F436919

General Info

Members Datasets Scaffolds Average Seq Length
409 154 818 265

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100028123|Ga0070714_1000281232
Length 276
Sequence VGRDRRGEVSRLLAIAAAALALGACGLIPHRTLTACADPNNLPFSNQAGQGFENKLAQMIATDLHAKLQYVWWAQRRGYVRNTLNERKCDFWPGIGSNVEMVATSRPYYRSTYMFVSRASENLKGLSLDDPRLKKLTIGVQMVGNDATNTPPAHALASRGIISNVRGYMLYGDYSKPNPPAEIVRAVERGDVDVALVWGPLAGYFAAQSPVPLRLEPVTPWMADMEWPMQFDISVGVQKDDQKLLKQIDKVLERRSPDIRRLLDNYHVPVVDGAGQ

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.89
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 4.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100028123 3300005435 Bacteria 4661
2 JGI24741J21665_1004085 3300001915 Bacteria 3313
3 JGI24740J21852_10009937 3300001979 Bacteria 3692
4 JGI24735J21928_10017255 3300002067 Bacteria 2233
5 JGI24744J21845_10022605 3300002077 Bacteria 1234
6 Ga0070658_10010551 3300005327 Bacteria 7404
7 Ga0070658_10088532 3300005327 Bacteria 2549
8 Ga0070658_10090111 3300005327 Bacteria 2526
9 Ga0070658_10206581 3300005327 Bacteria 1658
10 Ga0070658_10210687 3300005327 Bacteria 1641
11 Ga0070676_10024812 3300005328 Bacteria 3382
12 Ga0070676_10055108 3300005328 Bacteria 2346
13 Ga0070683_100006843 3300005329 Bacteria 9580
14 Ga0070683_100165011 3300005329 Bacteria 2101
15 Ga0070690_100027699 3300005330 Bacteria 3504
16 Ga0070670_100038828 3300005331 Bacteria 4094
17 Ga0070670_100188333 3300005331 Bacteria 1792
18 Ga0070666_10022034 3300005335 Bacteria 4134
19 Ga0070666_10077688 3300005335 Bacteria 2265
20 Ga0070680_100004450 3300005336 Bacteria 10553
21 Ga0070680_100012671 3300005336 Bacteria 6554
22 Ga0070680_100013013 3300005336 Bacteria 6473
23 Ga0070680_100051173 3300005336 Bacteria 3370
24 Ga0070682_100031362 3300005337 Bacteria 3214
25 Ga0068868_100030232 3300005338 Bacteria 4153
26 Ga0068868_100103985 3300005338 Bacteria 2301
27 Ga0070660_100018709 3300005339 Bacteria 5067
28 Ga0070660_100072662 3300005339 Bacteria 2689
29 Ga0070660_100460697 3300005339 Bacteria 1055
30 Ga0070691_10013747 3300005341 Bacteria 3714
31 Ga0070661_100012368 3300005344 Bacteria 5970
32 Ga0070661_100054950 3300005344 Bacteria 2916
33 Ga0070661_100085192 3300005344 Bacteria 2335
34 Ga0070661_100091775 3300005344 Bacteria 2249
35 Ga0070661_100109710 3300005344 Bacteria 2059
36 Ga0070661_100136903 3300005344 Bacteria 1843
37 Ga0070661_100259773 3300005344 Bacteria 1342
38 Ga0070661_100276958 3300005344 Bacteria 1300
39 Ga0070692_10045438 3300005345 Bacteria 2265
40 Ga0070668_100147255 3300005347 Bacteria 1901
41 Ga0070675_100119392 3300005354 Bacteria 2239
42 Ga0070671_100001735 3300005355 Bacteria 16555
43 Ga0070671_100069768 3300005355 Bacteria 2931
44 Ga0070674_100015137 3300005356 Bacteria 4809
45 Ga0070673_100008300 3300005364 Bacteria 6899
46 Ga0070673_100437705 3300005364 Bacteria 1174
47 Ga0070673_100629598 3300005364 Bacteria 980
48 Ga0070659_100014241 3300005366 Bacteria 5937
49 Ga0070659_100340526 3300005366 Bacteria 1256
50 Ga0070659_100370722 3300005366 Bacteria 1204
51 Ga0070659_100424772 3300005366 Bacteria 1124
52 Ga0070667_100015461 3300005367 Bacteria 6311
53 Ga0070714_100023627 3300005435 Bacteria 5053
54 Ga0070714_100033334 3300005435 Bacteria 4304
55 Ga0070663_100068024 3300005455 Bacteria 2585
56 Ga0070663_100140125 3300005455 Bacteria 1845
57 Ga0070678_100011603 3300005456 Bacteria 5443
58 Ga0070678_100051001 3300005456 Bacteria 2996
59 Ga0070662_100114910 3300005457 Bacteria 2055
60 Ga0070662_100139041 3300005457 Bacteria 1880
61 Ga0070662_100407767 3300005457 Bacteria 1122
62 Ga0070681_10205823 3300005458 Bacteria 1885
63 Ga0070681_10297149 3300005458 Bacteria 1525
64 Ga0070681_10439246 3300005458 Bacteria 1217
65 Ga0068867_100011817 3300005459 Bacteria 6165
66 Ga0068867_100252123 3300005459 Bacteria 1436
67 Ga0070679_100093443 3300005530 Bacteria 2995
68 Ga0070679_100340908 3300005530 Unclassified 1447
69 Ga0070684_100007065 3300005535 Bacteria 8728
70 Ga0070684_100022040 3300005535 Bacteria 5308
71 Ga0070684_100068668 3300005535 Bacteria 3115
72 Ga0070684_100089914 3300005535 Bacteria 2729
73 Ga0068853_100166957 3300005539 Bacteria 1989
74 Ga0068853_100190612 3300005539 Bacteria 1862
75 Ga0068853_100376289 3300005539 Bacteria 1325
76 Ga0070672_100087127 3300005543 Bacteria 2512
77 Ga0070686_100002980 3300005544 Bacteria 9278
78 Ga0070696_100090966 3300005546 Bacteria 2172
79 Ga0070693_100337447 3300005547 Bacteria 1028
80 Ga0070665_100038614 3300005548 Bacteria 4800
81 Ga0068855_100096248 3300005563 Bacteria 3411
82 Ga0070664_100003523 3300005564 Bacteria 12641
83 Ga0070664_100006786 3300005564 Bacteria 9230
84 Ga0070664_100052501 3300005564 Bacteria 3453
85 Ga0070664_100113890 3300005564 Bacteria 2362
86 Ga0070664_100172225 3300005564 Bacteria 1920
87 Ga0070664_100172488 3300005564 Bacteria 1919
88 Ga0068857_100052803 3300005577 Bacteria 3605
89 Ga0068857_100198098 3300005577 Bacteria 1830
90 Ga0068857_100503621 3300005577 Unclassified 1137
91 Ga0068857_100586224 3300005577 Bacteria 1053
92 Ga0068854_100026162 3300005578 Bacteria 4007
93 Ga0068854_100027175 3300005578 Bacteria 3941
94 Ga0068854_100051080 3300005578 Bacteria 2961
95 Ga0068854_100684462 3300005578 Bacteria 884
96 Ga0068856_100238589 3300005614 Bacteria 1833
97 Ga0068856_100264010 3300005614 Bacteria 1737
98 Ga0068856_100347894 3300005614 Bacteria 1501
99 Ga0068856_100366481 3300005614 Bacteria 1459
100 Ga0068856_100759713 3300005614 Bacteria 989
101 Ga0068856_100850461 3300005614 Bacteria 931
102 Ga0070702_100401618 3300005615 Bacteria 980
103 Ga0068852_100049454 3300005616 Bacteria 3597
104 Ga0068852_100143051 3300005616 Bacteria 2215
105 Ga0068852_100262833 3300005616 Bacteria 1658
106 Ga0068852_100267430 3300005616 Bacteria 1644
107 Ga0068852_100638318 3300005616 Bacteria 1071
108 Ga0068859_100136620 3300005617 Bacteria 2525
109 Ga0068864_100238137 3300005618 Bacteria 1685
110 Ga0068866_10003824 3300005718 Bacteria 6175
111 Ga0068851_10021801 3300005834 Bacteria 3113
112 Ga0068863_100046464 3300005841 Bacteria 4121
113 Ga0068863_100060100 3300005841 Bacteria 3594
114 Ga0068863_100705772 3300005841 Bacteria 1003
115 Ga0068860_100037422 3300005843 Bacteria 4646
116 Ga0081539_10055114 3300005985 Bacteria 2214
117 Ga0097621_100414806 3300006237 Bacteria 1207
118 Ga0068871_100031516 3300006358 Bacteria 4182
119 Ga0068871_100535041 3300006358 Bacteria 1060
120 Ga0097620_100136616 3300006931 Bacteria 2525
121 Ga0105240_10007132 3300009093 Bacteria 16278
122 Ga0105240_10053319 3300009093 Bacteria 5077
123 Ga0105245_10008364 3300009098 Bacteria 9039
124 Ga0105245_10031565 3300009098 Bacteria 4688
125 Ga0105245_10242405 3300009098 Bacteria 1748
126 Ga0105247_10088747 3300009101 Unclassified 1960
127 Ga0105243_10122387 3300009148 Bacteria 2196
128 Ga0105241_10022838 3300009174 Bacteria 4637
129 Ga0105248_10001297 3300009177 Bacteria 27824
130 Ga0105248_10086821 3300009177 Bacteria 3520
131 Ga0105248_10914263 3300009177 Bacteria 991
132 Ga0105237_10051171 3300009545 Bacteria 4149
133 Ga0105237_10408593 3300009545 Bacteria 1362
134 Ga0105238_10031803 3300009551 Bacteria 5370
135 Ga0105238_10061336 3300009551 Bacteria 3763
136 Ga0105239_10211174 3300010375 Bacteria 2176
137 Ga0157373_10007267 3300013100 Bacteria 8255
138 Ga0157373_10046201 3300013100 Bacteria 3107
139 Ga0157373_10059107 3300013100 Bacteria 2717
140 Ga0157373_10184964 3300013100 Bacteria 1468
141 Ga0157371_10024267 3300013102 Bacteria 4430
142 Ga0157371_10191385 3300013102 Bacteria 1465
143 Ga0157371_10247480 3300013102 Unclassified 1283
144 Ga0157370_10171171 3300013104 Bacteria 2019
145 Ga0157370_10172585 3300013104 Bacteria 2010
146 Ga0157370_10247302 3300013104 Bacteria 1650
147 Ga0157369_10023304 3300013105 Bacteria 6895
148 Ga0157369_10029243 3300013105 Bacteria 6091
149 Ga0157369_10052919 3300013105 Bacteria 4390
150 Ga0157369_10055247 3300013105 Bacteria 4286
151 Ga0157369_10095570 3300013105 Bacteria 3170
152 Ga0157369_10100351 3300013105 Plasmid 3086
153 Ga0157369_10346298 3300013105 Bacteria 1544
154 Ga0157369_10353161 3300013105 Unclassified 1527
155 Ga0157369_10578178 3300013105 Bacteria 1160
156 Ga0157374_10028382 3300013296 Bacteria 5055
157 Ga0157374_10267255 3300013296 Bacteria 1686
158 Ga0163162_10028445 3300013306 Bacteria 5531
159 Ga0157372_10019107 3300013307 Bacteria 7378
160 Ga0157372_10162935 3300013307 Bacteria 2578
161 Ga0157375_10030613 3300013308 Bacteria 5077
162 Ga0163163_10081324 3300014325 Bacteria 3241
163 Ga0157379_10104689 3300014968 Bacteria 2540
164 Ga0206353_10175931 3300020082 Bacteria 2007
165 Ga0206353_10529085 3300020082 Bacteria 1945
166 Ga0207697_10149806 3300025315 Bacteria 1014
167 Ga0207642_10040919 3300025899 Bacteria 2025
168 Ga0207642_10127232 3300025899 Bacteria 1324
169 Ga0207688_10088869 3300025901 Bacteria 1772
170 Ga0207680_10165645 3300025903 Bacteria 1485
171 Ga0207647_10004019 3300025904 Bacteria 10981
172 Ga0207645_10012927 3300025907 Bacteria 5649
173 Ga0207645_10046722 3300025907 Bacteria 2765
174 Ga0207645_10084604 3300025907 Bacteria 2036
175 Ga0207705_10006797 3300025909 Bacteria 8451
176 Ga0207705_10017583 3300025909 Bacteria 5118
177 Ga0207705_10064631 3300025909 Bacteria 2644
178 Ga0207705_10078183 3300025909 Bacteria 2407
179 Ga0207705_10081482 3300025909 Bacteria 2359
180 Ga0207705_10117883 3300025909 Bacteria 1967
181 Ga0207705_10222714 3300025909 Bacteria 1433
182 Ga0207705_10316214 3300025909 Bacteria 1199
183 Ga0207707_10402384 3300025912 Unclassified 1175
184 Ga0207707_10437832 3300025912 Bacteria 1119
185 Ga0207695_10005231 3300025913 Bacteria 17342
186 Ga0207660_10003725 3300025917 Bacteria 9934
187 Ga0207660_10003839 3300025917 Bacteria 9796
188 Ga0207660_10040172 3300025917 Bacteria 3274
189 Ga0207660_10199829 3300025917 Unclassified 1561
190 Ga0207662_10028907 3300025918 Bacteria 3209
191 Ga0207657_10013705 3300025919 Bacteria 7940
192 Ga0207657_10018875 3300025919 Bacteria 6567
193 Ga0207657_10019921 3300025919 Bacteria 6357
194 Ga0207657_10036400 3300025919 Bacteria 4405
195 Ga0207657_10039569 3300025919 Bacteria 4187
196 Ga0207657_10081697 3300025919 Bacteria 2714
197 Ga0207657_10084259 3300025919 Bacteria 2665
198 Ga0207657_10100831 3300025919 Bacteria 2397
199 Ga0207657_10172004 3300025919 Bacteria 1754
200 Ga0207657_10196542 3300025919 Bacteria 1625
201 Ga0207649_10011259 3300025920 Bacteria 4927
202 Ga0207649_10045717 3300025920 Bacteria 2685
203 Ga0207649_10062346 3300025920 Bacteria 2350
204 Ga0207649_10082084 3300025920 Bacteria 2089
205 Ga0207649_10095395 3300025920 Bacteria 1957
206 Ga0207649_10135239 3300025920 Bacteria 1680
207 Ga0207649_10271895 3300025920 Bacteria 1229
208 Ga0207649_10282519 3300025920 Bacteria 1207
209 Ga0207652_10031383 3300025921 Bacteria 4462
210 Ga0207652_10065655 3300025921 Bacteria 3143
211 Ga0207652_10237716 3300025921 Bacteria 1642
212 Ga0207694_10039452 3300025924 Bacteria 3634
213 Ga0207650_10026029 3300025925 Bacteria 4170
214 Ga0207650_10341186 3300025925 Bacteria 1230
215 Ga0207687_10020385 3300025927 Bacteria 4397
216 Ga0207687_10037066 3300025927 Unclassified 3325
217 Ga0207664_10048026 3300025929 Bacteria 3355
218 Ga0207664_10197106 3300025929 Bacteria 1736
219 Ga0207644_10000151 3300025931 Bacteria 49728
220 Ga0207644_10023043 3300025931 Bacteria 4259
221 Ga0207690_10024766 3300025932 Bacteria 3761
222 Ga0207690_10030245 3300025932 Bacteria 3452
223 Ga0207690_10115859 3300025932 Bacteria 1937
224 Ga0207690_10184479 3300025932 Bacteria 1573
225 Ga0207706_10002306 3300025933 Bacteria 18609
226 Ga0207706_10017796 3300025933 Bacteria 6402
227 Ga0207706_10027512 3300025933 Bacteria 5084
228 Ga0207706_10055321 3300025933 Bacteria 3500
229 Ga0207706_10128986 3300025933 Bacteria 2224
230 Ga0207706_10282106 3300025933 Bacteria 1448
231 Ga0207669_10059247 3300025937 Bacteria 2341
232 Ga0207691_10000712 3300025940 Bacteria 32911
233 Ga0207691_10158679 3300025940 Bacteria 1986
234 Ga0207691_10260649 3300025940 Bacteria 1494
235 Ga0207711_10003850 3300025941 Bacteria 12910
236 Ga0207711_10153851 3300025941 Bacteria 2077
237 Ga0207711_10239557 3300025941 Bacteria 1663
238 Ga0207661_10014290 3300025944 Bacteria 5814
239 Ga0207661_10026372 3300025944 Bacteria 4427
240 Ga0207661_10375417 3300025944 Bacteria 1286
241 Ga0207679_10162305 3300025945 Bacteria 1831
242 Ga0207679_10189001 3300025945 Bacteria 1710
243 Ga0207667_10028003 3300025949 Bacteria 6124
244 Ga0207667_10080482 3300025949 Bacteria 3375
245 Ga0207667_10084148 3300025949 Bacteria 3293
246 Ga0207667_10084738 3300025949 Bacteria 3281
247 Ga0207667_10132561 3300025949 Bacteria 2567
248 Ga0207667_10157117 3300025949 Bacteria 2340
249 Ga0207651_10041400 3300025960 Bacteria 3057
250 Ga0207640_10003340 3300025981 Bacteria 8644
251 Ga0207640_10031960 3300025981 Bacteria 3259
252 Ga0207640_10093226 3300025981 Bacteria 2092
253 Ga0207640_10148999 3300025981 Bacteria 1716
254 Ga0207640_10237503 3300025981 Bacteria 1406
255 Ga0207640_10483617 3300025981 Bacteria 1027
256 Ga0207658_10044291 3300025986 Bacteria 3239
257 Ga0207677_10025758 3300026023 Bacteria 3675
258 Ga0207703_10039435 3300026035 Bacteria 3775
259 Ga0207703_10506846 3300026035 Bacteria 1133
260 Ga0207639_10015599 3300026041 Bacteria 5361
261 Ga0207678_10020263 3300026067 Bacteria 5836
262 Ga0207678_10024289 3300026067 Bacteria 5294
263 Ga0207678_10197027 3300026067 Bacteria 1722
264 Ga0207678_10223457 3300026067 Bacteria 1612
265 Ga0207702_10118202 3300026078 Bacteria 2368
266 Ga0207702_10334629 3300026078 Bacteria 1445
267 Ga0207702_10586140 3300026078 Bacteria 1093
268 Ga0207641_10150780 3300026088 Bacteria 2105
269 Ga0207648_10002097 3300026089 Bacteria 21721
270 Ga0207648_10021109 3300026089 Bacteria 5856
271 Ga0207648_10205699 3300026089 Bacteria 1747
272 Ga0207648_10239621 3300026089 Bacteria 1615
273 Ga0207676_10072276 3300026095 Bacteria 2772
274 Ga0207674_10015297 3300026116 Bacteria 8435
275 Ga0207674_10019465 3300026116 Bacteria 7351
276 Ga0207674_10227675 3300026116 Bacteria 1812
277 Ga0207675_100100962 3300026118 Bacteria 2718
278 Ga0207683_10011254 3300026121 Bacteria 7627
279 Ga0207683_10019319 3300026121 Bacteria 5817
280 Ga0207683_10347714 3300026121 Bacteria 1360
281 Ga0207698_10000687 3300026142 Bacteria 19669
282 Ga0207698_10006423 3300026142 Bacteria 7335
283 Ga0207698_10092634 3300026142 Bacteria 2478
284 Ga0207698_10440424 3300026142 Bacteria 1255
285 Ga0207698_10493023 3300026142 Bacteria 1191
286 Ga0207698_10528711 3300026142 Bacteria 1152
287 Ga0268266_10031101 3300028379 Bacteria 4533
288 Ga0373931_0035197 3300035691 Bacteria 2602
289 Ga0395899_0034279 3300037312 Bacteria 3811
290 Ga0395899_0046313 3300037312 Bacteria 3239
291 Ga0395899_0105773 3300037312 Bacteria 2026
292 Ga0395899_0124919 3300037312 Bacteria 1840
293 Ga0395899_0158015 3300037312 Unclassified 1603
294 Ga0395900_0004693 3300037418 Bacteria 14408
295 Ga0395900_0005295 3300037418 Bacteria 13520
296 Ga0395900_0009627 3300037418 Bacteria 9910
297 Ga0395900_0011243 3300037418 Bacteria 9152
298 Ga0395900_0017347 3300037418 Bacteria 7350
299 Ga0395900_0022008 3300037418 Bacteria 6519
300 Ga0395900_0022180 3300037418 Bacteria 6495
301 Ga0395900_0028358 3300037418 Bacteria 5733
302 Ga0395900_0089091 3300037418 Bacteria 3172
303 Ga0395900_0177087 3300037418 Bacteria 2168
304 Ga0395900_0232212 3300037418 Bacteria 1854
305 Ga0395900_0246452 3300037418 Unclassified 1790
306 Ga0395900_0266882 3300037418 Bacteria 1707
307 Ga0395900_0445736 3300037418 Bacteria 1251
308 Ga0395898_0006518 3300037466 Bacteria 12472
309 Ga0395898_0052915 3300037466 Bacteria 3965
310 Ga0395898_0091506 3300037466 Bacteria 2926
311 Ga0395898_0255379 3300037466 Bacteria 1671
312 Ga0395898_0322951 3300037466 Bacteria 1472
313 Ga0395898_0433473 3300037466 Bacteria 1252
314 Ga0395898_0448204 3300037466 Bacteria 1229
315 Ga0395905_0000996 3300037471 Bacteria 36252
316 Ga0395905_0016377 3300037471 Bacteria 7043
317 Ga0395905_0029092 3300037471 Bacteria 5207
318 Ga0395905_0030473 3300037471 Bacteria 5083
319 Ga0395905_0031312 3300037471 Bacteria 5008
320 Ga0395905_0044509 3300037471 Bacteria 4166
321 Ga0395905_0064516 3300037471 Bacteria 3427
322 Ga0395905_0113226 3300037471 Bacteria 2548
323 Ga0395905_0214912 3300037471 Bacteria 1801
324 Ga0395905_0251301 3300037471 Bacteria 1651
325 Ga0395905_0331232 3300037471 Bacteria 1413
326 Ga0395905_0387249 3300037471 Bacteria 1292
327 Ga0395901_0000041 3300038443 Bacteria 202314
328 Ga0395901_0005709 3300038443 Bacteria 12596
329 Ga0395901_0020894 3300038443 Bacteria 6705
330 Ga0395901_0031153 3300038443 Bacteria 5498
331 Ga0395901_0393034 3300038443 Unclassified 1426
332 Ga0436365_1225393 3300039437 Bacteria 1722
333 Ga0439458_0000346 3300042157 Bacteria 11553
334 Ga0466969_0010473 3300044656 Bacteria 4915
335 Ga0466972_0042457 3300044658 Unclassified 2211
336 Ga0466965_0088336 3300044683 Bacteria 1574
337 Ga0466966_0015714 3300044684 Bacteria 5006
338 Ga0466966_0339450 3300044684 Unclassified 903
339 Ga0466961_0009756 3300044693 Bacteria 6111
340 Ga0466961_0017712 3300044693 Bacteria 4577
341 Ga0466961_0035628 3300044693 Bacteria 3195
342 Ga0466961_0055809 3300044693 Bacteria 2517
343 Ga0466963_0001644 3300044694 Bacteria 12176
344 Ga0466963_0009392 3300044694 Bacteria 5891
345 Ga0466963_0026594 3300044694 Bacteria 3701
346 Ga0466963_0068503 3300044694 Bacteria 2384
347 Ga0466963_0123898 3300044694 Bacteria 1781
348 Ga0466963_0153570 3300044694 Unclassified 1599
349 Ga0466963_0162965 3300044694 Bacteria 1552
350 Ga0466963_0391907 3300044694 Bacteria 979
351 Ga0466964_0128050 3300044706 Unclassified 1153
352 Ga0466971_0006442 3300044719 Bacteria 5100
353 Ga0466971_0081449 3300044719 Bacteria 1476
354 Ga0466971_0082192 3300044719 Bacteria 1470
355 Ga0466968_0012035 3300044735 Bacteria 3380
356 Ga0466970_0013502 3300044765 Bacteria 4189
357 Ga0466970_0023736 3300044765 Bacteria 3206
358 Ga0466970_0263979 3300044765 Bacteria 966
359 Ga0466957_0000731 3300044842 Bacteria 16854
360 Ga0466957_0017156 3300044842 Bacteria 4238
361 Ga0466957_0034713 3300044842 Bacteria 3025
362 Ga0466957_0047281 3300044842 Bacteria 2614
363 Ga0466957_0189193 3300044842 Unclassified 1348
364 Ga0466960_0035737 3300044901 Bacteria 2323
365 Ga0466960_0308037 3300044901 Bacteria 894
366 Ga0466959_0026837 3300045049 Bacteria 4272
367 Ga0466959_0098449 3300045049 Bacteria 2095
368 Ga0466959_0237676 3300045049 Unclassified 1259
369 Ga0466958_0011466 3300045836 Bacteria 4991
370 Ga0466958_0035296 3300045836 Bacteria 2986
371 Ga0466958_0039617 3300045836 Bacteria 2831
372 Ga0466958_0117305 3300045836 Bacteria 1664
373 Ga0466958_0158030 3300045836 Bacteria 1431
374 Ga0466967_0005623 3300045976 Bacteria 8720
375 Ga0466967_0007399 3300045976 Bacteria 7916
376 Ga0466967_0017470 3300045976 Bacteria 5697
377 Ga0466967_0036043 3300045976 Bacteria 4219
378 Ga0466967_0050538 3300045976 Bacteria 3641
379 Ga0466967_0057037 3300045976 Bacteria 3446
380 Ga0466967_0090142 3300045976 Bacteria 2785
381 Ga0466967_0111739 3300045976 Bacteria 2511
382 Ga0466967_0186399 3300045976 Bacteria 1959
383 Ga0466967_0217167 3300045976 Bacteria 1815
384 Ga0466967_0235295 3300045976 Bacteria 1745
385 Ga0466967_0462649 3300045976 Unclassified 1241
386 Ga0466967_0684262 3300045976 Bacteria 1015
387 Ga0496100_0029535 3300048903 Bacteria 3392
388 Ga0496102_0294334 3300048905 Bacteria 1530
389 Ga0496103_0031742 3300048906 Bacteria 3221
390 Ga0496105_0023443 3300048908 Bacteria 5006
391 Ga0496106_0011605 3300048909 Bacteria 6512
392 Ga0496107_0077419 3300048910 Bacteria 2422
393 Ga0496108_0005245 3300048911 Bacteria 10466
394 Ga0496108_0061917 3300048911 Bacteria 3150
395 Ga0496109_0162078 3300048912 Bacteria 2095
396 Ga0496110_0013656 3300048913 Bacteria 6725
397 Ga0496111_0050679 3300048914 Bacteria 2996
398 Ga0496111_0112092 3300048914 Bacteria 2009
399 Ga0496112_0004766 3300048915 Bacteria 11565
400 Ga0496112_0012325 3300048915 Bacteria 7852
401 Ga0496112_0035750 3300048915 Bacteria 4841
402 Ga0496112_0273039 3300048915 Unclassified 1639
403 Ga0496113_0009229 3300048916 Bacteria 6470
404 Ga0496113_0048816 3300048916 Bacteria 3150
405 Ga0496113_0274932 3300048916 Bacteria 1347
406 Ga0496113_0623770 3300048916 Unclassified 863
407 Ga0466962_0026434 3300061719 Bacteria 2786
408 Ga0466962_0032926 3300061719 Bacteria 2480
409 Ga0466962_0154067 3300061719 Bacteria 1115
410 Ga0070714_100028123
411 JGI24741J21665_1004085
412 JGI24740J21852_10009937
413 JGI24735J21928_10017255
414 JGI24744J21845_10022605
415 Ga0070658_10010551
416 Ga0070658_10088532
417 Ga0070658_10090111
418 Ga0070658_10206581
419 Ga0070658_10210687
420 Ga0070676_10024812
421 Ga0070676_10055108
422 Ga0070683_100006843
423 Ga0070683_100165011
424 Ga0070690_100027699
425 Ga0070670_100038828
426 Ga0070670_100188333
427 Ga0070666_10022034
428 Ga0070666_10077688
429 Ga0070680_100004450
430 Ga0070680_100012671
431 Ga0070680_100013013
432 Ga0070680_100051173
433 Ga0070682_100031362
434 Ga0068868_100030232
435 Ga0068868_100103985
436 Ga0070660_100018709
437 Ga0070660_100072662
438 Ga0070660_100460697
439 Ga0070691_10013747
440 Ga0070661_100012368
441 Ga0070661_100054950
442 Ga0070661_100085192
443 Ga0070661_100091775
444 Ga0070661_100109710
445 Ga0070661_100136903
446 Ga0070661_100259773
447 Ga0070661_100276958
448 Ga0070692_10045438
449 Ga0070668_100147255
450 Ga0070675_100119392
451 Ga0070671_100001735
452 Ga0070671_100069768
453 Ga0070674_100015137
454 Ga0070673_100008300
455 Ga0070673_100437705
456 Ga0070673_100629598
457 Ga0070659_100014241
458 Ga0070659_100340526
459 Ga0070659_100370722
460 Ga0070659_100424772
461 Ga0070667_100015461
462 Ga0070714_100023627
463 Ga0070714_100033334
464 Ga0070663_100068024
465 Ga0070663_100140125
466 Ga0070678_100011603
467 Ga0070678_100051001
468 Ga0070662_100114910
469 Ga0070662_100139041
470 Ga0070662_100407767
471 Ga0070681_10205823
472 Ga0070681_10297149
473 Ga0070681_10439246
474 Ga0068867_100011817
475 Ga0068867_100252123
476 Ga0070679_100093443
477 Ga0070679_100340908
478 Ga0070684_100007065
479 Ga0070684_100022040
480 Ga0070684_100068668
481 Ga0070684_100089914
482 Ga0068853_100166957
483 Ga0068853_100190612
484 Ga0068853_100376289
485 Ga0070672_100087127
486 Ga0070686_100002980
487 Ga0070696_100090966
488 Ga0070693_100337447
489 Ga0070665_100038614
490 Ga0068855_100096248
491 Ga0070664_100003523
492 Ga0070664_100006786
493 Ga0070664_100052501
494 Ga0070664_100113890
495 Ga0070664_100172225
496 Ga0070664_100172488
497 Ga0068857_100052803
498 Ga0068857_100198098
499 Ga0068857_100503621
500 Ga0068857_100586224
501 Ga0068854_100026162
502 Ga0068854_100027175
503 Ga0068854_100051080
504 Ga0068854_100684462
505 Ga0068856_100238589
506 Ga0068856_100264010
507 Ga0068856_100347894
508 Ga0068856_100366481
509 Ga0068856_100759713
510 Ga0068856_100850461
511 Ga0070702_100401618
512 Ga0068852_100049454
513 Ga0068852_100143051
514 Ga0068852_100262833
515 Ga0068852_100267430
516 Ga0068852_100638318
517 Ga0068859_100136620
518 Ga0068864_100238137
519 Ga0068866_10003824
520 Ga0068851_10021801
521 Ga0068863_100046464
522 Ga0068863_100060100
523 Ga0068863_100705772
524 Ga0068860_100037422
525 Ga0081539_10055114
526 Ga0097621_100414806
527 Ga0068871_100031516
528 Ga0068871_100535041
529 Ga0097620_100136616
530 Ga0105240_10007132
531 Ga0105240_10053319
532 Ga0105245_10008364
533 Ga0105245_10031565
534 Ga0105245_10242405
535 Ga0105247_10088747
536 Ga0105243_10122387
537 Ga0105241_10022838
538 Ga0105248_10001297
539 Ga0105248_10086821
540 Ga0105248_10914263
541 Ga0105237_10051171
542 Ga0105237_10408593
543 Ga0105238_10031803
544 Ga0105238_10061336
545 Ga0105239_10211174
546 Ga0157373_10007267
547 Ga0157373_10046201
548 Ga0157373_10059107
549 Ga0157373_10184964
550 Ga0157371_10024267
551 Ga0157371_10191385
552 Ga0157371_10247480
553 Ga0157370_10171171
554 Ga0157370_10172585
555 Ga0157370_10247302
556 Ga0157369_10023304
557 Ga0157369_10029243
558 Ga0157369_10052919
559 Ga0157369_10055247
560 Ga0157369_10095570
561 Ga0157369_10100351
562 Ga0157369_10346298
563 Ga0157369_10353161
564 Ga0157369_10578178
565 Ga0157374_10028382
566 Ga0157374_10267255
567 Ga0163162_10028445
568 Ga0157372_10019107
569 Ga0157372_10162935
570 Ga0157375_10030613
571 Ga0163163_10081324
572 Ga0157379_10104689
573 Ga0206353_10175931
574 Ga0206353_10529085
575 Ga0207697_10149806
576 Ga0207642_10040919
577 Ga0207642_10127232
578 Ga0207688_10088869
579 Ga0207680_10165645
580 Ga0207647_10004019
581 Ga0207645_10012927
582 Ga0207645_10046722
583 Ga0207645_10084604
584 Ga0207705_10006797
585 Ga0207705_10017583
586 Ga0207705_10064631
587 Ga0207705_10078183
588 Ga0207705_10081482
589 Ga0207705_10117883
590 Ga0207705_10222714
591 Ga0207705_10316214
592 Ga0207707_10402384
593 Ga0207707_10437832
594 Ga0207695_10005231
595 Ga0207660_10003725
596 Ga0207660_10003839
597 Ga0207660_10040172
598 Ga0207660_10199829
599 Ga0207662_10028907
600 Ga0207657_10013705
601 Ga0207657_10018875
602 Ga0207657_10019921
603 Ga0207657_10036400
604 Ga0207657_10039569
605 Ga0207657_10081697
606 Ga0207657_10084259
607 Ga0207657_10100831
608 Ga0207657_10172004
609 Ga0207657_10196542
610 Ga0207649_10011259
611 Ga0207649_10045717
612 Ga0207649_10062346
613 Ga0207649_10082084
614 Ga0207649_10095395
615 Ga0207649_10135239
616 Ga0207649_10271895
617 Ga0207649_10282519
618 Ga0207652_10031383
619 Ga0207652_10065655
620 Ga0207652_10237716
621 Ga0207694_10039452
622 Ga0207650_10026029
623 Ga0207650_10341186
624 Ga0207687_10020385
625 Ga0207687_10037066
626 Ga0207664_10048026
627 Ga0207664_10197106
628 Ga0207644_10000151
629 Ga0207644_10023043
630 Ga0207690_10024766
631 Ga0207690_10030245
632 Ga0207690_10115859
633 Ga0207690_10184479
634 Ga0207706_10002306
635 Ga0207706_10017796
636 Ga0207706_10027512
637 Ga0207706_10055321
638 Ga0207706_10128986
639 Ga0207706_10282106
640 Ga0207669_10059247
641 Ga0207691_10000712
642 Ga0207691_10158679
643 Ga0207691_10260649
644 Ga0207711_10003850
645 Ga0207711_10153851
646 Ga0207711_10239557
647 Ga0207661_10014290
648 Ga0207661_10026372
649 Ga0207661_10375417
650 Ga0207679_10162305
651 Ga0207679_10189001
652 Ga0207667_10028003
653 Ga0207667_10080482
654 Ga0207667_10084148
655 Ga0207667_10084738
656 Ga0207667_10132561
657 Ga0207667_10157117
658 Ga0207651_10041400
659 Ga0207640_10003340
660 Ga0207640_10031960
661 Ga0207640_10093226
662 Ga0207640_10148999
663 Ga0207640_10237503
664 Ga0207640_10483617
665 Ga0207658_10044291
666 Ga0207677_10025758
667 Ga0207703_10039435
668 Ga0207703_10506846
669 Ga0207639_10015599
670 Ga0207678_10020263
671 Ga0207678_10024289
672 Ga0207678_10197027
673 Ga0207678_10223457
674 Ga0207702_10118202
675 Ga0207702_10334629
676 Ga0207702_10586140
677 Ga0207641_10150780
678 Ga0207648_10002097
679 Ga0207648_10021109
680 Ga0207648_10205699
681 Ga0207648_10239621
682 Ga0207676_10072276
683 Ga0207674_10015297
684 Ga0207674_10019465
685 Ga0207674_10227675
686 Ga0207675_100100962
687 Ga0207683_10011254
688 Ga0207683_10019319
689 Ga0207683_10347714
690 Ga0207698_10000687
691 Ga0207698_10006423
692 Ga0207698_10092634
693 Ga0207698_10440424
694 Ga0207698_10493023
695 Ga0207698_10528711
696 Ga0268266_10031101
697 Ga0373931_0035197
698 Ga0395899_0034279
699 Ga0395899_0046313
700 Ga0395899_0105773
701 Ga0395899_0124919
702 Ga0395899_0158015
703 Ga0395900_0004693
704 Ga0395900_0005295
705 Ga0395900_0009627
706 Ga0395900_0011243
707 Ga0395900_0017347
708 Ga0395900_0022008
709 Ga0395900_0022180
710 Ga0395900_0028358
711 Ga0395900_0089091
712 Ga0395900_0177087
713 Ga0395900_0232212
714 Ga0395900_0246452
715 Ga0395900_0266882
716 Ga0395900_0445736
717 Ga0395898_0006518
718 Ga0395898_0052915
719 Ga0395898_0091506
720 Ga0395898_0255379
721 Ga0395898_0322951
722 Ga0395898_0433473
723 Ga0395898_0448204
724 Ga0395905_0000996
725 Ga0395905_0016377
726 Ga0395905_0029092
727 Ga0395905_0030473
728 Ga0395905_0031312
729 Ga0395905_0044509
730 Ga0395905_0064516
731 Ga0395905_0113226
732 Ga0395905_0214912
733 Ga0395905_0251301
734 Ga0395905_0331232
735 Ga0395905_0387249
736 Ga0395901_0000041
737 Ga0395901_0005709
738 Ga0395901_0020894
739 Ga0395901_0031153
740 Ga0395901_0393034
741 Ga0436365_1225393
742 Ga0439458_0000346
743 Ga0466969_0010473
744 Ga0466972_0042457
745 Ga0466965_0088336
746 Ga0466966_0015714
747 Ga0466966_0339450
748 Ga0466961_0009756
749 Ga0466961_0017712
750 Ga0466961_0035628
751 Ga0466961_0055809
752 Ga0466963_0001644
753 Ga0466963_0009392
754 Ga0466963_0026594
755 Ga0466963_0068503
756 Ga0466963_0123898
757 Ga0466963_0153570
758 Ga0466963_0162965
759 Ga0466963_0391907
760 Ga0466964_0128050
761 Ga0466971_0006442
762 Ga0466971_0081449
763 Ga0466971_0082192
764 Ga0466968_0012035
765 Ga0466970_0013502
766 Ga0466970_0023736
767 Ga0466970_0263979
768 Ga0466957_0000731
769 Ga0466957_0017156
770 Ga0466957_0034713
771 Ga0466957_0047281
772 Ga0466957_0189193
773 Ga0466960_0035737
774 Ga0466960_0308037
775 Ga0466959_0026837
776 Ga0466959_0098449
777 Ga0466959_0237676
778 Ga0466958_0011466
779 Ga0466958_0035296
780 Ga0466958_0039617
781 Ga0466958_0117305
782 Ga0466958_0158030
783 Ga0466967_0005623
784 Ga0466967_0007399
785 Ga0466967_0017470
786 Ga0466967_0036043
787 Ga0466967_0050538
788 Ga0466967_0057037
789 Ga0466967_0090142
790 Ga0466967_0111739
791 Ga0466967_0186399
792 Ga0466967_0217167
793 Ga0466967_0235295
794 Ga0466967_0462649
795 Ga0466967_0684262
796 Ga0496100_0029535
797 Ga0496102_0294334
798 Ga0496103_0031742
799 Ga0496105_0023443
800 Ga0496106_0011605
801 Ga0496107_0077419
802 Ga0496108_0005245
803 Ga0496108_0061917
804 Ga0496109_0162078
805 Ga0496110_0013656
806 Ga0496111_0050679
807 Ga0496111_0112092
808 Ga0496112_0004766
809 Ga0496112_0012325
810 Ga0496112_0035750
811 Ga0496112_0273039
812 Ga0496113_0009229
813 Ga0496113_0048816
814 Ga0496113_0274932
815 Ga0496113_0623770
816 Ga0466962_0026434
817 Ga0466962_0032926
818 Ga0466962_0154067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

33

268

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v4u-assembly1.cif.gz_A human ctp synthetase 2 - glutaminase domain in complex with 5-oxo-l- norleucine 0.6344 29 71
7mgz-assembly1.cif.gz_F human ctps1 bound to utp, amppnp, and glutamine 0.6129 26 71
7mif-assembly1.cif.gz_C human ctps1 bound to inhibitor r80 0.5995 26 73
2vkt-assembly1.cif.gz_A human ctp synthetase 2 - glutaminase domain 0.5904 30 73
6pk4-assembly1.cif.gz_A cryoem structure of the substrate-bound human ctp synthase 2 filament 0.5788 29 73
ID Description Score Start End Superfamily
3qaxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7823 112 214 3.40.190.10
3delC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7474 30 73 3.40.190.10
3h7mA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7467 112 220 3.40.190.10
3h7mA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7328 112 220 3.40.190.10
4q0cB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7276 111 215 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7I0JQV7-F1-model_v4 Quinoprotein dehydrogenase-associated putative ABC transporter substrate-binding protein 0.6889 76 199
AF-A0A530GLC6-F1-model_v4 Quinoprotein dehydrogenase-associated putative ABC transporter substrate-binding protein 0.6822 65 237 GO:0030313
AF-A0A529T1G1-F1-model_v4 Transporter substrate-binding domain-containing protein 0.6747 106 268 GO:0030313
AF-A0A7I0JQV7-F1-model_v4 Quinoprotein dehydrogenase-associated putative ABC transporter substrate-binding protein 0.6737 76 199
AF-A0A4Q0GMA8-F1-model_v4 Transporter substrate-binding domain-containing protein 0.6667 120 270

Map