F436935

General Info

Members Datasets Scaffolds Average Seq Length
409 203 409 84

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_102409118|Ga0068853_1024091181
Length 101
Sequence VIFWAYDLWAYVVGDGSLVRLVFLGKFGDVAPAGLAEIALPGDVRTLKDLKDWVTRQEPLLGAAMDATRTRLIVNQCVAHDLSQAVTDGDEVAFLPPMSGG

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.16
Nodule 0
Rhizoplane 0.49
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 JGI25165J46597_1044068 3300003214 Unclassified 572
3 JGI25153J46596_10000293 3300003215 Bacteria 37385
4 rootH2_10073677 3300003320 Bacteria 1559
5 rootH2_10092111 3300003320 Bacteria 1247
6 Ga0070658_10018011 3300005327 Bacteria 5649
7 Ga0070658_10179289 3300005327 Unclassified 1782
8 Ga0070658_10212863 3300005327 Bacteria 1633
9 Ga0070676_10102460 3300005328 Unclassified 1771
10 Ga0070676_10673191 3300005328 Bacteria 753
11 Ga0070676_10763790 3300005328 Unclassified 711
12 Ga0070683_100024271 3300005329 Bacteria 5429
13 Ga0070683_102288936 3300005329 Unclassified 518
14 Ga0070690_100027112 3300005330 Bacteria 3540
15 Ga0070677_10317178 3300005333 Unclassified 797
16 Ga0068869_100035947 3300005334 Bacteria 3515
17 Ga0070666_10003719 3300005335 Bacteria 9242
18 Ga0070666_11242653 3300005335 Bacteria 555
19 Ga0068868_100086917 3300005338 Unclassified 2514
20 Ga0068868_100092212 3300005338 Bacteria 2441
21 Ga0070660_100022435 3300005339 Bacteria 4668
22 Ga0070660_100040215 3300005339 Bacteria 3558
23 Ga0070689_101109932 3300005340 Bacteria 707
24 Ga0070689_101275354 3300005340 Unclassified 661
25 Ga0070689_101602589 3300005340 Bacteria 591
26 Ga0070687_100220474 3300005343 Unclassified 1161
27 Ga0070661_100051567 3300005344 Unclassified 3011
28 Ga0070668_100385173 3300005347 Unclassified 1194
29 Ga0070675_100098537 3300005354 Unclassified 2459
30 Ga0070675_100272796 3300005354 Bacteria 1485
31 Ga0070674_100526628 3300005356 Bacteria 988
32 Ga0070673_100245923 3300005364 Bacteria 1557
33 Ga0070659_100160460 3300005366 Bacteria 1838
34 Ga0070659_100359628 3300005366 Bacteria 1223
35 Ga0070667_100013558 3300005367 Bacteria 6734
36 Ga0070667_100086160 3300005367 Bacteria 2695
37 Ga0070714_101772403 3300005435 Bacteria 603
38 Ga0070714_102313088 3300005435 Bacteria 523
39 Ga0070713_100604202 3300005436 Bacteria 1042
40 Ga0070694_101339599 3300005444 Unclassified 603
41 Ga0070663_100309093 3300005455 Bacteria 1268
42 Ga0070663_101440752 3300005455 Bacteria 611
43 Ga0070678_100013834 3300005456 Bacteria 5072
44 Ga0070678_100427516 3300005456 Unclassified 1156
45 Ga0070681_10235668 3300005458 Bacteria 1744
46 Ga0068867_100001750 3300005459 Bacteria 15119
47 Ga0068867_100014240 3300005459 Bacteria 5634
48 Ga0068867_100740667 3300005459 Bacteria 871
49 Ga0070679_100097620 3300005530 Bacteria 2926
50 Ga0070679_100581734 3300005530 Bacteria 1063
51 Ga0070679_101237314 3300005530 Unclassified 692
52 Ga0070684_100295366 3300005535 Unclassified 1486
53 Ga0070684_101004003 3300005535 Bacteria 783
54 Ga0068853_100137953 3300005539 Unclassified 2188
55 Ga0068853_100775844 3300005539 Bacteria 917
56 Ga0068853_101196524 3300005539 Bacteria 734
57 Ga0068853_101568071 3300005539 Unclassified 638
58 Ga0068853_102409118 3300005539 Bacteria 510
59 Ga0070672_101683860 3300005543 Unclassified 570
60 Ga0070693_100253487 3300005547 Bacteria 1167
61 Ga0070693_100359114 3300005547 Bacteria 999
62 Ga0070665_100095824 3300005548 Bacteria 2972
63 Ga0070665_100144804 3300005548 Bacteria 2380
64 Ga0070665_100687065 3300005548 Bacteria 1036
65 Ga0070665_100855952 3300005548 Bacteria 922
66 Ga0070665_101079661 3300005548 Unclassified 814
67 Ga0070665_101872276 3300005548 Bacteria 606
68 Ga0068855_100196276 3300005563 Bacteria 2274
69 Ga0068855_100460894 3300005563 Unclassified 1386
70 Ga0068855_100469360 3300005563 Bacteria 1371
71 Ga0068855_101081593 3300005563 Unclassified 839
72 Ga0068855_102378773 3300005563 Unclassified 529
73 Ga0068857_100068654 3300005577 Bacteria 3155
74 Ga0068857_100785929 3300005577 Unclassified 908
75 Ga0068857_100988197 3300005577 Bacteria 810
76 Ga0068857_101700745 3300005577 Unclassified 617
77 Ga0068854_101169423 3300005578 Bacteria 688
78 Ga0068856_100260128 3300005614 Bacteria 1751
79 Ga0068856_102475023 3300005614 Bacteria 526
80 Ga0070702_100475137 3300005615 Unclassified 912
81 Ga0068852_100078820 3300005616 Bacteria 2916
82 Ga0068864_100057764 3300005618 Unclassified 3352
83 Ga0068864_100199175 3300005618 Bacteria 1839
84 Ga0068866_10032692 3300005718 Bacteria 2517
85 Ga0068851_10630115 3300005834 Unclassified 655
86 Ga0068870_10038717 3300005840 Bacteria 2464
87 Ga0068870_10411843 3300005840 Unclassified 882
88 Ga0068863_100199218 3300005841 Bacteria 1926
89 Ga0068858_100119044 3300005842 Bacteria 2469
90 Ga0068858_100184195 3300005842 Bacteria 1972
91 Ga0068860_100148694 3300005843 Bacteria 2255
92 Ga0068860_100160498 3300005843 Bacteria 2167
93 Ga0068862_100752760 3300005844 Bacteria 948
94 Ga0081455_10659130 3300005937 Unclassified 673
95 Ga0097621_100000046 3300006237 Bacteria 64086
96 Ga0097621_100137035 3300006237 Bacteria 2088
97 Ga0097621_100137680 3300006237 Bacteria 2084
98 Ga0097621_100537449 3300006237 Bacteria 1063
99 Ga0097621_101401199 3300006237 Unclassified 662
100 Ga0068871_100000004 3300006358 Bacteria 123358
101 Ga0068871_100141048 3300006358 Unclassified 2049
102 Ga0068871_100206565 3300006358 Bacteria 1697
103 Ga0068871_101957314 3300006358 Unclassified 557
104 Ga0068865_100367048 3300006881 Unclassified 1170
105 Ga0097620_101032773 3300006931 Bacteria 903
106 Ga0105240_10072822 3300009093 Bacteria 4245
107 Ga0105240_10080362 3300009093 Bacteria 4010
108 Ga0105245_10198008 3300009098 Unclassified 1928
109 Ga0105245_13082146 3300009098 Bacteria 516
110 Ga0105243_10214093 3300009148 Bacteria 1698
111 Ga0105241_10026371 3300009174 Bacteria 4323
112 Ga0105241_10142715 3300009174 Bacteria 1952
113 Ga0105241_10178164 3300009174 Unclassified 1761
114 Ga0105241_10212141 3300009174 Bacteria 1623
115 Ga0105241_10533268 3300009174 Bacteria 1051
116 Ga0105242_10649637 3300009176 Bacteria 1026
117 Ga0105242_12102893 3300009176 Unclassified 608
118 Ga0105242_12211772 3300009176 Bacteria 595
119 Ga0105248_10015941 3300009177 Bacteria 8277
120 Ga0105248_10774103 3300009177 Unclassified 1083
121 Ga0105248_10817835 3300009177 Bacteria 1052
122 Ga0105237_10054465 3300009545 Bacteria 4008
123 Ga0105237_10098430 3300009545 Bacteria 2916
124 Ga0105237_10108919 3300009545 Unclassified 2761
125 Ga0105237_10122696 3300009545 Unclassified 2592
126 Ga0105237_12178010 3300009545 Bacteria 564
127 Ga0105238_10034382 3300009551 Bacteria 5157
128 Ga0105238_10035871 3300009551 Bacteria 5041
129 Ga0105238_10096473 3300009551 Bacteria 2943
130 Ga0105238_10167382 3300009551 Bacteria 2174
131 Ga0105238_11721866 3300009551 Unclassified 658
132 Ga0105238_12364846 3300009551 Unclassified 567
133 Ga0105249_10053552 3300009553 Bacteria 3688
134 Ga0105239_10102347 3300010375 Bacteria 3170
135 Ga0105239_10208061 3300010375 Bacteria 2192
136 Ga0105239_10552749 3300010375 Bacteria 1311
137 Ga0105239_10570856 3300010375 Bacteria 1289
138 Ga0105239_11215323 3300010375 Bacteria 869
139 Ga0105239_12796218 3300010375 Bacteria 570
140 Ga0157371_10904997 3300013102 Bacteria 669
141 Ga0157370_11179415 3300013104 Bacteria 691
142 Ga0157369_10858438 3300013105 Bacteria 932
143 Ga0157369_10998204 3300013105 Bacteria 857
144 Ga0157374_10866565 3300013296 Bacteria 920
145 Ga0157378_10012780 3300013297 Bacteria 7349
146 Ga0157378_10637011 3300013297 Bacteria 1080
147 Ga0157378_10988105 3300013297 Bacteria 875
148 Ga0157378_13151060 3300013297 Bacteria 512
149 Ga0163162_10003970 3300013306 Bacteria 14184
150 Ga0163162_11383130 3300013306 Bacteria 801
151 Ga0163162_11619300 3300013306 Bacteria 739
152 Ga0157372_10024209 3300013307 Bacteria 6591
153 Ga0157375_10011357 3300013308 Bacteria 7862
154 Ga0157375_11338014 3300013308 Bacteria 843
155 Ga0157375_11573478 3300013308 Unclassified 777
156 Ga0163163_10014059 3300014325 Bacteria 7348
157 Ga0163163_10158809 3300014325 Bacteria 2306
158 Ga0163163_10268063 3300014325 Unclassified 1759
159 Ga0163163_13228616 3300014325 Unclassified 508
160 Ga0157380_10307803 3300014326 Bacteria 1463
161 Ga0157379_10000605 3300014968 Bacteria 28967
162 Ga0157379_10095234 3300014968 Bacteria 2671
163 Ga0157379_10163986 3300014968 Bacteria 2006
164 Ga0157379_10585592 3300014968 Unclassified 1040
165 Ga0157376_10145202 3300014969 Unclassified 2133
166 Ga0157376_10370868 3300014969 Bacteria 1376
167 Ga0157376_13130279 3300014969 Unclassified 501
168 Ga0209233_1000013 3300025261 Bacteria 1013785
169 Ga0209233_1007476 3300025261 Bacteria 3458
170 Ga0209758_1000013 3300025297 Bacteria 873003
171 Ga0207682_10444950 3300025893 Unclassified 613
172 Ga0207642_10009949 3300025899 Bacteria 3331
173 Ga0207688_10016755 3300025901 Bacteria 3978
174 Ga0207680_10015411 3300025903 Bacteria 3988
175 Ga0207680_10042591 3300025903 Bacteria 2657
176 Ga0207680_10859796 3300025903 Bacteria 650
177 Ga0207680_11195579 3300025903 Bacteria 542
178 Ga0207645_10027200 3300025907 Bacteria 3695
179 Ga0207643_10092806 3300025908 Bacteria 1762
180 Ga0207643_10298755 3300025908 Bacteria 1002
181 Ga0207705_10066388 3300025909 Unclassified 2609
182 Ga0207705_10180448 3300025909 Unclassified 1593
183 Ga0207705_11410596 3300025909 Unclassified 529
184 Ga0207705_11537184 3300025909 Unclassified 503
185 Ga0207654_10009595 3300025911 Bacteria 4920
186 Ga0207654_11205453 3300025911 Bacteria 552
187 Ga0207707_11406021 3300025912 Unclassified 556
188 Ga0207695_10157075 3300025913 Bacteria 2208
189 Ga0207671_10111432 3300025914 Bacteria 2082
190 Ga0207671_10430570 3300025914 Unclassified 1050
191 Ga0207671_10471044 3300025914 Bacteria 1001
192 Ga0207671_10539858 3300025914 Unclassified 930
193 Ga0207671_11129900 3300025914 Unclassified 615
194 Ga0207663_10726852 3300025916 Bacteria 787
195 Ga0207662_10111557 3300025918 Bacteria 1706
196 Ga0207657_10008929 3300025919 Bacteria 10128
197 Ga0207657_10062954 3300025919 Bacteria 3174
198 Ga0207649_10372544 3300025920 Bacteria 1062
199 Ga0207652_10305800 3300025921 Unclassified 1435
200 Ga0207652_10514143 3300025921 Bacteria 1078
201 Ga0207694_10064253 3300025924 Unclassified 2861
202 Ga0207694_10082000 3300025924 Unclassified 2534
203 Ga0207694_11355554 3300025924 Bacteria 601
204 Ga0207694_11892100 3300025924 Unclassified 501
205 Ga0207650_10194592 3300025925 Bacteria 1622
206 Ga0207659_10027797 3300025926 Bacteria 3834
207 Ga0207659_10109267 3300025926 Bacteria 2099
208 Ga0207687_10280188 3300025927 Unclassified 1336
209 Ga0207700_11038682 3300025928 Bacteria 733
210 Ga0207664_11345084 3300025929 Bacteria 634
211 Ga0207686_10315749 3300025934 Bacteria 1165
212 Ga0207704_10271778 3300025938 Bacteria 1284
213 Ga0207691_10976032 3300025940 Bacteria 707
214 Ga0207711_10014304 3300025941 Bacteria 6590
215 Ga0207711_10802359 3300025941 Unclassified 877
216 Ga0207689_10097246 3300025942 Bacteria 2418
217 Ga0207689_10110017 3300025942 Bacteria 2264
218 Ga0207689_10117701 3300025942 Unclassified 2185
219 Ga0207661_10708422 3300025944 Bacteria 926
220 Ga0207667_10066953 3300025949 Bacteria 3742
221 Ga0207667_10252112 3300025949 Bacteria 1805
222 Ga0207667_10486235 3300025949 Unclassified 1253
223 Ga0207667_10582839 3300025949 Bacteria 1129
224 Ga0207712_10329877 3300025961 Bacteria 1262
225 Ga0207668_12015712 3300025972 Bacteria 520
226 Ga0207640_11139957 3300025981 Bacteria 691
227 Ga0207658_10024071 3300025986 Bacteria 4255
228 Ga0207658_10066504 3300025986 Bacteria 2711
229 Ga0207677_10043403 3300026023 Unclassified 2989
230 Ga0207677_10093871 3300026023 Unclassified 2189
231 Ga0207677_11056568 3300026023 Bacteria 738
232 Ga0207677_11135088 3300026023 Unclassified 714
233 Ga0207703_10046062 3300026035 Bacteria 3511
234 Ga0207703_10125427 3300026035 Bacteria 2210
235 Ga0207703_10421028 3300026035 Unclassified 1243
236 Ga0207703_10546331 3300026035 Unclassified 1092
237 Ga0207703_12204193 3300026035 Bacteria 527
238 Ga0207639_10177653 3300026041 Unclassified 1808
239 Ga0207639_11450388 3300026041 Bacteria 644
240 Ga0207639_11630665 3300026041 Bacteria 605
241 Ga0207639_11765904 3300026041 Bacteria 579
242 Ga0207678_10278224 3300026067 Bacteria 1436
243 Ga0207678_11300259 3300026067 Unclassified 643
244 Ga0207678_11846477 3300026067 Bacteria 528
245 Ga0207702_10359101 3300026078 Bacteria 1396
246 Ga0207702_10501411 3300026078 Bacteria 1183
247 Ga0207702_10942921 3300026078 Bacteria 856
248 Ga0207702_11899926 3300026078 Bacteria 587
249 Ga0207641_10063110 3300026088 Bacteria 3164
250 Ga0207648_10019524 3300026089 Bacteria 6117
251 Ga0207648_10030153 3300026089 Bacteria 4807
252 Ga0207676_10055023 3300026095 Bacteria 3121
253 Ga0207676_10451851 3300026095 Unclassified 1211
254 Ga0207676_12002536 3300026095 Bacteria 578
255 Ga0207674_10079742 3300026116 Bacteria 3277
256 Ga0207674_10769158 3300026116 Bacteria 929
257 Ga0207674_10809488 3300026116 Bacteria 904
258 Ga0207674_11197310 3300026116 Unclassified 729
259 Ga0207675_100112676 3300026118 Bacteria 2568
260 Ga0207675_100269014 3300026118 Unclassified 1654
261 Ga0207683_10008775 3300026121 Bacteria 8632
262 Ga0207683_10048331 3300026121 Bacteria 3726
263 Ga0207698_11851748 3300026142 Bacteria 618
264 Ga0268266_10014103 3300028379 Bacteria 6880
265 Ga0268266_10026894 3300028379 Bacteria 4895
266 Ga0268266_10051777 3300028379 Bacteria 3525
267 Ga0268266_10142830 3300028379 Unclassified 2149
268 Ga0268266_10863463 3300028379 Bacteria 875
269 Ga0268265_10840488 3300028380 Unclassified 898
270 Ga0268265_11255632 3300028380 Bacteria 740
271 Ga0268264_10054695 3300028381 Bacteria 3333
272 Ga0268264_10102962 3300028381 Bacteria 2485
273 Ga0265318_10000568 3300028577 Bacteria 26046
274 Ga0307517_10135718 3300028786 Bacteria 1751
275 Ga0265338_10018601 3300028800 Bacteria 7424
276 Ga0265324_10061427 3300029957 Bacteria 1284
277 Ga0265330_10307870 3300031235 Bacteria 668
278 Ga0265332_10054006 3300031238 Bacteria 1724
279 Ga0265328_10467138 3300031239 Unclassified 500
280 Ga0265340_10178172 3300031247 Bacteria 961
281 Ga0265331_10018706 3300031250 Bacteria 3586
282 Ga0265331_10122366 3300031250 Bacteria 1189
283 Ga0265331_10326058 3300031250 Bacteria 688
284 Ga0265331_10399957 3300031250 Bacteria 616
285 Ga0265327_10001365 3300031251 Bacteria 31449
286 Ga0307408_100164827 3300031548 Bacteria 1764
287 Ga0265313_10002805 3300031595 Bacteria 14705
288 Ga0265314_10005911 3300031711 Bacteria 10941
289 Ga0265314_10070200 3300031711 Bacteria 2348
290 Ga0265314_10141162 3300031711 Bacteria 1489
291 Ga0265314_10644840 3300031711 Unclassified 541
292 Ga0265342_10177334 3300031712 Bacteria 1169
293 Ga0373932_0273192 3300035112 Bacteria 623
294 Ga0373931_0048042 3300035691 Bacteria 2261
295 Ga0373935_0905212 3300035692 Unclassified 654
296 Ga0373937_1140364 3300036401 Bacteria 728
297 Ga0395900_0186723 3300037418 Bacteria 2104
298 Ga0395898_0077554 3300037466 Bacteria 3208
299 Ga0436364_1074319 3300037853 Bacteria 1306
300 Ga0395901_0024068 3300038443 Bacteria 6247
301 Ga0395901_0414661 3300038443 Bacteria 1382
302 Ga0436360_0991596 3300039438 Bacteria 818
303 Ga0495651_0255009 3300046462 Bacteria 1196
304 Ga0495618_0671398 3300046514 Unclassified 611
305 Ga0495652_0281856 3300046529 Bacteria 1216
306 Ga0495611_0208282 3300046648 Bacteria 911
307 Ga0495625_0064346 3300046660 Bacteria 2587
308 Ga0495613_0000680 3300046689 Bacteria 26874
309 Ga0495600_0485089 3300046809 Bacteria 761
310 Ga0495600_0677116 3300046809 Unclassified 622
311 Ga0495600_0680937 3300046809 Unclassified 620
312 Ga0495672_0315558 3300047320 Unclassified 736
313 Ga0495593_0584514 3300047673 Unclassified 560
314 Ga0495602_0397970 3300048088 Bacteria 983
315 Ga0496106_0043506 3300048909 Bacteria 3370
316 Ga0496115_0818434 3300048918 Bacteria 724
317 Ga0496121_0003884 3300048924 Bacteria 20773
318 Ga0496126_0113794 3300048929 Bacteria 2355
319 Ga0501031_0002923 3300049568 Bacteria 10931
320 Ga0501032_0014943 3300049569 Bacteria 5491
321 Ga0501032_0380002 3300049569 Bacteria 908
322 Ga0501033_0003655 3300049570 Bacteria 12540
323 Ga0501033_0006469 3300049570 Bacteria 9168
324 Ga0501033_0035169 3300049570 Bacteria 3756
325 Ga0501033_0056715 3300049570 Bacteria 2895
326 Ga0501033_0115615 3300049570 Unclassified 1949
327 Ga0501036_0004570 3300049572 Bacteria 11178
328 Ga0501037_0011755 3300049573 Bacteria 6446
329 Ga0501037_0148322 3300049573 Bacteria 1677
330 Ga0501037_1123653 3300049573 Unclassified 508
331 Ga0501038_0045179 3300049574 Bacteria 3824
332 Ga0501038_0223731 3300049574 Bacteria 1500
333 Ga0501039_0012070 3300049575 Bacteria 6587
334 Ga0501039_0818955 3300049575 Bacteria 726
335 Ga0501040_0261835 3300049576 Bacteria 1234
336 Ga0501041_0467743 3300049577 Bacteria 801
337 Ga0501042_0005927 3300049578 Bacteria 7905
338 Ga0501043_0049084 3300049579 Bacteria 3317
339 Ga0501043_0732455 3300049579 Unclassified 720
340 Ga0501043_1117886 3300049579 Bacteria 556
341 Ga0501046_0001636 3300049580 Bacteria 21447
342 Ga0501047_0004000 3300049581 Bacteria 13852
343 Ga0501047_0030936 3300049581 Bacteria 5161
344 Ga0501047_0065983 3300049581 Bacteria 3488
345 Ga0501047_0547744 3300049581 Bacteria 981
346 Ga0501047_0675889 3300049581 Bacteria 851
347 Ga0501047_0939833 3300049581 Archaea 678
348 Ga0501047_1119025 3300049581 Unclassified 601
349 Ga0501047_1198771 3300049581 Bacteria 573
350 Ga0501048_0004393 3300049582 Bacteria 10738
351 Ga0501067_0001919 3300049583 Bacteria 11420
352 Ga0501068_0333030 3300049584 Bacteria 974
353 Ga0501069_0008224 3300049585 Bacteria 5477
354 Ga0501069_0788362 3300049585 Bacteria 575
355 Ga0501070_0004446 3300049586 Bacteria 12038
356 Ga0501070_0314609 3300049586 Bacteria 1274
357 Ga0501071_0083107 3300049587 Bacteria 2346
358 Ga0501072_0003693 3300049588 Bacteria 11542
359 Ga0501073_0004055 3300049589 Bacteria 11006
360 Ga0501073_0026156 3300049589 Bacteria 4182
361 Ga0501073_0211957 3300049589 Bacteria 1339
362 Ga0501073_0345987 3300049589 Bacteria 1026
363 Ga0501074_0001155 3300049590 Bacteria 17276
364 Ga0501074_0100241 3300049590 Bacteria 2073
365 Ga0501075_0821213 3300049591 Bacteria 707
366 Ga0501079_0003788 3300049741 Bacteria 11169
367 Ga0501080_0001040 3300049742 Bacteria 22818
368 Ga0501080_0457530 3300049742 Bacteria 1144
369 Ga0501080_0831461 3300049742 Bacteria 808
370 Ga0501080_1203423 3300049742 Unclassified 651
371 Ga0501083_0004091 3300049744 Bacteria 10268
372 Ga0501083_0011929 3300049744 Bacteria 6088
373 Ga0501083_0031695 3300049744 Bacteria 3628
374 Ga0501083_0123219 3300049744 Bacteria 1700
375 Ga0501035_0008173 3300049822 Bacteria 9749
376 Ga0501035_0009408 3300049822 Bacteria 9085
377 Ga0501035_0137159 3300049822 Bacteria 2129
378 Ga0501035_0231853 3300049822 Bacteria 1573
379 Ga0501035_0487499 3300049822 Unclassified 1016
380 Ga0501035_1149818 3300049822 Unclassified 604
381 Ga0501044_0006311 3300049823 Bacteria 13108
382 Ga0501044_0043283 3300049823 Bacteria 4679
383 Ga0501044_0047113 3300049823 Bacteria 4460
384 Ga0501044_0214436 3300049823 Bacteria 1878
385 Ga0501044_0232587 3300049823 Unclassified 1790
386 Ga0501044_0434287 3300049823 Unclassified 1222
387 Ga0501044_0450083 3300049823 Bacteria 1194
388 Ga0501044_0532771 3300049823 Bacteria 1073
389 Ga0501044_0764341 3300049823 Bacteria 848
390 Ga0501044_0776496 3300049823 Bacteria 839
391 Ga0501044_1140496 3300049823 Bacteria 648
392 Ga0500643_000021 3300053087 Bacteria 284326
393 Ga0500643_054768 3300053087 Bacteria 1131
394 Ga0500583_0345466 3300053092 Bacteria 722
395 Ga0500641_0250732 3300053096 Bacteria 742
396 Ga0500572_016345 3300053111 Bacteria 1888
397 Ga0500593_282539 3300053117 Unclassified 542
398 Ga0500594_0073466 3300053118 Bacteria 1010
399 Ga0500652_189987 3300053131 Bacteria 838
400 Ga0500559_0136919 3300053136 Bacteria 1145
401 Ga0500568_0028081 3300053139 Bacteria 2348
402 Ga0500611_148341 3300053727 Unclassified 642
403 Ga0501084_0009877 3300054114 Bacteria 7887
404 Ga0501084_0330010 3300054114 Bacteria 1288
405 Ga0501082_0007125 3300060353 Bacteria 9641
406 Ga0501082_0013584 3300060353 Bacteria 6997
407 Ga0501082_0062504 3300060353 Bacteria 3205
408 Ga0501082_0277596 3300060353 Bacteria 1459
409 Ga0530510_0304520 3300061734 Bacteria 1193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0137159 Ga0501035_0137159_233_442 62
2 3300005614 Ga0068856_102475023 Ga0068856_1024750231 76
3 3300026078 Ga0207702_11899926 Ga0207702_118999262 76
4 3300005327 Ga0070658_10018011 Ga0070658_100180114 80
5 3300005339 Ga0070660_100040215 Ga0070660_1000402152 80
6 3300005834 Ga0068851_10630115 Ga0068851_106301152 80
7 3300010375 Ga0105239_10552749 Ga0105239_105527493 80
8 3300025909 Ga0207705_10066388 Ga0207705_100663885 80
9 3300025919 Ga0207657_10062954 Ga0207657_100629542 80
10 3300025925 Ga0207650_10194592 Ga0207650_101945924 80
11 3300037853 Ga0436364_1074319 Ga0436364_1074319_503_769 80
12 3300005366 Ga0070659_100160460 Ga0070659_1001604604 81
13 3300005435 Ga0070714_102313088 Ga0070714_1023130881 81
14 3300009093 Ga0105240_10072822 Ga0105240_100728225 81
15 3300009174 Ga0105241_10212141 Ga0105241_102121411 81
16 3300009177 Ga0105248_10774103 Ga0105248_107741032 81
17 3300009545 Ga0105237_10098430 Ga0105237_100984303 81
18 3300009551 Ga0105238_10034382 Ga0105238_100343827 81
19 3300009551 Ga0105238_11721866 Ga0105238_117218661 81
20 3300009551 Ga0105238_12364846 Ga0105238_123648462 81
21 3300010375 Ga0105239_10570856 Ga0105239_105708562 81
22 3300010375 Ga0105239_11215323 Ga0105239_112153232 81
23 3300010375 Ga0105239_12796218 Ga0105239_127962182 81
24 3300013102 Ga0157371_10904997 Ga0157371_109049971 81
25 3300013105 Ga0157369_10858438 Ga0157369_108584383 81
26 3300014325 Ga0163163_10268063 Ga0163163_102680632 81
27 3300014968 Ga0157379_10585592 Ga0157379_105855922 81
28 3300025924 Ga0207694_11892100 Ga0207694_118921001 81
29 3300025929 Ga0207664_11345084 Ga0207664_113450842 81
30 3300026142 Ga0207698_11851748 Ga0207698_118517482 81
31 3300028800 Ga0265338_10018601 Ga0265338_100186012 81
32 3300029957 Ga0265324_10061427 Ga0265324_100614273 81
33 3300031250 Ga0265331_10122366 Ga0265331_101223662 81
34 3300031251 Ga0265327_10001365 Ga0265327_1000136514 81
35 3300031711 Ga0265314_10070200 Ga0265314_100702002 81
36 3300031711 Ga0265314_10644840 Ga0265314_106448402 81
37 3300037418 Ga0395900_0186723 Ga0395900_0186723_526_771 81
38 3300037466 Ga0395898_0077554 Ga0395898_0077554_445_690 81
39 3300038443 Ga0395901_0024068 Ga0395901_0024068_693_938 81
40 3300038443 Ga0395901_0414661 Ga0395901_0414661_778_1023 81
41 3300046462 Ga0495651_0255009 Ga0495651_0255009_634_900 81
42 3300046529 Ga0495652_0281856 Ga0495652_0281856_76_342 81
43 3300046689 Ga0495613_0000680 Ga0495613_0000680_19399_19665 81
44 3300046809 Ga0495600_0485089 Ga0495600_0485089_408_674 81
45 3300048909 Ga0496106_0043506 Ga0496106_0043506_2801_3046 81
46 3300048918 Ga0496115_0818434 Ga0496115_0818434_225_470 81
47 3300049581 Ga0501047_0939833 Ga0501047_0939833_210_458 81
48 3300049581 Ga0501047_1119025 Ga0501047_1119025_275_520 81
49 3300049822 Ga0501035_1149818 Ga0501035_1149818_115_360 81
50 3300049823 Ga0501044_0532771 Ga0501044_0532771_196_441 81
51 3300053111 Ga0500572_016345 Ga0500572_016345_195_440 81
52 3300053131 Ga0500652_189987 Ga0500652_189987_509_754 81
53 3300005328 Ga0070676_10673191 Ga0070676_106731912 82
54 3300005329 Ga0070683_100024271 Ga0070683_1000242715 82
55 3300005330 Ga0070690_100027112 Ga0070690_1000271121 82
56 3300005335 Ga0070666_10003719 Ga0070666_100037193 82
57 3300005338 Ga0068868_100092212 Ga0068868_1000922123 82
58 3300005340 Ga0070689_101602589 Ga0070689_1016025891 82
59 3300005344 Ga0070661_100051567 Ga0070661_1000515673 82
60 3300005367 Ga0070667_100013558 Ga0070667_1000135586 82
61 3300005367 Ga0070667_100086160 Ga0070667_1000861604 82
62 3300005435 Ga0070714_101772403 Ga0070714_1017724032 82
63 3300005455 Ga0070663_100309093 Ga0070663_1003090933 82
64 3300005456 Ga0070678_100013834 Ga0070678_1000138344 82
65 3300005459 Ga0068867_100014240 Ga0068867_1000142403 82
66 3300005530 Ga0070679_101237314 Ga0070679_1012373142 82
67 3300005535 Ga0070684_101004003 Ga0070684_1010040031 82
68 3300005539 Ga0068853_100137953 Ga0068853_1001379533 82
69 3300005543 Ga0070672_101683860 Ga0070672_1016838601 82
70 3300005548 Ga0070665_100687065 Ga0070665_1006870653 82
71 3300005563 Ga0068855_100469360 Ga0068855_1004693602 82
72 3300005578 Ga0068854_101169423 Ga0068854_1011694232 82
73 3300005614 Ga0068856_100260128 Ga0068856_1002601282 82
74 3300005616 Ga0068852_100078820 Ga0068852_1000788204 82
75 3300005618 Ga0068864_100057764 Ga0068864_1000577642 82
76 3300005618 Ga0068864_100199175 Ga0068864_1001991754 82
77 3300005718 Ga0068866_10032692 Ga0068866_100326923 82
78 3300005840 Ga0068870_10038717 Ga0068870_100387171 82
79 3300005842 Ga0068858_100119044 Ga0068858_1001190442 82
80 3300005843 Ga0068860_100148694 Ga0068860_1001486944 82
81 3300005843 Ga0068860_100160498 Ga0068860_1001604982 82
82 3300005844 Ga0068862_100752760 Ga0068862_1007527602 82
83 3300006237 Ga0097621_100137680 Ga0097621_1001376803 82
84 3300006237 Ga0097621_101401199 Ga0097621_1014011991 82
85 3300006358 Ga0068871_100141048 Ga0068871_1001410482 82
86 3300006358 Ga0068871_100206565 Ga0068871_1002065652 82
87 3300006881 Ga0068865_100367048 Ga0068865_1003670482 82
88 3300009093 Ga0105240_10080362 Ga0105240_100803622 82
89 3300009098 Ga0105245_10198008 Ga0105245_101980083 82
90 3300009174 Ga0105241_10142715 Ga0105241_101427153 82
91 3300009174 Ga0105241_10178164 Ga0105241_101781642 82
92 3300009176 Ga0105242_10649637 Ga0105242_106496372 82
93 3300009176 Ga0105242_12102893 Ga0105242_121028932 82
94 3300009545 Ga0105237_10122696 Ga0105237_101226963 82
95 3300009551 Ga0105238_10035871 Ga0105238_100358714 82
96 3300009551 Ga0105238_10096473 Ga0105238_100964735 82
97 3300010375 Ga0105239_10102347 Ga0105239_101023473 82
98 3300013296 Ga0157374_10866565 Ga0157374_108665652 82
99 3300013297 Ga0157378_10012780 Ga0157378_100127805 82
100 3300013297 Ga0157378_10637011 Ga0157378_106370113 82
101 3300013306 Ga0163162_10003970 Ga0163162_100039704 82
102 3300013306 Ga0163162_11383130 Ga0163162_113831301 82
103 3300013307 Ga0157372_10024209 Ga0157372_100242095 82
104 3300013308 Ga0157375_10011357 Ga0157375_100113576 82
105 3300014325 Ga0163163_10014059 Ga0163163_100140595 82
106 3300014325 Ga0163163_10158809 Ga0163163_101588093 82
107 3300014968 Ga0157379_10095234 Ga0157379_100952343 82
108 3300014969 Ga0157376_10145202 Ga0157376_101452023 82
109 3300025899 Ga0207642_10009949 Ga0207642_100099491 82
110 3300025903 Ga0207680_10015411 Ga0207680_100154114 82
111 3300025903 Ga0207680_10042591 Ga0207680_100425913 82
112 3300025908 Ga0207643_10298755 Ga0207643_102987552 82
113 3300025911 Ga0207654_10009595 Ga0207654_100095955 82
114 3300025914 Ga0207671_10111432 Ga0207671_101114324 82
115 3300025914 Ga0207671_10539858 Ga0207671_105398582 82
116 3300025916 Ga0207663_10726852 Ga0207663_107268522 82
117 3300025920 Ga0207649_10372544 Ga0207649_103725442 82
118 3300025924 Ga0207694_10082000 Ga0207694_100820003 82
119 3300025927 Ga0207687_10280188 Ga0207687_102801883 82
120 3300025934 Ga0207686_10315749 Ga0207686_103157492 82
121 3300025940 Ga0207691_10976032 Ga0207691_109760321 82
122 3300025942 Ga0207689_10097246 Ga0207689_100972461 82
123 3300025942 Ga0207689_10110017 Ga0207689_101100174 82
124 3300025949 Ga0207667_10252112 Ga0207667_102521123 82
125 3300025972 Ga0207668_12015712 Ga0207668_120157122 82
126 3300025981 Ga0207640_11139957 Ga0207640_111399572 82
127 3300025986 Ga0207658_10024071 Ga0207658_100240714 82
128 3300025986 Ga0207658_10066504 Ga0207658_100665043 82
129 3300026023 Ga0207677_10043403 Ga0207677_100434032 82
130 3300026023 Ga0207677_11135088 Ga0207677_111350882 82
131 3300026035 Ga0207703_10125427 Ga0207703_101254272 82
132 3300026041 Ga0207639_10177653 Ga0207639_101776532 82
133 3300026067 Ga0207678_10278224 Ga0207678_102782243 82
134 3300026078 Ga0207702_10501411 Ga0207702_105014111 82
135 3300026089 Ga0207648_10030153 Ga0207648_100301535 82
136 3300026095 Ga0207676_10055023 Ga0207676_100550233 82
137 3300026095 Ga0207676_10451851 Ga0207676_104518512 82
138 3300026095 Ga0207676_12002536 Ga0207676_120025361 82
139 3300026116 Ga0207674_10079742 Ga0207674_100797422 82
140 3300026118 Ga0207675_100112676 Ga0207675_1001126763 82
141 3300026121 Ga0207683_10008775 Ga0207683_100087759 82
142 3300028379 Ga0268266_10051777 Ga0268266_100517776 82
143 3300028380 Ga0268265_10840488 Ga0268265_108404883 82
144 3300028380 Ga0268265_11255632 Ga0268265_112556322 82
145 3300028381 Ga0268264_10054695 Ga0268264_100546954 82
146 3300028381 Ga0268264_10102962 Ga0268264_101029625 82
147 3300035692 Ga0373935_0905212 Ga0373935_0905212_15_266 82
148 3300046660 Ga0495625_0064346 Ga0495625_0064346_1015_1263 82
149 3300047320 Ga0495672_0315558 Ga0495672_0315558_395_643 82
150 3300053087 Ga0500643_000021 Ga0500643_000021_172915_173163 82
151 3300053139 Ga0500568_0028081 Ga0500568_0028081_866_1114 82
152 3300053727 Ga0500611_148341 Ga0500611_148341_47_295 82
153 3300003215 JGI25153J46596_10000293 JGI25153J46596_1000029325 83
154 3300003320 rootH2_10092111 rootH2_100921113 83
155 3300005329 Ga0070683_102288936 Ga0070683_1022889362 83
156 3300005366 Ga0070659_100359628 Ga0070659_1003596282 83
157 3300005458 Ga0070681_10235668 Ga0070681_102356682 83
158 3300005530 Ga0070679_100581734 Ga0070679_1005817342 83
159 3300005548 Ga0070665_101079661 Ga0070665_1010796612 83
160 3300005548 Ga0070665_101872276 Ga0070665_1018722762 83
161 3300005563 Ga0068855_100196276 Ga0068855_1001962763 83
162 3300005563 Ga0068855_101081593 Ga0068855_1010815932 83
163 3300005577 Ga0068857_100785929 Ga0068857_1007859292 83
164 3300005577 Ga0068857_100988197 Ga0068857_1009881972 83
165 3300005842 Ga0068858_100184195 Ga0068858_1001841953 83
166 3300009176 Ga0105242_12211772 Ga0105242_122117722 83
167 3300013104 Ga0157370_11179415 Ga0157370_111794152 83
168 3300013105 Ga0157369_10998204 Ga0157369_109982042 83
169 3300014325 Ga0163163_13228616 Ga0163163_132286162 83
170 3300025297 Ga0209758_1000013 Ga0209758_100001335 83
171 3300025912 Ga0207707_11406021 Ga0207707_114060212 83
172 3300025921 Ga0207652_10514143 Ga0207652_105141432 83
173 3300025949 Ga0207667_10066953 Ga0207667_100669533 83
174 3300025949 Ga0207667_10582839 Ga0207667_105828392 83
175 3300026035 Ga0207703_10046062 Ga0207703_100460626 83
176 3300026116 Ga0207674_10769158 Ga0207674_107691582 83
177 3300026116 Ga0207674_11197310 Ga0207674_111973102 83
178 3300028379 Ga0268266_10863463 Ga0268266_108634632 83
179 3300028577 Ga0265318_10000568 Ga0265318_1000056816 83
180 3300031235 Ga0265330_10307870 Ga0265330_103078701 83
181 3300031238 Ga0265332_10054006 Ga0265332_100540064 83
182 3300031239 Ga0265328_10467138 Ga0265328_104671382 83
183 3300031247 Ga0265340_10178172 Ga0265340_101781722 83
184 3300031250 Ga0265331_10018706 Ga0265331_100187062 83
185 3300031250 Ga0265331_10326058 Ga0265331_103260581 83
186 3300031595 Ga0265313_10002805 Ga0265313_1000280515 83
187 3300031711 Ga0265314_10005911 Ga0265314_100059114 83
188 3300031712 Ga0265342_10177334 Ga0265342_101773343 83
189 3300048924 Ga0496121_0003884 Ga0496121_0003884_13733_13984 83
190 3300049568 Ga0501031_0002923 Ga0501031_0002923_3076_3327 83
191 3300049569 Ga0501032_0014943 Ga0501032_0014943_810_1061 83
192 3300049569 Ga0501032_0380002 Ga0501032_0380002_468_719 83
193 3300049570 Ga0501033_0003655 Ga0501033_0003655_5003_5254 83
194 3300049570 Ga0501033_0006469 Ga0501033_0006469_6193_6444 83
195 3300049570 Ga0501033_0035169 Ga0501033_0035169_2992_3243 83
196 3300049570 Ga0501033_0056715 Ga0501033_0056715_1586_1837 83
197 3300049570 Ga0501033_0115615 Ga0501033_0115615_1314_1565 83
198 3300049572 Ga0501036_0004570 Ga0501036_0004570_7248_7499 83
199 3300049573 Ga0501037_0011755 Ga0501037_0011755_5368_5619 83
200 3300049573 Ga0501037_0148322 Ga0501037_0148322_1266_1517 83
201 3300049574 Ga0501038_0045179 Ga0501038_0045179_2746_2997 83
202 3300049575 Ga0501039_0012070 Ga0501039_0012070_3303_3554 83
203 3300049575 Ga0501039_0818955 Ga0501039_0818955_209_460 83
204 3300049576 Ga0501040_0261835 Ga0501040_0261835_787_1038 83
205 3300049577 Ga0501041_0467743 Ga0501041_0467743_349_600 83
206 3300049578 Ga0501042_0005927 Ga0501042_0005927_4412_4663 83
207 3300049579 Ga0501043_0049084 Ga0501043_0049084_2030_2281 83
208 3300049579 Ga0501043_0732455 Ga0501043_0732455_124_375 83
209 3300049580 Ga0501046_0001636 Ga0501046_0001636_13960_14211 83
210 3300049581 Ga0501047_0004000 Ga0501047_0004000_12500_12751 83
211 3300049581 Ga0501047_0030936 Ga0501047_0030936_3002_3253 83
212 3300049581 Ga0501047_0065983 Ga0501047_0065983_1037_1288 83
213 3300049581 Ga0501047_0675889 Ga0501047_0675889_98_349 83
214 3300049581 Ga0501047_1198771 Ga0501047_1198771_271_522 83
215 3300049582 Ga0501048_0004393 Ga0501048_0004393_7502_7753 83
216 3300049583 Ga0501067_0001919 Ga0501067_0001919_6602_6853 83
217 3300049584 Ga0501068_0333030 Ga0501068_0333030_656_907 83
218 3300049585 Ga0501069_0008224 Ga0501069_0008224_4418_4669 83
219 3300049586 Ga0501070_0004446 Ga0501070_0004446_9816_10067 83
220 3300049587 Ga0501071_0083107 Ga0501071_0083107_809_1060 83
221 3300049589 Ga0501073_0004055 Ga0501073_0004055_620_871 83
222 3300049590 Ga0501074_0001155 Ga0501074_0001155_3670_3921 83
223 3300049741 Ga0501079_0003788 Ga0501079_0003788_9868_10119 83
224 3300049742 Ga0501080_0001040 Ga0501080_0001040_21758_22009 83
225 3300049742 Ga0501080_1203423 Ga0501080_1203423_231_482 83
226 3300049744 Ga0501083_0004091 Ga0501083_0004091_2616_2867 83
227 3300049822 Ga0501035_0008173 Ga0501035_0008173_8689_8940 83
228 3300049822 Ga0501035_0009408 Ga0501035_0009408_3272_3523 83
229 3300049822 Ga0501035_0231853 Ga0501035_0231853_26_277 83
230 3300049823 Ga0501044_0006311 Ga0501044_0006311_9640_9891 83
231 3300049823 Ga0501044_0043283 Ga0501044_0043283_626_877 83
232 3300049823 Ga0501044_0047113 Ga0501044_0047113_1156_1407 83
233 3300049823 Ga0501044_0214436 Ga0501044_0214436_1349_1600 83
234 3300049823 Ga0501044_0232587 Ga0501044_0232587_993_1244 83
235 3300049823 Ga0501044_0434287 Ga0501044_0434287_334_585 83
236 3300049823 Ga0501044_0764341 Ga0501044_0764341_437_688 83
237 3300053092 Ga0500583_0345466 Ga0500583_0345466_12_263 83
238 3300054114 Ga0501084_0009877 Ga0501084_0009877_4516_4767 83
239 3300060353 Ga0501082_0007125 Ga0501082_0007125_2197_2448 83
240 3300061734 Ga0530510_0304520 Ga0530510_0304520_869_1120 83
241 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013261 84
242 3300003214 JGI25165J46597_1044068 JGI25165J46597_10440681 84
243 3300003320 rootH2_10073677 rootH2_100736773 84
244 3300005327 Ga0070658_10179289 Ga0070658_101792893 84
245 3300005327 Ga0070658_10212863 Ga0070658_102128632 84
246 3300005328 Ga0070676_10102460 Ga0070676_101024602 84
247 3300005328 Ga0070676_10763790 Ga0070676_107637902 84
248 3300005333 Ga0070677_10317178 Ga0070677_103171782 84
249 3300005334 Ga0068869_100035947 Ga0068869_1000359474 84
250 3300005335 Ga0070666_11242653 Ga0070666_112426531 84
251 3300005338 Ga0068868_100086917 Ga0068868_1000869173 84
252 3300005339 Ga0070660_100022435 Ga0070660_1000224354 84
253 3300005340 Ga0070689_101109932 Ga0070689_1011099321 84
254 3300005340 Ga0070689_101275354 Ga0070689_1012753541 84
255 3300005343 Ga0070687_100220474 Ga0070687_1002204743 84
256 3300005347 Ga0070668_100385173 Ga0070668_1003851732 84
257 3300005354 Ga0070675_100098537 Ga0070675_1000985373 84
258 3300005354 Ga0070675_100272796 Ga0070675_1002727963 84
259 3300005356 Ga0070674_100526628 Ga0070674_1005266281 84
260 3300005364 Ga0070673_100245923 Ga0070673_1002459232 84
261 3300005436 Ga0070713_100604202 Ga0070713_1006042022 84
262 3300005444 Ga0070694_101339599 Ga0070694_1013395992 84
263 3300005455 Ga0070663_101440752 Ga0070663_1014407521 84
264 3300005456 Ga0070678_100427516 Ga0070678_1004275162 84
265 3300005459 Ga0068867_100001750 Ga0068867_10000175012 84
266 3300005459 Ga0068867_100740667 Ga0068867_1007406672 84
267 3300005530 Ga0070679_100097620 Ga0070679_1000976205 84
268 3300005535 Ga0070684_100295366 Ga0070684_1002953663 84
269 3300005539 Ga0068853_100775844 Ga0068853_1007758443 84
270 3300005539 Ga0068853_101196524 Ga0068853_1011965242 84
271 3300005539 Ga0068853_101568071 Ga0068853_1015680712 84
272 3300005539 Ga0068853_102409118 Ga0068853_1024091181 84
273 3300005547 Ga0070693_100253487 Ga0070693_1002534873 84
274 3300005547 Ga0070693_100359114 Ga0070693_1003591142 84
275 3300005548 Ga0070665_100095824 Ga0070665_1000958241 84
276 3300005548 Ga0070665_100144804 Ga0070665_1001448043 84
277 3300005548 Ga0070665_100855952 Ga0070665_1008559522 84
278 3300005563 Ga0068855_100460894 Ga0068855_1004608943 84
279 3300005563 Ga0068855_102378773 Ga0068855_1023787732 84
280 3300005577 Ga0068857_100068654 Ga0068857_1000686544 84
281 3300005577 Ga0068857_101700745 Ga0068857_1017007452 84
282 3300005615 Ga0070702_100475137 Ga0070702_1004751371 84
283 3300005840 Ga0068870_10411843 Ga0068870_104118432 84
284 3300005841 Ga0068863_100199218 Ga0068863_1001992183 84
285 3300005937 Ga0081455_10659130 Ga0081455_106591302 84
286 3300006237 Ga0097621_100000046 Ga0097621_10000004640 84
287 3300006237 Ga0097621_100137035 Ga0097621_1001370353 84
288 3300006237 Ga0097621_100537449 Ga0097621_1005374492 84
289 3300006358 Ga0068871_100000004 Ga0068871_10000000450 84
290 3300006358 Ga0068871_101957314 Ga0068871_1019573142 84
291 3300006931 Ga0097620_101032773 Ga0097620_1010327732 84
292 3300009098 Ga0105245_13082146 Ga0105245_130821462 84
293 3300009148 Ga0105243_10214093 Ga0105243_102140933 84
294 3300009174 Ga0105241_10026371 Ga0105241_100263713 84
295 3300009174 Ga0105241_10533268 Ga0105241_105332682 84
296 3300009177 Ga0105248_10015941 Ga0105248_100159419 84
297 3300009177 Ga0105248_10817835 Ga0105248_108178352 84
298 3300009545 Ga0105237_10054465 Ga0105237_100544656 84
299 3300009545 Ga0105237_10108919 Ga0105237_101089193 84
300 3300009545 Ga0105237_12178010 Ga0105237_121780102 84
301 3300009551 Ga0105238_10167382 Ga0105238_101673825 84
302 3300009553 Ga0105249_10053552 Ga0105249_100535523 84
303 3300010375 Ga0105239_10208061 Ga0105239_102080614 84
304 3300013297 Ga0157378_10988105 Ga0157378_109881052 84
305 3300013297 Ga0157378_13151060 Ga0157378_131510602 84
306 3300013306 Ga0163162_11619300 Ga0163162_116193002 84
307 3300013308 Ga0157375_11338014 Ga0157375_113380142 84
308 3300013308 Ga0157375_11573478 Ga0157375_115734782 84
309 3300014326 Ga0157380_10307803 Ga0157380_103078032 84
310 3300014968 Ga0157379_10000605 Ga0157379_100006058 84
311 3300014968 Ga0157379_10163986 Ga0157379_101639863 84
312 3300014969 Ga0157376_10370868 Ga0157376_103708682 84
313 3300014969 Ga0157376_13130279 Ga0157376_131302792 84
314 3300025261 Ga0209233_1000013 Ga0209233_1000013509 84
315 3300025261 Ga0209233_1007476 Ga0209233_10074762 84
316 3300025893 Ga0207682_10444950 Ga0207682_104449502 84
317 3300025901 Ga0207688_10016755 Ga0207688_100167554 84
318 3300025903 Ga0207680_10859796 Ga0207680_108597962 84
319 3300025903 Ga0207680_11195579 Ga0207680_111955792 84
320 3300025907 Ga0207645_10027200 Ga0207645_100272005 84
321 3300025908 Ga0207643_10092806 Ga0207643_100928062 84
322 3300025909 Ga0207705_10180448 Ga0207705_101804483 84
323 3300025909 Ga0207705_11410596 Ga0207705_114105962 84
324 3300025909 Ga0207705_11537184 Ga0207705_115371841 84
325 3300025911 Ga0207654_11205453 Ga0207654_112054531 84
326 3300025913 Ga0207695_10157075 Ga0207695_101570753 84
327 3300025914 Ga0207671_10430570 Ga0207671_104305702 84
328 3300025914 Ga0207671_10471044 Ga0207671_104710443 84
329 3300025914 Ga0207671_11129900 Ga0207671_111299002 84
330 3300025918 Ga0207662_10111557 Ga0207662_101115572 84
331 3300025919 Ga0207657_10008929 Ga0207657_100089295 84
332 3300025921 Ga0207652_10305800 Ga0207652_103058002 84
333 3300025924 Ga0207694_10064253 Ga0207694_100642533 84
334 3300025924 Ga0207694_11355554 Ga0207694_113555542 84
335 3300025926 Ga0207659_10027797 Ga0207659_100277973 84
336 3300025926 Ga0207659_10109267 Ga0207659_101092673 84
337 3300025928 Ga0207700_11038682 Ga0207700_110386821 84
338 3300025938 Ga0207704_10271778 Ga0207704_102717782 84
339 3300025941 Ga0207711_10014304 Ga0207711_100143049 84
340 3300025941 Ga0207711_10802359 Ga0207711_108023592 84
341 3300025942 Ga0207689_10117701 Ga0207689_101177012 84
342 3300025944 Ga0207661_10708422 Ga0207661_107084222 84
343 3300025949 Ga0207667_10486235 Ga0207667_104862353 84
344 3300025961 Ga0207712_10329877 Ga0207712_103298773 84
345 3300026023 Ga0207677_10093871 Ga0207677_100938712 84
346 3300026023 Ga0207677_11056568 Ga0207677_110565682 84
347 3300026035 Ga0207703_10421028 Ga0207703_104210283 84
348 3300026035 Ga0207703_10546331 Ga0207703_105463312 84
349 3300026035 Ga0207703_12204193 Ga0207703_122041932 84
350 3300026041 Ga0207639_11450388 Ga0207639_114503881 84
351 3300026041 Ga0207639_11630665 Ga0207639_116306652 84
352 3300026041 Ga0207639_11765904 Ga0207639_117659042 84
353 3300026067 Ga0207678_11300259 Ga0207678_113002592 84
354 3300026067 Ga0207678_11846477 Ga0207678_118464771 84
355 3300026078 Ga0207702_10359101 Ga0207702_103591013 84
356 3300026078 Ga0207702_10942921 Ga0207702_109429212 84
357 3300026088 Ga0207641_10063110 Ga0207641_100631105 84
358 3300026089 Ga0207648_10019524 Ga0207648_100195244 84
359 3300026116 Ga0207674_10809488 Ga0207674_108094882 84
360 3300026118 Ga0207675_100269014 Ga0207675_1002690143 84
361 3300026121 Ga0207683_10048331 Ga0207683_100483312 84
362 3300028379 Ga0268266_10014103 Ga0268266_100141039 84
363 3300028379 Ga0268266_10026894 Ga0268266_100268942 84
364 3300028379 Ga0268266_10142830 Ga0268266_101428303 84
365 3300028786 Ga0307517_10135718 Ga0307517_101357183 84
366 3300031250 Ga0265331_10399957 Ga0265331_103999572 84
367 3300031548 Ga0307408_100164827 Ga0307408_1001648272 84
368 3300031711 Ga0265314_10141162 Ga0265314_101411622 84
369 3300035112 Ga0373932_0273192 Ga0373932_0273192_37_333 84
370 3300035691 Ga0373931_0048042 Ga0373931_0048042_762_1058 84
371 3300036401 Ga0373937_1140364 Ga0373937_1140364_163_417 84
372 3300039438 Ga0436360_0991596 Ga0436360_0991596_425_679 84
373 3300046514 Ga0495618_0671398 Ga0495618_0671398_254_508 84
374 3300046648 Ga0495611_0208282 Ga0495611_0208282_626_892 84
375 3300046809 Ga0495600_0677116 Ga0495600_0677116_119_388 84
376 3300046809 Ga0495600_0680937 Ga0495600_0680937_196_450 84
377 3300047673 Ga0495593_0584514 Ga0495593_0584514_145_414 84
378 3300048088 Ga0495602_0397970 Ga0495602_0397970_394_648 84
379 3300048929 Ga0496126_0113794 Ga0496126_0113794_554_808 84
380 3300049573 Ga0501037_1123653 Ga0501037_1123653_212_466 84
381 3300049574 Ga0501038_0223731 Ga0501038_0223731_472_726 84
382 3300049579 Ga0501043_1117886 Ga0501043_1117886_90_344 84
383 3300049581 Ga0501047_0547744 Ga0501047_0547744_579_833 84
384 3300049585 Ga0501069_0788362 Ga0501069_0788362_299_553 84
385 3300049586 Ga0501070_0314609 Ga0501070_0314609_456_710 84
386 3300049588 Ga0501072_0003693 Ga0501072_0003693_4791_5045 84
387 3300049589 Ga0501073_0026156 Ga0501073_0026156_1270_1524 84
388 3300049589 Ga0501073_0211957 Ga0501073_0211957_317_571 84
389 3300049589 Ga0501073_0345987 Ga0501073_0345987_526_780 84
390 3300049590 Ga0501074_0100241 Ga0501074_0100241_1453_1707 84
391 3300049591 Ga0501075_0821213 Ga0501075_0821213_225_479 84
392 3300049742 Ga0501080_0457530 Ga0501080_0457530_642_896 84
393 3300049742 Ga0501080_0831461 Ga0501080_0831461_340_594 84
394 3300049744 Ga0501083_0011929 Ga0501083_0011929_2601_2855 84
395 3300049744 Ga0501083_0031695 Ga0501083_0031695_2282_2536 84
396 3300049744 Ga0501083_0123219 Ga0501083_0123219_532_786 84
397 3300049822 Ga0501035_0487499 Ga0501035_0487499_580_834 84
398 3300049823 Ga0501044_0450083 Ga0501044_0450083_530_784 84
399 3300049823 Ga0501044_0776496 Ga0501044_0776496_182_436 84
400 3300049823 Ga0501044_1140496 Ga0501044_1140496_30_284 84
401 3300053087 Ga0500643_054768 Ga0500643_054768_438_692 84
402 3300053096 Ga0500641_0250732 Ga0500641_0250732_16_270 84
403 3300053117 Ga0500593_282539 Ga0500593_282539_19_273 84
404 3300053118 Ga0500594_0073466 Ga0500594_0073466_19_273 84
405 3300053136 Ga0500559_0136919 Ga0500559_0136919_206_508 84
406 3300054114 Ga0501084_0330010 Ga0501084_0330010_760_1014 84
407 3300060353 Ga0501082_0013584 Ga0501082_0013584_4339_4593 84
408 3300060353 Ga0501082_0062504 Ga0501082_0062504_595_849 84
409 3300060353 Ga0501082_0277596 Ga0501082_0277596_583_837 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

23

101

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8237 2 84
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8115 2 84
1wv3-assembly1.cif.gz_A crystal structure of n-terminal domain of hypothetical protein sav0287 from staphylococcus aureus 0.7947 52 77
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.7943 3 84
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.7773 3 84
ID Description Score Start End Superfamily
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.84 2 84 3.10.20.30
af_Q9VB25_446_561_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8282 53 78 2.60.200.20
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8145 2 84 3.10.20.30
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8126 2 84 3.10.20.30
af_K7KL57_126_234_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8111 53 77 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A1Q3JHF1-F1-model_v4 deleted 0.9826 3 84
AF-A0A1Q3JHF1-F1-model_v4 deleted 0.9596 3 84
AF-A0A2E2SAX4-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9043 2 84
AF-A0A656KX15-F1-model_v4 deleted 0.9036 28 84
AF-A0A7C4HG71-F1-model_v4 MoaD/ThiS family protein 0.8849 2 84 GO:0000166
GO:0006777
GO:1990133

Feature Viewer

pLDDT pTM Quality
92 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map