F437044

General Info

Members Datasets Scaffolds Average Seq Length
409 230 401 318

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1077368|Ga0436364_1077368_945_2054
Length 369
Sequence VEKVSPNPFDDPLGAENERMPGESGAPATRRSAPTRVALALGSGGARGYAHIGVIEALRARNYEVVGIAGSSMGAVVGGLEAAGRLDEFADWAKSLTQRTILRLLDPSISAAGVMRAGKILDAVRDILGPVAIEELPIPYTAVATDLLAGKSVWFQRGPLDEAIRASIAIPGVIAPHEVDGRLLADGGILDPLPMAPLSAVNADLTIAVSLSGSEAITSREAEPGATVEWLNRMMRSTTALLDRPTARAVLARFGVPSSDAENWPDDPDAEQPDDDGAVELADLSPEVPKLGSFEVMNRTIDIAQSALARHTLAVYPPDLLIEVPRSTCRALEFHRAVEVIAAGRDLADDALDALEAGTDQLTPPAIED

Samples

Sample ID Description Type Environment
1 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
6 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
7 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
8 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.33
Nodule 0.24
Rhizoplane 13.69
Rhizosphere 66.26
Stem 0
Stem Tuber 0
Unclassified 12.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10011056 3300001991 Bacteria 1619
2 JGI24744J21845_10002663 3300002077 Bacteria 3644
3 JGI24744J21845_10009743 3300002077 Bacteria 1973
4 JGI24742J22300_10001233 3300002244 Bacteria 4008
5 Ga0070676_10053086 3300005328 Bacteria 2386
6 Ga0070690_100016982 3300005330 Bacteria 4369
7 Ga0070670_100039267 3300005331 Bacteria 4071
8 Ga0070670_100164756 3300005331 Bacteria 1921
9 Ga0068869_100375720 3300005334 Bacteria 1164
10 Ga0070666_10004595 3300005335 Bacteria 8421
11 Ga0070666_10163670 3300005335 Bacteria 1555
12 Ga0070680_100523702 3300005336 Bacteria 1015
13 Ga0070682_100355231 3300005337 Bacteria 1094
14 Ga0068868_100005133 3300005338 Bacteria 9196
15 Ga0068868_100076151 3300005338 Bacteria 2682
16 Ga0070689_100011642 3300005340 Bacteria 6308
17 Ga0070691_10022154 3300005341 Bacteria 2945
18 Ga0070668_100010948 3300005347 Bacteria 6749
19 Ga0070668_100015430 3300005347 Bacteria 5709
20 Ga0070669_100006848 3300005353 Bacteria 8197
21 Ga0070675_100239455 3300005354 Bacteria 1585
22 Ga0070671_100017444 3300005355 Bacteria 5815
23 Ga0070674_100011361 3300005356 Bacteria 5421
24 Ga0070688_100025631 3300005365 Bacteria 3493
25 Ga0070659_100015605 3300005366 Bacteria 5689
26 Ga0070667_100002849 3300005367 Bacteria 14928
27 Ga0070667_100007260 3300005367 Bacteria 9207
28 Ga0070667_100007906 3300005367 Bacteria 8819
29 Ga0070667_100276630 3300005367 Bacteria 1506
30 Ga0070714_100091369 3300005435 Bacteria 2667
31 Ga0070710_10000709 3300005437 Bacteria 15857
32 Ga0070710_10003661 3300005437 Bacteria 7265
33 Ga0070701_10135708 3300005438 Bacteria 1402
34 Ga0070711_100000220 3300005439 Bacteria 30189
35 Ga0070711_100011499 3300005439 Bacteria 5499
36 Ga0070711_100199785 3300005439 Bacteria 1542
37 Ga0070700_100004821 3300005441 Bacteria 7079
38 Ga0070700_100024325 3300005441 Bacteria 3554
39 Ga0070694_100018953 3300005444 Bacteria 4372
40 Ga0070694_100331106 3300005444 Bacteria 1175
41 Ga0070663_100000261 3300005455 Bacteria 26441
42 Ga0070663_100045570 3300005455 Bacteria 3098
43 Ga0070663_100174496 3300005455 Bacteria 1663
44 Ga0070678_100000231 3300005456 Bacteria 25410
45 Ga0070662_100003854 3300005457 Bacteria 9404
46 Ga0070662_100211941 3300005457 Bacteria 1542
47 Ga0068867_100004155 3300005459 Bacteria 10180
48 Ga0068867_100069339 3300005459 Bacteria 2633
49 Ga0068853_100013987 3300005539 Bacteria 6565
50 Ga0070672_100070587 3300005543 Bacteria 2776
51 Ga0070695_100021266 3300005545 Bacteria 3967
52 Ga0070696_100000829 3300005546 Bacteria 19923
53 Ga0070693_100002255 3300005547 Bacteria 8838
54 Ga0070665_100031726 3300005548 Bacteria 5317
55 Ga0070665_100065992 3300005548 Bacteria 3630
56 Ga0070665_100082312 3300005548 Bacteria 3224
57 Ga0068854_100000198 3300005578 Bacteria 40596
58 Ga0070702_100000682 3300005615 Bacteria 12751
59 Ga0068852_100270646 3300005616 Bacteria 1634
60 Ga0068859_100001075 3300005617 Bacteria 27961
61 Ga0068859_100355505 3300005617 Bacteria 1560
62 Ga0068859_100381774 3300005617 Bacteria 1504
63 Ga0068864_100069386 3300005618 Bacteria 3065
64 Ga0068866_10000535 3300005718 Bacteria 17395
65 Ga0068866_10068026 3300005718 Bacteria 1871
66 Ga0068861_100000696 3300005719 Bacteria 20143
67 Ga0068863_100000733 3300005841 Bacteria 32858
68 Ga0068863_100128519 3300005841 Bacteria 2418
69 Ga0068863_100524499 3300005841 Bacteria 1168
70 Ga0068858_100016817 3300005842 Bacteria 6869
71 Ga0068858_100193678 3300005842 Bacteria 1921
72 Ga0068860_100003120 3300005843 Bacteria 17129
73 Ga0068860_100262565 3300005843 Bacteria 1683
74 Ga0068862_100029404 3300005844 Bacteria 4630
75 Ga0081455_10123072 3300005937 Bacteria 2041
76 Ga0081455_10210942 3300005937 Bacteria 1447
77 Ga0075365_10013586 3300006038 Bacteria 4878
78 Ga0075363_100001024 3300006048 Bacteria 10036
79 Ga0075363_100001262 3300006048 Bacteria 9411
80 Ga0075364_10001909 3300006051 Bacteria 11599
81 Ga0075364_10265986 3300006051 Bacteria 1166
82 Ga0070716_100009767 3300006173 Bacteria 4794
83 Ga0070712_100000493 3300006175 Bacteria 22536
84 Ga0070712_100002576 3300006175 Bacteria 11202
85 Ga0075367_10007244 3300006178 Bacteria 5669
86 Ga0075369_10015844 3300006186 Bacteria 3032
87 Ga0075369_10042135 3300006186 Bacteria 1956
88 Ga0097621_100047038 3300006237 Bacteria 3494
89 Ga0075370_10001281 3300006353 Bacteria 10732
90 Ga0075370_10009951 3300006353 Bacteria 4954
91 Ga0075370_10186912 3300006353 Bacteria 1220
92 Ga0075430_100026140 3300006846 Bacteria 4968
93 Ga0075430_100091181 3300006846 Bacteria 2549
94 Ga0068865_100004610 3300006881 Bacteria 8322
95 Ga0097620_100001075 3300006931 Bacteria 27961
96 Ga0097620_100355464 3300006931 Bacteria 1560
97 Ga0097620_100381824 3300006931 Bacteria 1504
98 Ga0105245_10001366 3300009098 Bacteria 22092
99 Ga0105245_10101179 3300009098 Bacteria 2667
100 Ga0105247_10000698 3300009101 Bacteria 26249
101 Ga0105247_10226832 3300009101 Bacteria 1267
102 Ga0114129_10054422 3300009147 Bacteria 5610
103 Ga0105243_10001379 3300009148 Bacteria 21532
104 Ga0105243_10028935 3300009148 Bacteria 4258
105 Ga0105242_10001623 3300009176 Bacteria 17729
106 Ga0105248_10001820 3300009177 Bacteria 23699
107 Ga0105248_10017837 3300009177 Bacteria 7835
108 Ga0105237_10003712 3300009545 Bacteria 17985
109 Ga0105237_10010933 3300009545 Bacteria 9630
110 Ga0105237_10326437 3300009545 Bacteria 1538
111 Ga0105249_10000589 3300009553 Bacteria 33192
112 Ga0105249_10008943 3300009553 Bacteria 8749
113 Ga0105249_10110315 3300009553 Bacteria 2600
114 Ga0105239_10003845 3300010375 Bacteria 18233
115 Ga0105246_10103195 3300011119 Bacteria 2080
116 Ga0157371_10191929 3300013102 Bacteria 1463
117 Ga0157369_10440308 3300013105 Bacteria 1350
118 Ga0157374_10003582 3300013296 Bacteria 13075
119 Ga0157378_10012499 3300013297 Bacteria 7431
120 Ga0157378_10299236 3300013297 Bacteria 1556
121 Ga0163162_10002550 3300013306 Bacteria 17237
122 Ga0157372_10006318 3300013307 Bacteria 12605
123 Ga0157372_10565093 3300013307 Bacteria 1326
124 Ga0157375_10000478 3300013308 Bacteria 36449
125 Ga0157375_10184941 3300013308 Bacteria 2236
126 Ga0163163_10372479 3300014325 Bacteria 1485
127 Ga0157380_10000372 3300014326 Bacteria 26981
128 Ga0157377_10037951 3300014745 Bacteria 2657
129 Ga0157379_10008683 3300014968 Bacteria 8849
130 Ga0163161_10000595 3300017792 Bacteria 28928
131 Ga0163161_10153327 3300017792 Bacteria 1752
132 Ga0213876_10000447 3300021384 Bacteria 33381
133 Ga0213876_10005270 3300021384 Bacteria 7121
134 Ga0213876_10041040 3300021384 Bacteria 2445
135 Ga0213875_10010586 3300021388 Bacteria 4614
136 Ga0213875_10012064 3300021388 Bacteria 4279
137 Ga0213875_10062913 3300021388 Bacteria 1735
138 Ga0207692_10004775 3300025898 Bacteria 5385
139 Ga0207642_10003082 3300025899 Bacteria 5223
140 Ga0207710_10006066 3300025900 Bacteria 5180
141 Ga0207688_10000673 3300025901 Bacteria 16871
142 Ga0207680_10024683 3300025903 Bacteria 3303
143 Ga0207680_10161001 3300025903 Bacteria 1505
144 Ga0207647_10098752 3300025904 Bacteria 1735
145 Ga0207671_10000689 3300025914 Bacteria 43697
146 Ga0207671_10017690 3300025914 Bacteria 5491
147 Ga0207671_10241436 3300025914 Bacteria 1419
148 Ga0207693_10000430 3300025915 Bacteria 38189
149 Ga0207693_10009155 3300025915 Bacteria 8083
150 Ga0207663_10001439 3300025916 Bacteria 11063
151 Ga0207663_10123094 3300025916 Bacteria 1779
152 Ga0207681_10013582 3300025923 Bacteria 5043
153 Ga0207681_10160299 3300025923 Bacteria 1695
154 Ga0207650_10070227 3300025925 Bacteria 2632
155 Ga0207687_10000803 3300025927 Bacteria 21200
156 Ga0207700_10136220 3300025928 Bacteria 2012
157 Ga0207700_10288166 3300025928 Bacteria 1414
158 Ga0207664_10048322 3300025929 Bacteria 3345
159 Ga0207644_10008398 3300025931 Bacteria 6757
160 Ga0207690_10044583 3300025932 Bacteria 2925
161 Ga0207706_10004981 3300025933 Bacteria 12411
162 Ga0207706_10018146 3300025933 Bacteria 6331
163 Ga0207686_10005781 3300025934 Bacteria 6636
164 Ga0207709_10071871 3300025935 Bacteria 2199
165 Ga0207670_10019020 3300025936 Bacteria 4186
166 Ga0207669_10001734 3300025937 Bacteria 9264
167 Ga0207704_10002341 3300025938 Bacteria 8513
168 Ga0207704_10186564 3300025938 Bacteria 1504
169 Ga0207665_10012050 3300025939 Bacteria 5676
170 Ga0207711_10001130 3300025941 Bacteria 25467
171 Ga0207711_10006457 3300025941 Bacteria 9870
172 Ga0207661_10120290 3300025944 Bacteria 2235
173 Ga0207712_10000170 3300025961 Bacteria 67105
174 Ga0207712_10001841 3300025961 Bacteria 13983
175 Ga0207668_10001136 3300025972 Bacteria 15864
176 Ga0207668_10005253 3300025972 Bacteria 7618
177 Ga0207640_10007565 3300025981 Bacteria 5999
178 Ga0207658_10000665 3300025986 Bacteria 30020
179 Ga0207658_10003398 3300025986 Bacteria 11266
180 Ga0207658_10004618 3300025986 Bacteria 9549
181 Ga0207658_10031600 3300025986 Bacteria 3761
182 Ga0207677_10020010 3300026023 Bacteria 4055
183 Ga0207703_10010738 3300026035 Bacteria 7148
184 Ga0207703_10151782 3300026035 Bacteria 2021
185 Ga0207639_10022811 3300026041 Bacteria 4513
186 Ga0207678_10000958 3300026067 Bacteria 26386
187 Ga0207678_10018893 3300026067 Bacteria 6055
188 Ga0207678_10035528 3300026067 Bacteria 4339
189 Ga0207708_10074078 3300026075 Bacteria 2610
190 Ga0207641_10001782 3300026088 Bacteria 20723
191 Ga0207641_10500299 3300026088 Bacteria 1180
192 Ga0207648_10002033 3300026089 Bacteria 22080
193 Ga0207648_10050026 3300026089 Bacteria 3655
194 Ga0207675_100000192 3300026118 Bacteria 55745
195 Ga0207683_10001366 3300026121 Bacteria 22060
196 Ga0207698_10221275 3300026142 Bacteria 1711
197 Ga0207698_10229474 3300026142 Bacteria 1684
198 Ga0268266_10012996 3300028379 Bacteria 7179
199 Ga0268266_10015094 3300028379 Bacteria 6633
200 Ga0268266_10118973 3300028379 Bacteria 2349
201 Ga0268266_10350694 3300028379 Bacteria 1387
202 Ga0268265_10014195 3300028380 Bacteria 5426
203 Ga0268264_10009121 3300028381 Bacteria 8226
204 Ga0268264_10254793 3300028381 Bacteria 1632
205 Ga0265327_10158525 3300031251 Bacteria 1047
206 Ga0307413_10117683 3300031824 Bacteria 1792
207 Ga0307409_100226651 3300031995 Bacteria 1691
208 Ga0373960_0016304 3300035121 Bacteria 1909
209 Ga0373960_0024543 3300035121 Bacteria 1632
210 Ga0373931_0007027 3300035691 Bacteria 5297
211 Ga0373931_0008130 3300035691 Bacteria 4970
212 Ga0436364_1077368 3300037853 Bacteria 2389
213 Ga0436364_1107971 3300037853 Bacteria 8495
214 Ga0436364_1247608 3300037853 Bacteria 2567
215 Ga0436364_1503047 3300037853 Bacteria 11171
216 Ga0436365_1083994 3300039437 Bacteria 225582
217 Ga0436365_1253726 3300039437 Bacteria 22924
218 Ga0436365_1562757 3300039437 Bacteria 2901
219 Ga0436365_1709394 3300039437 Bacteria 51419
220 Ga0436363_0669456 3300039450 Bacteria 2400
221 Ga0439466_0010297 3300041411 Bacteria 3476
222 Ga0439466_0016972 3300041411 Bacteria 2626
223 Ga0439465_0002688 3300041413 Bacteria 5815
224 Ga0439465_0005521 3300041413 Bacteria 4032
225 Ga0451791_1873472 3300041451 Bacteria 3808
226 Ga0451807_0730936 3300041486 Bacteria 1263
227 Ga0439431_0009116 3300041997 Bacteria 2237
228 Ga0466969_0031942 3300044656 Bacteria 2678
229 Ga0466969_0047655 3300044656 Bacteria 2120
230 Ga0466972_0072960 3300044658 Bacteria 1636
231 Ga0466966_0006489 3300044684 Bacteria 7742
232 Ga0466966_0007793 3300044684 Bacteria 7091
233 Ga0466961_0006278 3300044693 Bacteria 7548
234 Ga0466963_0030038 3300044694 Bacteria 3503
235 Ga0466964_0093246 3300044706 Bacteria 1314
236 Ga0466971_0019470 3300044719 Bacteria 3015
237 Ga0466968_0000787 3300044735 Bacteria 11058
238 Ga0466968_0004273 3300044735 Bacteria 5331
239 Ga0466970_0006849 3300044765 Bacteria 5705
240 Ga0466957_0014795 3300044842 Bacteria 4546
241 Ga0466957_0128335 3300044842 Bacteria 1622
242 Ga0466960_0001867 3300044901 Bacteria 7735
243 Ga0466959_0002456 3300045049 Bacteria 11854
244 Ga0466959_0045309 3300045049 Bacteria 3239
245 Ga0466958_0041782 3300045836 Bacteria 2759
246 Ga0466958_0061751 3300045836 Bacteria 2283
247 Ga0466958_0137705 3300045836 Bacteria 1536
248 Ga0466967_0001683 3300045976 Bacteria 13124
249 Ga0466967_0025224 3300045976 Bacteria 4900
250 Ga0466967_0026698 3300045976 Bacteria 4788
251 Ga0466967_0063563 3300045976 Bacteria 3280
252 Ga0466967_0131086 3300045976 Bacteria 2327
253 Ga0466967_0256360 3300045976 Bacteria 1672
254 Ga0466967_0398268 3300045976 Bacteria 1339
255 Ga0495603_0154896 3300046455 Bacteria 1330
256 Ga0495638_0009718 3300046460 Bacteria 6723
257 Ga0495638_0055021 3300046460 Bacteria 2472
258 Ga0495641_0081417 3300046461 Bacteria 1450
259 Ga0495654_0055289 3300046530 Bacteria 1922
260 Ga0495665_0106113 3300046531 Bacteria 1474
261 Ga0495640_0033962 3300046533 Bacteria 3622
262 Ga0495658_0057738 3300046683 Bacteria 2218
263 Ga0495624_0109834 3300046690 Bacteria 1696
264 Ga0495674_0055832 3300047319 Bacteria 3462
265 Ga0495673_0011746 3300047469 Bacteria 4688
266 Ga0495686_0004251 3300047472 Bacteria 11874
267 Ga0495593_0015864 3300047673 Bacteria 4257
268 Ga0496100_0000328 3300048903 Bacteria 23392
269 Ga0496100_0000412 3300048903 Bacteria 20666
270 Ga0496100_0001365 3300048903 Bacteria 11967
271 Ga0496100_0002987 3300048903 Bacteria 8708
272 Ga0496101_0000054 3300048904 Bacteria 137699
273 Ga0496101_0000073 3300048904 Bacteria 113870
274 Ga0496101_0001959 3300048904 Bacteria 12465
275 Ga0496101_0068657 3300048904 Bacteria 2592
276 Ga0496102_0000006 3300048905 Bacteria 471494
277 Ga0496102_0004217 3300048905 Bacteria 12154
278 Ga0496102_0006758 3300048905 Bacteria 9794
279 Ga0496102_0013922 3300048905 Bacteria 6980
280 Ga0496102_0438295 3300048905 Bacteria 1226
281 Ga0496103_0000006 3300048906 Bacteria 470539
282 Ga0496103_0000945 3300048906 Bacteria 20803
283 Ga0496103_0008481 3300048906 Bacteria 6106
284 Ga0496103_0107811 3300048906 Bacteria 1767
285 Ga0496104_0004253 3300048907 Bacteria 12431
286 Ga0496104_0169625 3300048907 Bacteria 2093
287 Ga0496105_0000700 3300048908 Bacteria 22662
288 Ga0496105_0179625 3300048908 Bacteria 1733
289 Ga0496106_0000901 3300048909 Bacteria 21691
290 Ga0496106_0005261 3300048909 Bacteria 9586
291 Ga0496106_0008817 3300048909 Bacteria 7453
292 Ga0496106_0030695 3300048909 Bacteria 4006
293 Ga0496107_0000261 3300048910 Bacteria 28034
294 Ga0496107_0000264 3300048910 Bacteria 27701
295 Ga0496107_0001164 3300048910 Bacteria 15946
296 Ga0496107_0102080 3300048910 Bacteria 2103
297 Ga0496107_0179493 3300048910 Bacteria 1572
298 Ga0496108_0034876 3300048911 Bacteria 4180
299 Ga0496108_0149184 3300048911 Bacteria 2017
300 Ga0496108_0345659 3300048911 Bacteria 1298
301 Ga0496109_0000152 3300048912 Bacteria 68036
302 Ga0496109_0003787 3300048912 Bacteria 12624
303 Ga0496109_0162789 3300048912 Bacteria 2091
304 Ga0496109_0178018 3300048912 Bacteria 1997
305 Ga0496110_0001576 3300048913 Bacteria 16638
306 Ga0496110_0036679 3300048913 Bacteria 4259
307 Ga0496110_0050492 3300048913 Bacteria 3652
308 Ga0496111_0072194 3300048914 Bacteria 2512
309 Ga0496112_0086995 3300048915 Bacteria 3092
310 Ga0496112_0119707 3300048915 Bacteria 2603
311 Ga0496112_0184183 3300048915 Bacteria 2052
312 Ga0496112_0210987 3300048915 Bacteria 1899
313 Ga0496113_0055502 3300048916 Bacteria 2970
314 Ga0496113_0178419 3300048916 Bacteria 1683
315 Ga0496113_0283596 3300048916 Bacteria 1325
316 Ga0496113_0453866 3300048916 Bacteria 1030
317 Ga0496114_0000047 3300048917 Bacteria 119106
318 Ga0496114_0002699 3300048917 Bacteria 13559
319 Ga0496114_0007462 3300048917 Bacteria 8647
320 Ga0496115_0002787 3300048918 Bacteria 12565
321 Ga0496115_0006427 3300048918 Bacteria 8611
322 Ga0496116_0000025 3300048919 Bacteria 470539
323 Ga0496116_0000968 3300048919 Bacteria 35439
324 Ga0496117_0000006 3300048920 Bacteria 758420
325 Ga0496117_0010582 3300048920 Bacteria 8383
326 Ga0496117_0217299 3300048920 Bacteria 1067
327 Ga0496118_0000004 3300048921 Bacteria 758420
328 Ga0496118_0000274 3300048921 Bacteria 90649
329 Ga0496118_0006579 3300048921 Bacteria 12695
330 Ga0496118_0066463 3300048921 Bacteria 2631
331 Ga0496119_0000041 3300048922 Bacteria 203687
332 Ga0496119_0005086 3300048922 Bacteria 12767
333 Ga0496120_0000027 3300048923 Bacteria 231507
334 Ga0496120_0094740 3300048923 Bacteria 1588
335 Ga0496120_0142854 3300048923 Bacteria 1213
336 Ga0496121_0000004 3300048924 Bacteria 1139011
337 Ga0496121_0002353 3300048924 Bacteria 29156
338 Ga0496122_0000136 3300048925 Bacteria 170671
339 Ga0496122_0000313 3300048925 Bacteria 107106
340 Ga0496122_0086324 3300048925 Bacteria 2160
341 Ga0496123_0004345 3300048926 Bacteria 15001
342 Ga0496123_0011722 3300048926 Bacteria 7560
343 Ga0496123_0021467 3300048926 Bacteria 5018
344 Ga0496124_0000117 3300048927 Bacteria 164439
345 Ga0496125_0000003 3300048928 Bacteria 1189767
346 Ga0496125_0063170 3300048928 Bacteria 2955
347 Ga0496126_0000001 3300048929 Bacteria 1139011
348 Ga0496126_0001241 3300048929 Bacteria 41382
349 Ga0496126_0001576 3300048929 Bacteria 34867
350 Ga0496126_0005213 3300048929 Bacteria 14998
351 Ga0496126_0057663 3300048929 Bacteria 3504
352 Ga0501031_0144607 3300049568 Bacteria 1554
353 Ga0501032_0072347 3300049569 Bacteria 2298
354 Ga0501032_0184408 3300049569 Bacteria 1365
355 Ga0501034_0013153 3300049571 Bacteria 8527
356 Ga0501034_0029170 3300049571 Bacteria 5609
357 Ga0501034_0051377 3300049571 Bacteria 4157
358 Ga0501037_0047960 3300049573 Bacteria 3130
359 Ga0501038_0541826 3300049574 Bacteria 886
360 Ga0501046_0005675 3300049580 Bacteria 11140
361 Ga0501047_0014438 3300049581 Bacteria 7511
362 Ga0501048_0041800 3300049582 Bacteria 3283
363 Ga0501070_0000288 3300049586 Bacteria 47185
364 Ga0501070_0056347 3300049586 Bacteria 3258
365 Ga0501070_0249548 3300049586 Bacteria 1452
366 Ga0501072_0113050 3300049588 Bacteria 2162
367 Ga0501074_0149568 3300049590 Bacteria 1670
368 Ga0501080_0038536 3300049742 Bacteria 4462
369 Ga0501080_0138468 3300049742 Bacteria 2251
370 Ga0501035_0001318 3300049822 Bacteria 25624
371 Ga0501035_0001771 3300049822 Bacteria 21793
372 Ga0501035_0057719 3300049822 Bacteria 3460
373 Ga0501035_0274937 3300049822 Bacteria 1425
374 Ga0501044_0000554 3300049823 Bacteria 45441
375 Ga0501044_0007276 3300049823 Bacteria 12164
376 Ga0501044_0068481 3300049823 Bacteria 3615
377 Ga0501044_0303690 3300049823 Bacteria 1524
378 nmdc:mga03n38_2248_c1 3300050490 Bacteria 5902
379 nmdc:mga00v17_14205_c2 3300050491 Bacteria 3389
380 nmdc:mga00v17_68584_c1 3300050491 Bacteria 2192
381 nmdc:mga00v17_9283_c1 3300050491 Bacteria 5318
382 nmdc:mga0yw44_316592_c1 3300050492 Bacteria 1047
383 nmdc:mga0yw44_76188_c1 3300050492 Bacteria 2093
384 nmdc:mga07m45_5019_c2 3300050496 Bacteria 5975
385 nmdc:mga07m45_69698_c1 3300050496 Bacteria 1999
386 nmdc:mga0qj67_20884_c1 3300050509 Bacteria 5017
387 nmdc:mga0qj67_70209_c1 3300050509 Bacteria 2794
388 nmdc:mga0sz30_14725_c1 3300050516 Bacteria 3083
389 nmdc:mga0sz30_2907_c1 3300050516 Bacteria 6137
390 Ga0500610_0021005 3300053079 Bacteria 3197
391 Ga0500635_0028971 3300053080 Bacteria 1773
392 Ga0495655_0036308 3300053083 Bacteria 1231
393 Ga0495655_0046126 3300053083 Bacteria 1135
394 Ga0500643_000450 3300053087 Bacteria 30395
395 Ga0500643_010395 3300053087 Bacteria 3467
396 Ga0500643_018414 3300053087 Bacteria 2318
397 Ga0500597_011836 3300053120 Bacteria 3175
398 Ga0500652_003623 3300053131 Bacteria 4693
399 Ga0500627_0026149 3300053158 Bacteria 2406
400 Ga0500645_000046 3300053730 Bacteria 106127
401 Ga0466962_0032672 3300061719 Bacteria 2491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048923 Ga0496120_0094740 Ga0496120_0094740_494_1309 252
2 3300049574 Ga0501038_0541826 Ga0501038_0541826_14_862 259
3 3300047472 Ga0495686_0004251 Ga0495686_0004251_3289_4281 265
4 3300005367 Ga0070667_100002849 Ga0070667_10000284915 266
5 3300005455 Ga0070663_100000261 Ga0070663_10000026130 266
6 3300005616 Ga0068852_100270646 Ga0068852_1002706462 266
7 3300009177 Ga0105248_10001820 Ga0105248_1000182011 266
8 3300009545 Ga0105237_10003712 Ga0105237_100037127 266
9 3300009553 Ga0105249_10000589 Ga0105249_1000058923 266
10 3300025914 Ga0207671_10000689 Ga0207671_100006892 266
11 3300025941 Ga0207711_10001130 Ga0207711_1000113011 266
12 3300025961 Ga0207712_10000170 Ga0207712_100001707 266
13 3300025986 Ga0207658_10000665 Ga0207658_1000066534 266
14 3300026067 Ga0207678_10000958 Ga0207678_100009582 266
15 3300026142 Ga0207698_10221275 Ga0207698_102212752 266
16 3300048925 Ga0496122_0000136 Ga0496122_0000136_25706_26698 266
17 3300048926 Ga0496123_0004345 Ga0496123_0004345_13516_14508 266
18 3300048929 Ga0496126_0057663 Ga0496126_0057663_2335_3327 266
19 3300005539 Ga0068853_100013987 Ga0068853_1000139874 267
20 3300026041 Ga0207639_10022811 Ga0207639_100228112 267
21 3300050492 nmdc:mga0yw44_316592_c1 nmdc:mga0yw44_316592_c1_18_830 267
22 3300049588 Ga0501072_0113050 Ga0501072_0113050_1279_2124 269
23 3300025928 Ga0207700_10288166 Ga0207700_102881662 276
24 3300049569 Ga0501032_0184408 Ga0501032_0184408_63_1064 279
25 3300048929 Ga0496126_0005213 Ga0496126_0005213_6577_7509 281
26 3300045836 Ga0466958_0061751 Ga0466958_0061751_1142_2173 284
27 3300046690 Ga0495624_0109834 Ga0495624_0109834_27_929 284
28 3300044901 Ga0466960_0001867 Ga0466960_0001867_2019_3053 287
29 3300045976 Ga0466967_0001683 Ga0466967_0001683_3158_4192 287
30 3300005439 Ga0070711_100199785 Ga0070711_1001997852 288
31 3300048911 Ga0496108_0345659 Ga0496108_0345659_144_1049 288
32 3300048915 Ga0496112_0184183 Ga0496112_0184183_834_1739 288
33 3300048916 Ga0496113_0283596 Ga0496113_0283596_387_1292 288
34 3300048920 Ga0496117_0010582 Ga0496117_0010582_6932_7921 288
35 3300048921 Ga0496118_0000274 Ga0496118_0000274_68914_69903 288
36 3300053087 Ga0500643_000450 Ga0500643_000450_25222_26214 289
37 3300053120 Ga0500597_011836 Ga0500597_011836_1801_2793 289
38 3300005435 Ga0070714_100091369 Ga0070714_1000913692 291
39 3300025928 Ga0207700_10136220 Ga0207700_101362202 291
40 3300025929 Ga0207664_10048322 Ga0207664_100483222 291
41 3300006353 Ga0075370_10001281 Ga0075370_100012815 293
42 3300045976 Ga0466967_0398268 Ga0466967_0398268_298_1326 293
43 3300048904 Ga0496101_0068657 Ga0496101_0068657_1365_2303 293
44 3300048915 Ga0496112_0119707 Ga0496112_0119707_707_1645 293
45 3300048916 Ga0496113_0178419 Ga0496113_0178419_710_1648 293
46 3300048925 Ga0496122_0086324 Ga0496122_0086324_960_1898 293
47 3300048926 Ga0496123_0011722 Ga0496123_0011722_314_1252 293
48 3300048929 Ga0496126_0001576 Ga0496126_0001576_28502_29440 293
49 3300009101 Ga0105247_10226832 Ga0105247_102268321 294
50 3300009545 Ga0105237_10010933 Ga0105237_100109337 294
51 3300025914 Ga0207671_10017690 Ga0207671_100176907 294
52 3300031251 Ga0265327_10158525 Ga0265327_101585251 294
53 3300048907 Ga0496104_0169625 Ga0496104_0169625_927_1895 294
54 iso_pu_bacteria 2902792274 2902798830 294
55 iso_pu_bacteria 2738541264 2738668425 295
56 iso_pu_bacteria 2738541356 2739147495 295
57 3300044656 Ga0466969_0031942 Ga0466969_0031942_1187_2122 296
58 3300044684 Ga0466966_0006489 Ga0466966_0006489_4518_5453 296
59 3300044735 Ga0466968_0000787 Ga0466968_0000787_1013_1948 296
60 3300044735 Ga0466968_0004273 Ga0466968_0004273_2355_3308 296
61 3300045049 Ga0466959_0002456 Ga0466959_0002456_7865_8800 296
62 3300045976 Ga0466967_0063563 Ga0466967_0063563_498_1451 296
63 3300046530 Ga0495654_0055289 Ga0495654_0055289_206_1162 296
64 3300047469 Ga0495673_0011746 Ga0495673_0011746_3377_4333 296
65 3300048903 Ga0496100_0000412 Ga0496100_0000412_7902_8861 296
66 3300048904 Ga0496101_0000073 Ga0496101_0000073_65578_66537 296
67 3300048905 Ga0496102_0000006 Ga0496102_0000006_184791_185750 296
68 3300048906 Ga0496103_0000006 Ga0496103_0000006_184589_185548 296
69 3300048910 Ga0496107_0102080 Ga0496107_0102080_310_1269 296
70 3300048919 Ga0496116_0000025 Ga0496116_0000025_284992_285951 296
71 3300048920 Ga0496117_0000006 Ga0496117_0000006_284992_285951 296
72 3300048921 Ga0496118_0000004 Ga0496118_0000004_284992_285951 296
73 3300048922 Ga0496119_0000041 Ga0496119_0000041_183849_184808 296
74 3300048923 Ga0496120_0000027 Ga0496120_0000027_16197_17156 296
75 3300048924 Ga0496121_0002353 Ga0496121_0002353_14427_15386 296
76 3300048929 Ga0496126_0001241 Ga0496126_0001241_5973_6932 296
77 3300049822 Ga0501035_0057719 Ga0501035_0057719_535_1512 296
78 3300049823 Ga0501044_0068481 Ga0501044_0068481_1921_2898 296
79 3300053087 Ga0500643_018414 Ga0500643_018414_597_1553 296
80 3300061719 Ga0466962_0032672 Ga0466962_0032672_945_1880 296
81 3300006186 Ga0075369_10042135 Ga0075369_100421352 297
82 3300041451 Ga0451791_1873472 Ga0451791_1873472_1389_2396 297
83 3300041486 Ga0451807_0730936 Ga0451807_0730936_195_1202 297
84 3300045976 Ga0466967_0131086 Ga0466967_0131086_447_1412 297
85 3300050516 nmdc:mga0sz30_2907_c1 nmdc:mga0sz30_2907_c1_316_1278 297
86 3300049822 Ga0501035_0274937 Ga0501035_0274937_278_1303 298
87 3300025944 Ga0207661_10120290 Ga0207661_101202903 299
88 3300048920 Ga0496117_0217299 Ga0496117_0217299_13_1008 299
89 3300005331 Ga0070670_100164756 Ga0070670_1001647561 300
90 3300005335 Ga0070666_10163670 Ga0070666_101636701 300
91 3300005367 Ga0070667_100007260 Ga0070667_1000072606 300
92 3300005617 Ga0068859_100381774 Ga0068859_1003817742 300
93 3300006931 Ga0097620_100381824 Ga0097620_1003818242 300
94 3300025903 Ga0207680_10161001 Ga0207680_101610012 300
95 3300025986 Ga0207658_10004618 Ga0207658_100046186 300
96 3300044719 Ga0466971_0019470 Ga0466971_0019470_371_1420 300
97 3300045836 Ga0466958_0137705 Ga0466958_0137705_142_1191 300
98 3300048903 Ga0496100_0001365 Ga0496100_0001365_10387_11355 300
99 3300048904 Ga0496101_0000054 Ga0496101_0000054_30748_31716 300
100 3300048905 Ga0496102_0013922 Ga0496102_0013922_3567_4535 300
101 3300048905 Ga0496102_0438295 Ga0496102_0438295_125_1105 300
102 3300048906 Ga0496103_0008481 Ga0496103_0008481_1169_2137 300
103 3300048909 Ga0496106_0005261 Ga0496106_0005261_3726_4694 300
104 3300048910 Ga0496107_0000261 Ga0496107_0000261_2514_3482 300
105 3300048911 Ga0496108_0034876 Ga0496108_0034876_501_1469 300
106 3300048912 Ga0496109_0000152 Ga0496109_0000152_19364_20332 300
107 3300048913 Ga0496110_0001576 Ga0496110_0001576_2998_3966 300
108 3300048914 Ga0496111_0072194 Ga0496111_0072194_1226_2194 300
109 3300048916 Ga0496113_0453866 Ga0496113_0453866_28_996 300
110 3300048917 Ga0496114_0000047 Ga0496114_0000047_38780_39748 300
111 3300048918 Ga0496115_0002787 Ga0496115_0002787_6297_7265 300
112 3300048919 Ga0496116_0000968 Ga0496116_0000968_30517_31485 300
113 3300048921 Ga0496118_0066463 Ga0496118_0066463_27_995 300
114 3300048922 Ga0496119_0005086 Ga0496119_0005086_3768_4736 300
115 3300048923 Ga0496120_0142854 Ga0496120_0142854_26_994 300
116 3300048924 Ga0496121_0000004 Ga0496121_0000004_132355_133323 300
117 3300048925 Ga0496122_0000313 Ga0496122_0000313_81109_82077 300
118 3300048926 Ga0496123_0021467 Ga0496123_0021467_310_1278 300
119 3300048927 Ga0496124_0000117 Ga0496124_0000117_132355_133323 300
120 3300048928 Ga0496125_0000003 Ga0496125_0000003_1056445_1057413 300
121 3300048929 Ga0496126_0000001 Ga0496126_0000001_132355_133323 300
122 3300050490 nmdc:mga03n38_2248_c1 nmdc:mga03n38_2248_c1_1328_2347 301
123 3300050491 nmdc:mga00v17_9283_c1 nmdc:mga00v17_9283_c1_2870_3889 301
124 3300005347 Ga0070668_100010948 Ga0070668_1000109482 302
125 3300025972 Ga0207668_10001136 Ga0207668_100011365 302
126 3300053080 Ga0500635_0028971 Ga0500635_0028971_525_1481 302
127 3300053131 Ga0500652_003623 Ga0500652_003623_2354_3310 302
128 3300045976 Ga0466967_0026698 Ga0466967_0026698_3210_4238 303
129 3300046461 Ga0495641_0081417 Ga0495641_0081417_19_996 303
130 3300046531 Ga0495665_0106113 Ga0495665_0106113_12_989 303
131 3300046533 Ga0495640_0033962 Ga0495640_0033962_2162_3139 303
132 3300046683 Ga0495658_0057738 Ga0495658_0057738_687_1664 303
133 3300047319 Ga0495674_0055832 Ga0495674_0055832_2197_3174 303
134 3300047673 Ga0495593_0015864 Ga0495593_0015864_482_1459 303
135 3300045976 Ga0466967_0256360 Ga0466967_0256360_439_1356 304
136 3300048921 Ga0496118_0006579 Ga0496118_0006579_11551_12579 304
137 3300049569 Ga0501032_0072347 Ga0501032_0072347_36_1052 304
138 3300049571 Ga0501034_0029170 Ga0501034_0029170_263_1279 304
139 3300049581 Ga0501047_0014438 Ga0501047_0014438_5549_6565 304
140 3300049822 Ga0501035_0001318 Ga0501035_0001318_9017_10033 304
141 3300049823 Ga0501044_0000554 Ga0501044_0000554_14898_15914 304
142 iso_pu_bacteria 2738541274 2738704892 304
143 iso_pu_bacteria 2738543028 2739330062 304
144 3300045976 Ga0466967_0025224 Ga0466967_0025224_2743_3774 305
145 3300046460 Ga0495638_0009718 Ga0495638_0009718_3352_4335 305
146 3300049568 Ga0501031_0144607 Ga0501031_0144607_222_1253 305
147 3300049571 Ga0501034_0013153 Ga0501034_0013153_7298_8329 305
148 3300049573 Ga0501037_0047960 Ga0501037_0047960_1107_2138 305
149 3300049580 Ga0501046_0005675 Ga0501046_0005675_2812_3843 305
150 3300049582 Ga0501048_0041800 Ga0501048_0041800_198_1229 305
151 3300049586 Ga0501070_0000288 Ga0501070_0000288_15314_16345 305
152 3300049586 Ga0501070_0249548 Ga0501070_0249548_313_1338 305
153 3300049590 Ga0501074_0149568 Ga0501074_0149568_118_1149 305
154 3300049742 Ga0501080_0138468 Ga0501080_0138468_766_1797 305
155 3300049822 Ga0501035_0001771 Ga0501035_0001771_7262_8293 305
156 3300049823 Ga0501044_0007276 Ga0501044_0007276_2591_3622 305
157 3300053079 Ga0500610_0021005 Ga0500610_0021005_616_1602 305
158 3300053083 Ga0495655_0036308 Ga0495655_0036308_44_1009 305
159 3300005334 Ga0068869_100375720 Ga0068869_1003757201 306
160 3300005455 Ga0070663_100045570 Ga0070663_1000455701 306
161 3300005618 Ga0068864_100069386 Ga0068864_1000693862 306
162 3300013307 Ga0157372_10565093 Ga0157372_105650931 306
163 3300014325 Ga0163163_10372479 Ga0163163_103724792 306
164 3300021384 Ga0213876_10005270 Ga0213876_100052706 306
165 3300026067 Ga0207678_10018893 Ga0207678_100188936 306
166 3300026142 Ga0207698_10229474 Ga0207698_102294742 306
167 3300028379 Ga0268266_10350694 Ga0268266_103506942 306
168 3300039437 Ga0436365_1253726 Ga0436365_1253726_14012_15121 306
169 3300046455 Ga0495603_0154896 Ga0495603_0154896_104_1072 306
170 3300046460 Ga0495638_0055021 Ga0495638_0055021_462_1478 306
171 3300048911 Ga0496108_0149184 Ga0496108_0149184_974_1942 306
172 3300048913 Ga0496110_0036679 Ga0496110_0036679_484_1452 306
173 3300048915 Ga0496112_0086995 Ga0496112_0086995_691_1659 306
174 3300048916 Ga0496113_0055502 Ga0496113_0055502_1690_2658 306
175 3300048928 Ga0496125_0063170 Ga0496125_0063170_1797_2804 306
176 3300049823 Ga0501044_0303690 Ga0501044_0303690_174_1283 306
177 3300053087 Ga0500643_010395 Ga0500643_010395_469_1485 306
178 3300053158 Ga0500627_0026149 Ga0500627_0026149_1315_2331 306
179 3300053730 Ga0500645_000046 Ga0500645_000046_8303_9310 306
180 iso_pu_bacteria 2744054611 2744956423 306
181 3300005937 Ga0081455_10123072 Ga0081455_101230723 307
182 3300006038 Ga0075365_10013586 Ga0075365_100135866 307
183 3300021388 Ga0213875_10062913 Ga0213875_100629132 307
184 3300037853 Ga0436364_1247608 Ga0436364_1247608_879_1994 307
185 3300050492 nmdc:mga0yw44_76188_c1 nmdc:mga0yw44_76188_c1_639_1589 307
186 3300006048 Ga0075363_100001024 Ga0075363_1000010246 308
187 3300006048 Ga0075363_100001262 Ga0075363_1000012622 308
188 3300006051 Ga0075364_10001909 Ga0075364_100019097 308
189 3300006051 Ga0075364_10265986 Ga0075364_102659862 308
190 3300006178 Ga0075367_10007244 Ga0075367_100072442 308
191 3300006353 Ga0075370_10009951 Ga0075370_100099512 308
192 3300031824 Ga0307413_10117683 Ga0307413_101176832 308
193 3300044656 Ga0466969_0047655 Ga0466969_0047655_715_1830 308
194 3300044684 Ga0466966_0007793 Ga0466966_0007793_4105_5220 308
195 3300044693 Ga0466961_0006278 Ga0466961_0006278_935_2050 308
196 3300044694 Ga0466963_0030038 Ga0466963_0030038_1508_2623 308
197 3300044765 Ga0466970_0006849 Ga0466970_0006849_4016_5131 308
198 3300044842 Ga0466957_0014795 Ga0466957_0014795_644_1759 308
199 3300045049 Ga0466959_0045309 Ga0466959_0045309_558_1673 308
200 3300045836 Ga0466958_0041782 Ga0466958_0041782_82_1197 308
201 3300049571 Ga0501034_0051377 Ga0501034_0051377_590_1516 308
202 3300050491 nmdc:mga00v17_14205_c2 nmdc:mga00v17_14205_c2_2352_3287 308
203 3300050496 nmdc:mga07m45_5019_c2 nmdc:mga07m45_5019_c2_2437_3372 308
204 3300050496 nmdc:mga07m45_69698_c1 nmdc:mga07m45_69698_c1_44_979 308
205 3300006186 Ga0075369_10015844 Ga0075369_100158443 309
206 3300021384 Ga0213876_10041040 Ga0213876_100410402 309
207 3300039437 Ga0436365_1709394 Ga0436365_1709394_45212_46327 309
208 3300039450 Ga0436363_0669456 Ga0436363_0669456_805_1773 309
209 3300041413 Ga0439465_0005521 Ga0439465_0005521_211_1155 309
210 3300050516 nmdc:mga0sz30_14725_c1 nmdc:mga0sz30_14725_c1_658_1602 309
211 iso_pu_bacteria 2842134933 2842139355 309
212 3300021384 Ga0213876_10000447 Ga0213876_100004479 310
213 3300021388 Ga0213875_10010586 Ga0213875_100105865 310
214 3300021388 Ga0213875_10012064 Ga0213875_100120642 310
215 3300037853 Ga0436364_1107971 Ga0436364_1107971_475_1509 310
216 3300037853 Ga0436364_1503047 Ga0436364_1503047_9988_10965 310
217 3300039437 Ga0436365_1083994 Ga0436365_1083994_199556_200590 310
218 3300039437 Ga0436365_1562757 Ga0436365_1562757_78_1157 310
219 3300049586 Ga0501070_0056347 Ga0501070_0056347_1632_2600 310
220 3300049742 Ga0501080_0038536 Ga0501080_0038536_1617_2585 310
221 3300005841 Ga0068863_100128519 Ga0068863_1001285192 311
222 3300028381 Ga0268264_10254793 Ga0268264_102547931 311
223 3300048903 Ga0496100_0000328 Ga0496100_0000328_15988_17004 311
224 3300048904 Ga0496101_0001959 Ga0496101_0001959_6075_7091 311
225 3300048908 Ga0496105_0000700 Ga0496105_0000700_16971_17987 311
226 3300048909 Ga0496106_0008817 Ga0496106_0008817_5554_6570 311
227 3300048910 Ga0496107_0001164 Ga0496107_0001164_6067_7083 311
228 3300048912 Ga0496109_0178018 Ga0496109_0178018_564_1580 311
229 3300048917 Ga0496114_0007462 Ga0496114_0007462_6563_7579 311
230 iso_pu_bacteria 2902799365 2902803422 311
231 3300005331 Ga0070670_100039267 Ga0070670_1000392674 312
232 3300005355 Ga0070671_100017444 Ga0070671_1000174446 312
233 3300005441 Ga0070700_100024325 Ga0070700_1000243252 312
234 3300005548 Ga0070665_100082312 Ga0070665_1000823123 312
235 3300005617 Ga0068859_100355505 Ga0068859_1003555052 312
236 3300005841 Ga0068863_100000733 Ga0068863_10000073317 312
237 3300005842 Ga0068858_100193678 Ga0068858_1001936782 312
238 3300006353 Ga0075370_10186912 Ga0075370_101869122 312
239 3300006931 Ga0097620_100355464 Ga0097620_1003554642 312
240 3300025925 Ga0207650_10070227 Ga0207650_100702274 312
241 3300025931 Ga0207644_10008398 Ga0207644_100083983 312
242 3300025986 Ga0207658_10003398 Ga0207658_100033985 312
243 3300026035 Ga0207703_10151782 Ga0207703_101517822 312
244 3300026088 Ga0207641_10001782 Ga0207641_100017826 312
245 3300028379 Ga0268266_10015094 Ga0268266_100150946 312
246 3300048905 Ga0496102_0006758 Ga0496102_0006758_714_1676 312
247 3300048907 Ga0496104_0004253 Ga0496104_0004253_514_1476 312
248 3300048908 Ga0496105_0179625 Ga0496105_0179625_479_1441 312
249 3300048912 Ga0496109_0162789 Ga0496109_0162789_669_1631 312
250 3300048913 Ga0496110_0050492 Ga0496110_0050492_991_1953 312
251 3300050491 nmdc:mga00v17_68584_c1 nmdc:mga00v17_68584_c1_601_1557 312
252 3300028380 Ga0268265_10014195 Ga0268265_100141953 313
253 3300037853 Ga0436364_1077368 Ga0436364_1077368_945_2054 313
254 3300002077 JGI24744J21845_10002663 JGI24744J21845_100026634 315
255 3300002244 JGI24742J22300_10001233 JGI24742J22300_100012337 315
256 3300005328 Ga0070676_10053086 Ga0070676_100530862 315
257 3300005330 Ga0070690_100016982 Ga0070690_1000169825 315
258 3300005335 Ga0070666_10004595 Ga0070666_100045957 315
259 3300005336 Ga0070680_100523702 Ga0070680_1005237021 315
260 3300005337 Ga0070682_100355231 Ga0070682_1003552311 315
261 3300005338 Ga0068868_100005133 Ga0068868_1000051334 315
262 3300005340 Ga0070689_100011642 Ga0070689_1000116425 315
263 3300005341 Ga0070691_10022154 Ga0070691_100221541 315
264 3300005347 Ga0070668_100015430 Ga0070668_1000154306 315
265 3300005353 Ga0070669_100006848 Ga0070669_1000068489 315
266 3300005356 Ga0070674_100011361 Ga0070674_1000113617 315
267 3300005365 Ga0070688_100025631 Ga0070688_1000256316 315
268 3300005366 Ga0070659_100015605 Ga0070659_1000156053 315
269 3300005367 Ga0070667_100007906 Ga0070667_1000079067 315
270 3300005437 Ga0070710_10000709 Ga0070710_100007096 315
271 3300005439 Ga0070711_100000220 Ga0070711_10000022016 315
272 3300005441 Ga0070700_100004821 Ga0070700_1000048215 315
273 3300005444 Ga0070694_100018953 Ga0070694_1000189531 315
274 3300005456 Ga0070678_100000231 Ga0070678_10000023112 315
275 3300005457 Ga0070662_100003854 Ga0070662_1000038548 315
276 3300005459 Ga0068867_100004155 Ga0068867_1000041559 315
277 3300005545 Ga0070695_100021266 Ga0070695_1000212666 315
278 3300005546 Ga0070696_100000829 Ga0070696_10000082916 315
279 3300005547 Ga0070693_100002255 Ga0070693_1000022556 315
280 3300005548 Ga0070665_100065992 Ga0070665_1000659922 315
281 3300005578 Ga0068854_100000198 Ga0068854_10000019829 315
282 3300005615 Ga0070702_100000682 Ga0070702_1000006828 315
283 3300005617 Ga0068859_100001075 Ga0068859_1000010758 315
284 3300005718 Ga0068866_10000535 Ga0068866_100005357 315
285 3300005719 Ga0068861_100000696 Ga0068861_1000006968 315
286 3300005843 Ga0068860_100003120 Ga0068860_10000312014 315
287 3300005937 Ga0081455_10210942 Ga0081455_102109422 315
288 3300006173 Ga0070716_100009767 Ga0070716_1000097674 315
289 3300006175 Ga0070712_100000493 Ga0070712_1000004938 315
290 3300006237 Ga0097621_100047038 Ga0097621_1000470386 315
291 3300006846 Ga0075430_100026140 Ga0075430_1000261404 315
292 3300006881 Ga0068865_100004610 Ga0068865_1000046102 315
293 3300006931 Ga0097620_100001075 Ga0097620_10000107525 315
294 3300009098 Ga0105245_10001366 Ga0105245_100013667 315
295 3300009101 Ga0105247_10000698 Ga0105247_100006988 315
296 3300009148 Ga0105243_10001379 Ga0105243_100013798 315
297 3300009176 Ga0105242_10001623 Ga0105242_100016235 315
298 3300009177 Ga0105248_10017837 Ga0105248_100178378 315
299 3300009545 Ga0105237_10326437 Ga0105237_103264372 315
300 3300009553 Ga0105249_10008943 Ga0105249_100089435 315
301 3300010375 Ga0105239_10003845 Ga0105239_100038452 315
302 3300013102 Ga0157371_10191929 Ga0157371_101919292 315
303 3300013297 Ga0157378_10012499 Ga0157378_100124992 315
304 3300013306 Ga0163162_10002550 Ga0163162_100025507 315
305 3300013307 Ga0157372_10006318 Ga0157372_100063188 315
306 3300013308 Ga0157375_10000478 Ga0157375_1000047826 315
307 3300014326 Ga0157380_10000372 Ga0157380_100003728 315
308 3300014745 Ga0157377_10037951 Ga0157377_100379512 315
309 3300014968 Ga0157379_10008683 Ga0157379_100086834 315
310 3300017792 Ga0163161_10000595 Ga0163161_1000059524 315
311 3300025898 Ga0207692_10004775 Ga0207692_100047753 315
312 3300025899 Ga0207642_10003082 Ga0207642_100030824 315
313 3300025900 Ga0207710_10006066 Ga0207710_100060661 315
314 3300025901 Ga0207688_10000673 Ga0207688_1000067316 315
315 3300025903 Ga0207680_10024683 Ga0207680_100246832 315
316 3300025904 Ga0207647_10098752 Ga0207647_100987522 315
317 3300025914 Ga0207671_10241436 Ga0207671_102414362 315
318 3300025915 Ga0207693_10000430 Ga0207693_1000043024 315
319 3300025916 Ga0207663_10001439 Ga0207663_100014396 315
320 3300025923 Ga0207681_10013582 Ga0207681_100135826 315
321 3300025927 Ga0207687_10000803 Ga0207687_100008038 315
322 3300025933 Ga0207706_10004981 Ga0207706_100049816 315
323 3300025934 Ga0207686_10005781 Ga0207686_100057812 315
324 3300025935 Ga0207709_10071871 Ga0207709_100718712 315
325 3300025936 Ga0207670_10019020 Ga0207670_100190205 315
326 3300025937 Ga0207669_10001734 Ga0207669_100017346 315
327 3300025938 Ga0207704_10002341 Ga0207704_100023416 315
328 3300025939 Ga0207665_10012050 Ga0207665_100120505 315
329 3300025941 Ga0207711_10006457 Ga0207711_100064575 315
330 3300025961 Ga0207712_10001841 Ga0207712_1000184111 315
331 3300025972 Ga0207668_10005253 Ga0207668_100052538 315
332 3300025981 Ga0207640_10007565 Ga0207640_100075654 315
333 3300025986 Ga0207658_10031600 Ga0207658_100316003 315
334 3300026023 Ga0207677_10020010 Ga0207677_100200105 315
335 3300026035 Ga0207703_10010738 Ga0207703_100107382 315
336 3300026089 Ga0207648_10002033 Ga0207648_100020337 315
337 3300026118 Ga0207675_100000192 Ga0207675_10000019258 315
338 3300026121 Ga0207683_10001366 Ga0207683_100013667 315
339 3300028379 Ga0268266_10012996 Ga0268266_100129966 315
340 3300028381 Ga0268264_10009121 Ga0268264_100091218 315
341 3300035121 Ga0373960_0024543 Ga0373960_0024543_61_1008 315
342 3300035691 Ga0373931_0008130 Ga0373931_0008130_2418_3365 315
343 3300041411 Ga0439466_0016972 Ga0439466_0016972_37_984 315
344 3300044706 Ga0466964_0093246 Ga0466964_0093246_201_1187 315
345 3300044842 Ga0466957_0128335 Ga0466957_0128335_305_1291 315
346 3300048903 Ga0496100_0002987 Ga0496100_0002987_3672_4619 315
347 3300048905 Ga0496102_0004217 Ga0496102_0004217_10030_10977 315
348 3300048906 Ga0496103_0000945 Ga0496103_0000945_14117_15064 315
349 3300048909 Ga0496106_0000901 Ga0496106_0000901_14274_15221 315
350 3300048910 Ga0496107_0000264 Ga0496107_0000264_5509_6456 315
351 3300048917 Ga0496114_0002699 Ga0496114_0002699_6720_7667 315
352 3300048918 Ga0496115_0006427 Ga0496115_0006427_5798_6745 315
353 3300050509 nmdc:mga0qj67_20884_c1 nmdc:mga0qj67_20884_c1_1722_2669 315
354 3300053083 Ga0495655_0046126 Ga0495655_0046126_97_1044 315
355 3300001991 JGI24743J22301_10011056 JGI24743J22301_100110562 316
356 3300002077 JGI24744J21845_10009743 JGI24744J21845_100097431 316
357 3300005338 Ga0068868_100076151 Ga0068868_1000761512 316
358 3300005354 Ga0070675_100239455 Ga0070675_1002394551 316
359 3300005367 Ga0070667_100276630 Ga0070667_1002766302 316
360 3300005437 Ga0070710_10003661 Ga0070710_100036616 316
361 3300005438 Ga0070701_10135708 Ga0070701_101357082 316
362 3300005439 Ga0070711_100011499 Ga0070711_1000114995 316
363 3300005444 Ga0070694_100331106 Ga0070694_1003311061 316
364 3300005455 Ga0070663_100174496 Ga0070663_1001744962 316
365 3300005457 Ga0070662_100211941 Ga0070662_1002119411 316
366 3300005459 Ga0068867_100069339 Ga0068867_1000693393 316
367 3300005543 Ga0070672_100070587 Ga0070672_1000705873 316
368 3300005548 Ga0070665_100031726 Ga0070665_1000317262 316
369 3300005718 Ga0068866_10068026 Ga0068866_100680263 316
370 3300005841 Ga0068863_100524499 Ga0068863_1005244991 316
371 3300005842 Ga0068858_100016817 Ga0068858_1000168173 316
372 3300005843 Ga0068860_100262565 Ga0068860_1002625652 316
373 3300005844 Ga0068862_100029404 Ga0068862_1000294045 316
374 3300006175 Ga0070712_100002576 Ga0070712_1000025769 316
375 3300006846 Ga0075430_100091181 Ga0075430_1000911813 316
376 3300009098 Ga0105245_10101179 Ga0105245_101011792 316
377 3300009147 Ga0114129_10054422 Ga0114129_100544223 316
378 3300009148 Ga0105243_10028935 Ga0105243_100289355 316
379 3300009553 Ga0105249_10110315 Ga0105249_101103152 316
380 3300011119 Ga0105246_10103195 Ga0105246_101031952 316
381 3300013105 Ga0157369_10440308 Ga0157369_104403082 316
382 3300013296 Ga0157374_10003582 Ga0157374_1000358211 316
383 3300013297 Ga0157378_10299236 Ga0157378_102992362 316
384 3300013308 Ga0157375_10184941 Ga0157375_101849411 316
385 3300017792 Ga0163161_10153327 Ga0163161_101533272 316
386 3300025915 Ga0207693_10009155 Ga0207693_1000915510 316
387 3300025916 Ga0207663_10123094 Ga0207663_101230942 316
388 3300025923 Ga0207681_10160299 Ga0207681_101602992 316
389 3300025932 Ga0207690_10044583 Ga0207690_100445833 316
390 3300025933 Ga0207706_10018146 Ga0207706_100181463 316
391 3300025938 Ga0207704_10186564 Ga0207704_101865642 316
392 3300026067 Ga0207678_10035528 Ga0207678_100355283 316
393 3300026075 Ga0207708_10074078 Ga0207708_100740783 316
394 3300026088 Ga0207641_10500299 Ga0207641_105002991 316
395 3300026089 Ga0207648_10050026 Ga0207648_100500264 316
396 3300028379 Ga0268266_10118973 Ga0268266_101189732 316
397 3300031995 Ga0307409_100226651 Ga0307409_1002266512 316
398 3300035121 Ga0373960_0016304 Ga0373960_0016304_755_1705 316
399 3300035691 Ga0373931_0007027 Ga0373931_0007027_3607_4557 316
400 3300041411 Ga0439466_0010297 Ga0439466_0010297_1071_2021 316
401 3300041413 Ga0439465_0002688 Ga0439465_0002688_813_1763 316
402 3300041997 Ga0439431_0009116 Ga0439431_0009116_319_1269 316
403 3300044658 Ga0466972_0072960 Ga0466972_0072960_122_1138 316
404 3300048906 Ga0496103_0107811 Ga0496103_0107811_21_971 316
405 3300048909 Ga0496106_0030695 Ga0496106_0030695_2404_3354 316
406 3300048910 Ga0496107_0179493 Ga0496107_0179493_37_987 316
407 3300048912 Ga0496109_0003787 Ga0496109_0003787_351_1301 316
408 3300048915 Ga0496112_0210987 Ga0496112_0210987_348_1298 316
409 3300050509 nmdc:mga0qj67_70209_c1 nmdc:mga0qj67_70209_c1_935_1885 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

39

199

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.8352 5 310
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.827 5 310
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.8198 5 310
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.8178 5 310
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.7988 5 310
ID Description Score Start End Superfamily
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.8051 5 292 3.40.1090.10
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7928 5 292 3.40.1090.10
5v8sB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7543 4 37 3.40.50.360
af_P0AFR0_2_250_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7486 5 264 3.40.1090.10
af_A0A0P0XFP9_51_260_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7387 5 164 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A4R2SM52-F1-model_v4 deleted 0.9333 6 162
AF-L7LAS5-F1-model_v4 PNPLA domain-containing protein 0.9327 5 309 GO:0016042
GO:0016787
AF-L7LAS5-F1-model_v4 PNPLA domain-containing protein 0.9221 5 309 GO:0016042
GO:0016787
AF-A0A800IHK2-F1-model_v4 Alpha/beta hydrolase 0.9217 5 147 GO:0016042
GO:0016787
AF-A0A661G757-F1-model_v4 Serine protease 0.912 5 174 GO:0006508
GO:0008233
GO:0016042

Feature Viewer

pLDDT pTM Quality
78.16 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map