteria 1154
406 Ga0466962_0009663 3300061719 Bacteria 4625
407 2644634682 2643221715 Bacteria 6671032
408 2738704261 2738541274 Bacteria 6909446
409 2739331255 2738543028 Bacteria 6917070
410 2902804527 2902799365 Bacteria 5419524
411 Ga0068853_100074034
412 CNXas_1000711
413 JGI24737J22298_10032169
414 JGI24743J22301_10000651
415 JGI24738J21930_10041108
416 JGI24744J21845_10000045
417 JGI24742J22300_10001857
418 JGI24742J22300_10079924
419 JGI24751J29686_10016762
420 Ga0055540_1003269
421 Ga0070676_10059246
422 Ga0070690_100116318
423 Ga0070690_100622117
424 Ga0068869_100017466
425 Ga0068869_100042036
426 Ga0070666_10166769
427 Ga0070680_100723169
428 Ga0070682_100076500
429 Ga0068868_100010437
430 Ga0068868_100165362
431 Ga0070689_100143679
432 Ga0070691_10003824
433 Ga0070661_100484866
434 Ga0070692_10177290
435 Ga0070668_100187250
436 Ga0070675_100026864
437 Ga0070671_100003738
438 Ga0070671_100560575
439 Ga0070674_100000313
440 Ga0070674_100209623
441 Ga0070673_100100375
442 Ga0070688_100737694
443 Ga0070659_100469463
444 Ga0070709_10073109
445 Ga0070714_100193617
446 Ga0070701_10281591
447 Ga0070711_100001408
448 Ga0070711_100020900
449 Ga0070705_100056050
450 Ga0070705_100455710
451 Ga0070700_100034041
452 Ga0070694_100016335
453 Ga0070663_100062683
454 Ga0070663_100182243
455 Ga0070678_100000286
456 Ga0070678_100081571
457 Ga0070662_100022312
458 Ga0068867_100008047
459 Ga0068867_100319722
460 Ga0070685_10245745
461 Ga0070685_10853175
462 Ga0070706_100906801
463 Ga0070707_100163502
464 Ga0068853_100047167
465 Ga0068853_100141169
466 Ga0070672_100313968
467 Ga0070686_100811796
468 Ga0070686_100881599
469 Ga0070696_100272866
470 Ga0070665_100007256
471 Ga0070665_100028131
472 Ga0070665_100059516
473 Ga0070704_100008834
474 Ga0068855_100546156
475 Ga0068855_101695092
476 Ga0068854_100052996
477 Ga0068854_100059773
478 Ga0068856_100099930
479 Ga0070702_100001755
480 Ga0070702_100104897
481 Ga0070702_100636773
482 Ga0070702_100873343
483 Ga0068852_100184730
484 Ga0068859_100015509
485 Ga0068859_100216025
486 Ga0068859_100340012
487 Ga0068859_100480897
488 Ga0068864_100037500
489 Ga0068866_10017198
490 Ga0068861_100000265
491 Ga0068861_100017362
492 Ga0068861_100160094
493 Ga0068861_100361191
494 Ga0068870_10456639
495 Ga0068863_100001259
496 Ga0068858_100000762
497 Ga0068858_100162258
498 Ga0068860_100041448
499 Ga0068860_100286482
500 Ga0068862_100034236
501 Ga0068862_100052389
502 Ga0068862_100333915
503 Ga0081455_10017757
504 Ga0075365_10015622
505 Ga0075365_10109586
506 Ga0075365_10116156
507 Ga0075365_10153652
508 Ga0075365_10305809
509 Ga0075365_10485589
510 Ga0075365_10518177
511 Ga0075365_10625603
512 Ga0075368_10177839
513 Ga0075363_100011212
514 Ga0075363_100011593
515 Ga0075363_100012599
516 Ga0075363_100028850
517 Ga0075363_100034633
518 Ga0075363_100124418
519 Ga0075363_100127100
520 Ga0075363_100287591
521 Ga0075364_10000578
522 Ga0075364_10024971
523 Ga0075364_10080537
524 Ga0075364_10204850
525 Ga0075364_10477712
526 Ga0070715_10041425
527 Ga0070716_100092620
528 Ga0070712_100409906
529 Ga0075362_10007670
530 Ga0075362_10025608
531 Ga0075362_10094098
532 Ga0075367_10249679
533 Ga0075369_10000374
534 Ga0075369_10007061
535 Ga0075369_10029098
536 Ga0075369_10059715
537 Ga0075369_10074171
538 Ga0075369_10172593
539 Ga0075369_10187435
540 Ga0075369_10282425
541 Ga0075369_10410352
542 Ga0075366_10251126
543 Ga0097621_100119173
544 Ga0075370_10002189
545 Ga0075370_10020841
546 Ga0075370_10075024
547 Ga0075370_10075780
548 Ga0075370_10282962
549 Ga0075370_10528139
550 Ga0068871_100089407
551 Ga0068871_100348956
552 Ga0075428_100091830
553 Ga0075430_100306617
554 Ga0068865_100004829
555 Ga0097620_100015509
556 Ga0097620_100216022
557 Ga0097620_100340014
558 Ga0097620_100480892
559 Ga0099795_10010854
560 Ga0105244_10328826
561 Ga0105240_10813445
562 Ga0105245_10000924
563 Ga0105245_10911971
564 Ga0105247_10006056
565 Ga0105247_10124639
566 Ga0114129_10041366
567 Ga0105243_10000904
568 Ga0105243_10097297
569 Ga0105242_10003759
570 Ga0105242_10116469
571 Ga0105248_10018160
572 Ga0105237_10002602
573 Ga0105237_10149010
574 Ga0105237_10305475
575 Ga0105238_10431437
576 Ga0105238_11065897
577 Ga0105249_10006853
578 Ga0105249_10123764
579 Ga0105249_10126816
580 Ga0105239_10003573
581 Ga0105239_10016822
582 Ga0105239_10300473
583 Ga0105239_10682301
584 Ga0105246_10141632
585 Ga0157374_10019756
586 Ga0157378_10038166
587 Ga0157378_10063635
588 Ga0163162_10002821
589 Ga0163162_10059180
590 Ga0163162_10067058
591 Ga0163162_10557828
592 Ga0163162_11978293
593 Ga0157372_10014845
594 Ga0157375_10029076
595 Ga0157380_10007334
596 Ga0157380_10351718
597 Ga0157377_10062676
598 Ga0157377_10264144
599 Ga0157379_10011857
600 Ga0163161_10000661
601 Ga0163161_10115109
602 Ga0209673_1025372
603 Ga0209051_1004937
604 Ga0209051_1063093
605 Ga0207696_1047997
606 Ga0207692_10002288
607 Ga0207642_10002299
608 Ga0207710_10017652
609 Ga0207710_10048265
610 Ga0207688_10004505
611 Ga0207688_10008585
612 Ga0207688_10351541
613 Ga0207680_10465883
614 Ga0207647_10019845
615 Ga0207647_10030725
616 Ga0207685_10015628
617 Ga0207699_10680927
618 Ga0207645_10045116
619 Ga0207654_10100470
620 Ga0207671_10004760
621 Ga0207693_10000790
622 Ga0207693_10004869
623 Ga0207693_10326642
624 Ga0207663_10004393
625 Ga0207649_10838769
626 Ga0207650_10190458
627 Ga0207687_10000563
628 Ga0207687_10025441
629 Ga0207664_10290743
630 Ga0207644_10029395
631 Ga0207644_10439230
632 Ga0207690_10045390
633 Ga0207690_10087029
634 Ga0207706_10021577
635 Ga0207706_10026046
636 Ga0207686_10044376
637 Ga0207709_10017290
638 Ga0207670_10794485
639 Ga0207669_10000203
640 Ga0207704_10076527
641 Ga0207665_10093669
642 Ga0207689_10053963
643 Ga0207667_10339363
644 Ga0207712_10005855
645 Ga0207712_10179636
646 Ga0207668_10000661
647 Ga0207640_10012136
648 Ga0207658_10036335
649 Ga0207658_10159479
650 Ga0207658_10634077
651 Ga0207677_10030581
652 Ga0207677_10077705
653 Ga0207703_10020348
654 Ga0207703_10073349
655 Ga0207639_10008073
656 Ga0207678_10006516
657 Ga0207678_10060908
658 Ga0207678_10167174
659 Ga0207708_10003570
660 Ga0207708_10133119
661 Ga0207648_10019389
662 Ga0207648_10081800
663 Ga0207676_10088312
664 Ga0207675_100002734
665 Ga0207675_100013004
666 Ga0207675_100213744
667 Ga0207675_100349600
668 Ga0207683_10000819
669 Ga0207683_10018317
670 Ga0207698_10063046
671 Ga0268266_10005952
672 Ga0268266_10015201
673 Ga0268266_10096532
674 Ga0268265_10012113
675 Ga0268265_10047749
676 Ga0268264_11001169
677 Ga0307413_10340149
678 Ga0307409_100597961
679 Ga0307416_100045720
680 Ga0307415_100131658
681 Ga0373938_0039594
682 Ga0373949_0025543
683 Ga0373931_0128133
684 Ga0439461_0004842
685 Ga0439466_0004524
686 Ga0439466_0009093
687 Ga0439465_0006013
688 Ga0439465_0173242
689 Ga0451795_0662872
690 Ga0439431_0206633
691 Ga0439442_003721
692 Ga0439434_0004189
693 Ga0466969_0089109
694 Ga0466972_0002163
695 Ga0466972_0002766
696 Ga0466972_0005443
697 Ga0466972_0013967
698 Ga0466972_0028465
699 Ga0466972_0171768
700 Ga0466965_0000568
701 Ga0466965_0004981
702 Ga0466965_0037021
703 Ga0466965_0056488
704 Ga0466966_0013817
705 Ga0466961_0011289
706 Ga0466964_0011900
707 Ga0466964_0166228
708 Ga0466971_0003229
709 Ga0466971_0186564
710 Ga0466968_0066692
711 Ga0466968_0074811
712 Ga0466968_0117444
713 Ga0466970_0008901
714 Ga0466970_0027969
715 Ga0466970_0115031
716 Ga0466957_0019569
717 Ga0466957_0028067
718 Ga0466957_0052730
719 Ga0466960_0000012
720 Ga0466959_0015127
721 Ga0466959_0110171
722 Ga0466958_0013732
723 Ga0466967_0273830
724 Ga0466967_0705869
725 Ga0495638_0102070
726 Ga0495596_0194760
727 Ga0495672_0160352
728 Ga0495686_0002396
729 Ga0496100_0054423
730 Ga0496100_0268035
731 Ga0496101_0006586
732 Ga0496101_0442190
733 Ga0496102_0001886
734 Ga0496102_0007365
735 Ga0496102_0119868
736 Ga0496102_0576022
737 Ga0496103_0013002
738 Ga0496104_0059798
739 Ga0496104_0293181
740 Ga0496104_0589654
741 Ga0496105_0009953
742 Ga0496105_0055491
743 Ga0496106_0008940
744 Ga0496106_0051213
745 Ga0496106_0147398
746 Ga0496107_0010912
747 Ga0496107_0197433
748 Ga0496108_0000268
749 Ga0496108_0900841
750 Ga0496109_0047289
751 Ga0496109_1008863
752 Ga0496110_0024821
753 Ga0496111_0247056
754 Ga0496111_0275873
755 Ga0496112_0038609
756 Ga0496112_0134180
757 Ga0496112_0202821
758 Ga0496112_0338614
759 Ga0496113_0015875
760 Ga0496113_0236333
761 Ga0496114_0051527
762 Ga0496115_0018274
763 Ga0496115_0923264
764 Ga0496122_0056020
765 Ga0496123_0027928
766 Ga0496125_0369637
767 Ga0496126_0058924
768 Ga0496126_0069080
769 Ga0501034_0111701
770 Ga0501036_0007552
771 Ga0501038_0001720
772 Ga0501039_0001136
773 Ga0501043_0003707
774 Ga0501068_0700803
775 Ga0501070_0000247
776 Ga0501070_0108800
777 Ga0501073_0238872
778 Ga0501077_0697541
779 Ga0501044_0002179
780 nmdc:mga03n38_142594_c1
781 nmdc:mga03n38_219875_c1
782 nmdc:mga03n38_283359_c1
783 nmdc:mga03n38_286821_c1
784 nmdc:mga03n38_38972_c1
785 nmdc:mga03n38_40864_c1
786 nmdc:mga03n38_766776_c1
787 nmdc:mga03n38_90261_c1
788 nmdc:mga00v17_115085_c1
789 nmdc:mga00v17_235089_c1
790 nmdc:mga00v17_41607_c1
791 nmdc:mga00v17_599173_c1
792 nmdc:mga0yw44_19044_c1
793 nmdc:mga0yw44_230535_c1
794 nmdc:mga0yw44_553843_c1
795 nmdc:mga06z11_60287_c1
796 nmdc:mga04h51_519944_c1
797 nmdc:mga07m45_12776_c1
798 nmdc:mga07m45_22811_c1
799 nmdc:mga07m45_80220_c1
800 nmdc:mga05p37_540611_c1
801 nmdc:mga0qj67_295392_c1
802 nmdc:mga06r32_92150_c1
803 nmdc:mga0sz30_122780_c1
804 nmdc:mga0sz30_15221_c1
805 nmdc:mga0sz30_16967_c1
806 nmdc:mga0sz30_7230_c1
807 Ga0500650_0147115
808 Ga0500642_0150328
809 Ga0500559_0138587
810 Ga0500568_0118309
811 Ga0500616_0083699
812 Ga0500627_0008955
813 Ga0500634_0188990
814 Ga0500645_000006
815 Ga0500645_055199
816 Ga0466962_0009663
817 2644634682
818 2738704261
819 2739331255
820 2902804527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

141

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.8515 1 149
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.8204 1 149
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.7861 3 149
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.7512 3 149
3hdp-assembly1.cif.gz_A crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum 0.7416 2 148
ID Description Score Start End Superfamily
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8515 1 149 3.10.180.10
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8204 1 149 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7861 3 149 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7758 3 149 3.10.180.10
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7654 3 150 3.10.180.10
ID Description Score Start End GO Terms
AF-A0PSJ1-F1-model_v4 Conserved hypothetical flavoprotein 0.9911 4 163 GO:0016491
AF-A0A1G6ZXP9-F1-model_v4 deleted 0.9866 13 164
AF-A0A7I7SXK7-F1-model_v4 Lactoylglutathione lyase 0.9851 35 164 GO:0016829
AF-A0A1N2T9J7-F1-model_v4 deleted 0.9782 23 164
AF-A0A7I7SXK7-F1-model_v4 Lactoylglutathione lyase 0.9776 35 164 GO:0016829

Map