F436911

General Info

Members Datasets Scaffolds Average Seq Length
409 202 409 135

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100138371|Ga0070680_1001383712
Length 134
Sequence MQRVLVVLLAAVAGLLGRPLVSSAHHSFAATYLETQSATIEGEIVQFVFRNPHSFVHVGVKEKDGTVTTYNVEWGGTGQLNGTGVTRETLKAGDVVIITGAPGRNPADHRIRMVTLKRPRDGFTWGQQPGQTFD

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
185 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
190 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.2
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10064818 3300002077 Archaea 667
2 Ga0058863_10027306 3300004799 Bacteria 859
3 Ga0058861_11096727 3300004800 Bacteria 613
4 Ga0065712_10279785 3300005290 Bacteria 898
5 Ga0065715_10417621 3300005293 Bacteria 862
6 Ga0070658_10057865 3300005327 Unclassified 3154
7 Ga0070658_10089756 3300005327 Bacteria 2531
8 Ga0070676_10030184 3300005328 Unclassified 3089
9 Ga0070676_10153546 3300005328 Bacteria 1476
10 Ga0070683_100660704 3300005329 Unclassified 1001
11 Ga0070690_100445324 3300005330 Unclassified 959
12 Ga0070690_100769259 3300005330 Unclassified 745
13 Ga0070670_100053324 3300005331 Bacteria 3473
14 Ga0070670_100557858 3300005331 Bacteria 1022
15 Ga0070670_101043647 3300005331 Bacteria 744
16 Ga0070677_10105462 3300005333 Bacteria 1250
17 Ga0070666_10065546 3300005335 Unclassified 2464
18 Ga0070666_10329446 3300005335 Bacteria 1090
19 Ga0070680_100138371 3300005336 Bacteria 2041
20 Ga0068868_100828114 3300005338 Bacteria 837
21 Ga0070689_100025627 3300005340 Unclassified 4432
22 Ga0070691_10015265 3300005341 Bacteria 3529
23 Ga0070661_100178911 3300005344 Bacteria 1613
24 Ga0070661_100212868 3300005344 Bacteria 1480
25 Ga0070661_101215360 3300005344 Bacteria 631
26 Ga0070669_100012152 3300005353 Bacteria 6110
27 Ga0070669_100034946 3300005353 Bacteria 3640
28 Ga0070669_100716271 3300005353 Bacteria 846
29 Ga0070669_101459880 3300005353 Unclassified 594
30 Ga0070675_100000327 3300005354 Bacteria 32122
31 Ga0070675_100039589 3300005354 Bacteria 3847
32 Ga0070675_100107588 3300005354 Unclassified 2355
33 Ga0070675_100184988 3300005354 Bacteria 1803
34 Ga0070675_100341627 3300005354 Unclassified 1326
35 Ga0070675_100452934 3300005354 Unclassified 1151
36 Ga0070675_100549274 3300005354 Bacteria 1044
37 Ga0070675_101023013 3300005354 Bacteria 759
38 Ga0070671_100227698 3300005355 Bacteria 1582
39 Ga0070671_100896301 3300005355 Bacteria 775
40 Ga0070674_100210950 3300005356 Bacteria 1505
41 Ga0070674_100820562 3300005356 Unclassified 804
42 Ga0070673_100039663 3300005364 Bacteria 3606
43 Ga0070673_100146573 3300005364 Bacteria 1996
44 Ga0070673_100237031 3300005364 Bacteria 1585
45 Ga0070673_100669987 3300005364 Bacteria 951
46 Ga0070673_101252689 3300005364 Archaea 696
47 Ga0070673_101453983 3300005364 Unclassified 646
48 Ga0070688_100360187 3300005365 Bacteria 1067
49 Ga0070659_100180107 3300005366 Unclassified 1734
50 Ga0070667_100143805 3300005367 Unclassified 2090
51 Ga0070667_101092134 3300005367 Bacteria 746
52 Ga0070667_101134840 3300005367 Bacteria 731
53 Ga0070701_10343440 3300005438 Bacteria 930
54 Ga0070705_100000131 3300005440 Bacteria 43858
55 Ga0070705_101937218 3300005440 Unclassified 502
56 Ga0070700_100001233 3300005441 Bacteria 12672
57 Ga0070700_100119223 3300005441 Bacteria 1765
58 Ga0070700_100121294 3300005441 Unclassified 1752
59 Ga0070700_100476664 3300005441 Archaea 955
60 Ga0070694_100000044 3300005444 Bacteria 58304
61 Ga0070694_100135816 3300005444 Unclassified 1782
62 Ga0070708_100739402 3300005445 Unclassified 925
63 Ga0070678_100632275 3300005456 Unclassified 958
64 Ga0070678_101021758 3300005456 Bacteria 761
65 Ga0070678_101113326 3300005456 Bacteria 729
66 Ga0070662_100179383 3300005457 Bacteria 1669
67 Ga0068867_100011237 3300005459 Bacteria 6315
68 Ga0068867_100664385 3300005459 Unclassified 916
69 Ga0068867_100755703 3300005459 Unclassified 863
70 Ga0068867_102293834 3300005459 Unclassified 513
71 Ga0070706_100247632 3300005467 Unclassified 1664
72 Ga0070707_100003951 3300005468 Bacteria 13956
73 Ga0070707_100517840 3300005468 Bacteria 1155
74 Ga0070698_100480242 3300005471 Unclassified 1180
75 Ga0070698_100560731 3300005471 Unclassified 1082
76 Ga0070699_100583923 3300005518 Bacteria 1018
77 Ga0070684_101127042 3300005535 Unclassified 737
78 Ga0070672_100145907 3300005543 Bacteria 1955
79 Ga0070672_100181401 3300005543 Bacteria 1754
80 Ga0070672_101647127 3300005543 Archaea 576
81 Ga0070686_100022868 3300005544 Bacteria 3728
82 Ga0070695_100000526 3300005545 Bacteria 20225
83 Ga0070696_100000056 3300005546 Bacteria 53352
84 Ga0070696_101106315 3300005546 Unclassified 666
85 Ga0070693_100208324 3300005547 Bacteria 1274
86 Ga0070665_101506273 3300005548 Bacteria 681
87 Ga0070704_100368597 3300005549 Unclassified 1217
88 Ga0070704_100872728 3300005549 Bacteria 808
89 Ga0070664_100006685 3300005564 Bacteria 9298
90 Ga0070664_100037769 3300005564 Bacteria 4061
91 Ga0070664_100631087 3300005564 Unclassified 995
92 Ga0070664_100919473 3300005564 Archaea 821
93 Ga0070664_100941724 3300005564 Bacteria 811
94 Ga0068857_100178500 3300005577 Bacteria 1932
95 Ga0068857_100469562 3300005577 Bacteria 1178
96 Ga0068854_100453783 3300005578 Bacteria 1071
97 Ga0070702_100138536 3300005615 Bacteria 1547
98 Ga0068852_100632978 3300005616 Bacteria 1076
99 Ga0068859_100178388 3300005617 Bacteria 2207
100 Ga0068859_101278271 3300005617 Bacteria 809
101 Ga0068859_102309541 3300005617 Bacteria 593
102 Ga0068864_100450591 3300005618 Bacteria 1231
103 Ga0068864_100596892 3300005618 Bacteria 1071
104 Ga0068866_10013047 3300005718 Bacteria 3634
105 Ga0068861_100004918 3300005719 Bacteria 9000
106 Ga0068861_101377578 3300005719 Unclassified 688
107 Ga0068870_10224438 3300005840 Bacteria 1152
108 Ga0068870_10648192 3300005840 Bacteria 723
109 Ga0068863_100329181 3300005841 Unclassified 1485
110 Ga0068863_100588368 3300005841 Bacteria 1101
111 Ga0068863_102059070 3300005841 Unclassified 581
112 Ga0068858_100188310 3300005842 Unclassified 1950
113 Ga0068860_100047378 3300005843 Bacteria 4097
114 Ga0068860_101633210 3300005843 Unclassified 666
115 Ga0068862_100354437 3300005844 Unclassified 1362
116 Ga0068862_100360866 3300005844 Bacteria 1350
117 Ga0068862_101316537 3300005844 Bacteria 724
118 Ga0081455_10934338 3300005937 Unclassified 538
119 Ga0081539_10000108 3300005985 Bacteria 195322
120 Ga0075432_10185017 3300006058 Bacteria 817
121 Ga0075432_10412908 3300006058 Unclassified 585
122 Ga0070715_10026811 3300006163 Bacteria 2296
123 Ga0097621_100096311 3300006237 Bacteria 2483
124 Ga0097621_100508679 3300006237 Bacteria 1092
125 Ga0097621_101032935 3300006237 Bacteria 770
126 Ga0075428_100035601 3300006844 Bacteria 5487
127 Ga0075428_100057437 3300006844 Unclassified 4259
128 Ga0075428_100092939 3300006844 Unclassified 3288
129 Ga0075428_100146627 3300006844 Unclassified 2565
130 Ga0075428_100273698 3300006844 Bacteria 1817
131 Ga0075430_100131780 3300006846 Bacteria 2083
132 Ga0075430_100875831 3300006846 Bacteria 740
133 Ga0075431_100020127 3300006847 Bacteria 6815
134 Ga0075431_100161136 3300006847 Unclassified 2307
135 Ga0075431_100338309 3300006847 Unclassified 1515
136 Ga0075431_100520628 3300006847 Bacteria 1179
137 Ga0075431_101172237 3300006847 Bacteria 731
138 Ga0075433_10000341 3300006852 Bacteria 28968
139 Ga0075433_10020192 3300006852 Bacteria 5565
140 Ga0075433_10331729 3300006852 Unclassified 1345
141 Ga0075433_10451826 3300006852 Unclassified 1133
142 Ga0075433_10777252 3300006852 Bacteria 837
143 Ga0075433_10981291 3300006852 Bacteria 736
144 Ga0075433_11051847 3300006852 Unclassified 708
145 Ga0075434_100002942 3300006871 Bacteria 15143
146 Ga0075434_100009764 3300006871 Bacteria 8971
147 Ga0075434_100066159 3300006871 Bacteria 3600
148 Ga0075434_100322745 3300006871 Unclassified 1565
149 Ga0075429_100015948 3300006880 Bacteria 6507
150 Ga0068865_100002789 3300006881 Bacteria 10379
151 Ga0068865_100487335 3300006881 Bacteria 1026
152 Ga0068865_100887122 3300006881 Bacteria 775
153 Ga0075436_101213952 3300006914 Bacteria 569
154 Ga0097620_100178373 3300006931 Bacteria 2207
155 Ga0097620_101278243 3300006931 Bacteria 809
156 Ga0097620_102309783 3300006931 Bacteria 593
157 Ga0075435_100051866 3300007076 Bacteria 3305
158 Ga0075435_100251075 3300007076 Bacteria 1506
159 Ga0075435_100630318 3300007076 Unclassified 930
160 Ga0111539_10013102 3300009094 Bacteria 10372
161 Ga0111539_10140461 3300009094 Unclassified 2828
162 Ga0111539_10926635 3300009094 Bacteria 1013
163 Ga0111539_11988292 3300009094 Unclassified 674
164 Ga0111539_12455402 3300009094 Bacteria 605
165 Ga0111539_12780015 3300009094 Unclassified 567
166 Ga0105245_10706809 3300009098 Bacteria 1041
167 Ga0105245_12316064 3300009098 Unclassified 591
168 Ga0114129_10001545 3300009147 Bacteria 31204
169 Ga0114129_10038173 3300009147 Bacteria 6777
170 Ga0114129_10165447 3300009147 Bacteria 3019
171 Ga0114129_10300876 3300009147 Bacteria 2138
172 Ga0114129_10528428 3300009147 Bacteria 1537
173 Ga0114129_10758950 3300009147 Bacteria 1241
174 Ga0114129_13136551 3300009147 Bacteria 539
175 Ga0105243_10089152 3300009148 Bacteria 2535
176 Ga0105243_10977823 3300009148 Bacteria 847
177 Ga0105242_10012444 3300009176 Bacteria 6551
178 Ga0105242_10556972 3300009176 Bacteria 1100
179 Ga0105242_10714558 3300009176 Unclassified 982
180 Ga0105242_10829382 3300009176 Bacteria 918
181 Ga0105242_11460736 3300009176 Unclassified 713
182 Ga0105248_10006333 3300009177 Bacteria 12985
183 Ga0105248_10126425 3300009177 Bacteria 2883
184 Ga0105248_10205927 3300009177 Bacteria 2217
185 Ga0105248_10477736 3300009177 Unclassified 1405
186 Ga0105248_11569255 3300009177 Unclassified 746
187 Ga0105246_10078840 3300011119 Unclassified 2340
188 Ga0105246_10904742 3300011119 Bacteria 792
189 Ga0105246_11215621 3300011119 Bacteria 694
190 Ga0105246_11393884 3300011119 Unclassified 654
191 Ga0157378_11798639 3300013297 Unclassified 661
192 Ga0163162_10306212 3300013306 Bacteria 1721
193 Ga0163162_10369473 3300013306 Bacteria 1567
194 Ga0157375_10047731 3300013308 Bacteria 4183
195 Ga0157375_10176382 3300013308 Bacteria 2287
196 Ga0157375_10382268 3300013308 Bacteria 1574
197 Ga0157375_10396853 3300013308 Unclassified 1546
198 Ga0157375_11166188 3300013308 Archaea 903
199 Ga0157375_12907222 3300013308 Unclassified 572
200 Ga0157375_13157837 3300013308 Unclassified 550
201 Ga0163163_10002567 3300014325 Bacteria 15379
202 Ga0163163_10084648 3300014325 Bacteria 3177
203 Ga0157380_10001054 3300014326 Bacteria 17651
204 Ga0157380_10070376 3300014326 Unclassified 2827
205 Ga0157380_10337236 3300014326 Bacteria 1405
206 Ga0157377_10063304 3300014745 Bacteria 2119
207 Ga0157376_10546106 3300014969 Unclassified 1146
208 Ga0157376_10845912 3300014969 Unclassified 930
209 Ga0182007_10293172 3300015262 Bacteria 595
210 Ga0163161_10138730 3300017792 Unclassified 1840
211 Ga0163161_10249595 3300017792 Bacteria 1383
212 Ga0163161_10346169 3300017792 Unclassified 1180
213 Ga0163161_11117282 3300017792 Unclassified 678
214 Ga0207682_10002391 3300025893 Bacteria 8441
215 Ga0207682_10071355 3300025893 Bacteria 1472
216 Ga0207642_10398833 3300025899 Unclassified 823
217 Ga0207688_10037800 3300025901 Bacteria 2678
218 Ga0207680_10027531 3300025903 Bacteria 3167
219 Ga0207645_10043057 3300025907 Unclassified 2889
220 Ga0207645_10189523 3300025907 Bacteria 1351
221 Ga0207643_10071740 3300025908 Bacteria 1994
222 Ga0207643_10272912 3300025908 Bacteria 1047
223 Ga0207705_10143761 3300025909 Bacteria 1783
224 Ga0207660_10511171 3300025917 Unclassified 975
225 Ga0207649_10204078 3300025920 Bacteria 1398
226 Ga0207649_10388260 3300025920 Unclassified 1042
227 Ga0207649_10734375 3300025920 Bacteria 767
228 Ga0207646_10008885 3300025922 Bacteria 10008
229 Ga0207646_10343350 3300025922 Bacteria 1349
230 Ga0207646_10347683 3300025922 Bacteria 1340
231 Ga0207681_10012655 3300025923 Bacteria 5209
232 Ga0207681_10521315 3300025923 Bacteria 975
233 Ga0207681_10800460 3300025923 Bacteria 787
234 Ga0207681_11028526 3300025923 Unclassified 691
235 Ga0207681_11488183 3300025923 Unclassified 568
236 Ga0207694_10023116 3300025924 Bacteria 4719
237 Ga0207650_10014231 3300025925 Bacteria 5526
238 Ga0207659_10000302 3300025926 Bacteria 29911
239 Ga0207659_10013066 3300025926 Bacteria 5306
240 Ga0207659_10031459 3300025926 Bacteria 3633
241 Ga0207659_10378260 3300025926 Archaea 1180
242 Ga0207659_11556789 3300025926 Unclassified 565
243 Ga0207687_10155611 3300025927 Unclassified 1748
244 Ga0207687_10629290 3300025927 Bacteria 906
245 Ga0207644_10131685 3300025931 Bacteria 1915
246 Ga0207644_10772396 3300025931 Bacteria 803
247 Ga0207706_10103796 3300025933 Unclassified 2501
248 Ga0207706_11017837 3300025933 Bacteria 695
249 Ga0207686_10462441 3300025934 Bacteria 978
250 Ga0207686_10505432 3300025934 Unclassified 938
251 Ga0207709_10053710 3300025935 Bacteria 2480
252 Ga0207669_10072544 3300025937 Bacteria 2168
253 Ga0207669_10108190 3300025937 Unclassified 1856
254 Ga0207669_10370426 3300025937 Bacteria 1113
255 Ga0207669_10453056 3300025937 Bacteria 1017
256 Ga0207669_10610518 3300025937 Bacteria 888
257 Ga0207669_10652649 3300025937 Unclassified 861
258 Ga0207691_10171804 3300025940 Bacteria 1898
259 Ga0207691_10299652 3300025940 Bacteria 1381
260 Ga0207691_10417573 3300025940 Bacteria 1143
261 Ga0207691_10859303 3300025940 Archaea 760
262 Ga0207711_10028199 3300025941 Bacteria 4723
263 Ga0207711_10204518 3300025941 Unclassified 1803
264 Ga0207689_10009838 3300025942 Bacteria 8240
265 Ga0207689_10014537 3300025942 Bacteria 6694
266 Ga0207661_10547842 3300025944 Unclassified 1060
267 Ga0207679_10005987 3300025945 Bacteria 7651
268 Ga0207679_10045209 3300025945 Bacteria 3183
269 Ga0207679_10099731 3300025945 Bacteria 2268
270 Ga0207679_11033112 3300025945 Archaea 754
271 Ga0207651_10072926 3300025960 Bacteria 2439
272 Ga0207651_10296288 3300025960 Unclassified 1343
273 Ga0207651_10549159 3300025960 Bacteria 1004
274 Ga0207651_11102481 3300025960 Archaea 711
275 Ga0207712_10393397 3300025961 Bacteria 1163
276 Ga0207668_10574670 3300025972 Bacteria 979
277 Ga0207640_10681184 3300025981 Unclassified 879
278 Ga0207658_10097975 3300025986 Unclassified 2290
279 Ga0207658_11196809 3300025986 Unclassified 695
280 Ga0207677_10283703 3300026023 Bacteria 1360
281 Ga0207703_10117249 3300026035 Unclassified 2281
282 Ga0207703_10227200 3300026035 Unclassified 1671
283 Ga0207678_10031644 3300026067 Bacteria 4614
284 Ga0207708_10002329 3300026075 Bacteria 13948
285 Ga0207708_10158320 3300026075 Bacteria 1787
286 Ga0207708_10181741 3300026075 Bacteria 1670
287 Ga0207641_10400891 3300026088 Bacteria 1317
288 Ga0207641_10499731 3300026088 Bacteria 1181
289 Ga0207641_11643243 3300026088 Unclassified 644
290 Ga0207648_10002268 3300026089 Bacteria 20815
291 Ga0207648_10921104 3300026089 Bacteria 817
292 Ga0207676_10025124 3300026095 Bacteria 4418
293 Ga0207676_10372269 3300026095 Bacteria 1327
294 Ga0207676_11263483 3300026095 Bacteria 733
295 Ga0207674_11001651 3300026116 Bacteria 805
296 Ga0207675_100010890 3300026118 Bacteria 8518
297 Ga0207683_10052872 3300026121 Bacteria 3560
298 Ga0207683_10235341 3300026121 Bacteria 1670
299 Ga0207683_10500140 3300026121 Bacteria 1123
300 Ga0207683_10729962 3300026121 Bacteria 919
301 Ga0207683_10733509 3300026121 Bacteria 916
302 Ga0207698_10476642 3300026142 Bacteria 1210
303 Ga0207698_11336117 3300026142 Bacteria 732
304 Ga0207428_10012246 3300027907 Bacteria 7542
305 Ga0207428_10302082 3300027907 Bacteria 1184
306 Ga0268266_11058331 3300028379 Bacteria 785
307 Ga0268266_11625409 3300028379 Bacteria 622
308 Ga0268265_10326414 3300028380 Unclassified 1392
309 Ga0268265_11018833 3300028380 Bacteria 819
310 Ga0268265_11150591 3300028380 Bacteria 772
311 Ga0268264_10028830 3300028381 Bacteria 4544
312 Ga0268264_10528219 3300028381 Bacteria 1154
313 Ga0268264_11024018 3300028381 Unclassified 833
314 Ga0268264_11107344 3300028381 Bacteria 800
315 Ga0307408_101891594 3300031548 Unclassified 572
316 Ga0307405_11905377 3300031731 Unclassified 530
317 Ga0307416_100035086 3300032002 Bacteria 3826
318 Ga0307416_101510728 3300032002 Bacteria 777
319 Ga0307414_11012377 3300032004 Bacteria 765
320 Ga0307414_11156458 3300032004 Bacteria 716
321 Ga0373957_0196498 3300035120 Unclassified 840
322 Ga0373943_0108431 3300035170 Bacteria 1461
323 Ga0373955_0302070 3300035172 Bacteria 965
324 Ga0373937_0248730 3300036401 Unclassified 1676
325 Ga0373925_0476301 3300037068 Bacteria 1024
326 Ga0439453_0029826 3300041408 Unclassified 1028
327 Ga0439450_116054 3300042008 Unclassified 687
328 Ga0439434_0201811 3300042435 Bacteria 671
329 Ga0439464_0145799 3300042439 Unclassified 739
330 Ga0451576_0418866 3300045051 Bacteria 1405
331 Ga0495592_0027899 3300046454 Unclassified 4277
332 Ga0495603_0204610 3300046455 Bacteria 1141
333 Ga0495580_0069534 3300046472 Bacteria 2460
334 Ga0495594_0427246 3300046499 Unclassified 753
335 Ga0495608_0009269 3300046511 Bacteria 6884
336 Ga0495618_0058752 3300046514 Bacteria 2437
337 Ga0495630_0005354 3300046517 Bacteria 9050
338 Ga0495663_0185614 3300046525 Bacteria 722
339 Ga0495652_0240096 3300046529 Bacteria 1349
340 Ga0495598_0099735 3300046537 Bacteria 959
341 Ga0495621_0253899 3300046539 Unclassified 719
342 Ga0495667_0154264 3300046559 Bacteria 1478
343 Ga0495634_0026154 3300046642 Bacteria 4075
344 Ga0495588_0331876 3300046674 Unclassified 800
345 Ga0495623_0244565 3300046679 Unclassified 1012
346 Ga0495647_0434120 3300046681 Bacteria 606
347 Ga0495658_0019182 3300046683 Unclassified 3567
348 Ga0495613_0006408 3300046689 Bacteria 8795
349 Ga0495600_0097095 3300046809 Bacteria 1921
350 Ga0495674_0007395 3300047319 Bacteria 10501
351 Ga0495684_0005720 3300047471 Bacteria 9670
352 Ga0495602_0149914 3300048088 Bacteria 1835
353 Ga0496100_0287553 3300048903 Unclassified 1227
354 Ga0496101_0001337 3300048904 Bacteria 14781
355 Ga0496101_0725583 3300048904 Unclassified 784
356 Ga0496102_0145157 3300048905 Bacteria 2227
357 Ga0496104_0034023 3300048907 Bacteria 4750
358 Ga0496106_0403682 3300048909 Viruses 1098
359 Ga0496107_0214518 3300048910 Bacteria 1431
360 Ga0496114_0000423 3300048917 Bacteria 31229
361 Ga0496115_0622394 3300048918 Viruses 856
362 Ga0501298_031492 3300049521 Bacteria 1043
363 Ga0501031_1101857 3300049568 Unclassified 507
364 Ga0501198_026011 3300049649 Bacteria 954
365 Ga0501217_230666 3300049661 Bacteria 589
366 Ga0501227_255055 3300049665 Bacteria 500
367 Ga0501233_178384 3300049668 Unclassified 607
368 Ga0501249_049015 3300049679 Bacteria 967
369 Ga0501234_060835 3300049707 Unclassified 640
370 Ga0501081_1120698 3300049743 Unclassified 596
371 Ga0501278_038070 3300049774 Bacteria 514
372 Ga0501283_008351 3300049779 Unclassified 1491
373 nmdc:mga05p37_1265132_c1 3300050507 Unclassified 756
374 nmdc:mga05p37_126521_c1 3300050507 Bacteria 3138
375 nmdc:mga05p37_2049302_c1 3300050507 Bacteria 539
376 nmdc:mga05p37_27663_c1 3300050507 Bacteria 6907
377 nmdc:mga05p37_4062_c1 3300050507 Bacteria 17104
378 nmdc:mga05p37_57030_c1 3300050507 Bacteria 4810
379 nmdc:mga05p37_627984_c1 3300050507 Bacteria 1208
380 nmdc:mga05p37_714527_c1 3300050507 Bacteria 1111
381 nmdc:mga09592_105816_c1 3300050508 Bacteria 2413
382 nmdc:mga09592_70690_c1 3300050508 Bacteria 2962
383 nmdc:mga0qj67_107125_c1 3300050509 Unclassified 2255
384 nmdc:mga0qj67_404862_c1 3300050509 Bacteria 1101
385 nmdc:mga0qj67_9710_c1 3300050509 Bacteria 7168
386 nmdc:mga06r32_196704_c1 3300050510 Bacteria 2003
387 nmdc:mga06r32_30475_c1 3300050510 Bacteria 5061
388 nmdc:mga06r32_354864_c1 3300050510 Unclassified 1451
389 nmdc:mga06r32_569010_c1 3300050510 Unclassified 1106
390 nmdc:mga08y16_494103_c1 3300050511 Unclassified 1244
391 nmdc:mga08y16_6889_c1 3300050511 Bacteria 11917
392 nmdc:mga08y16_794595_c1 3300050511 Unclassified 939
393 nmdc:mga0n895_143118_c1 3300050512 Unclassified 2420
394 nmdc:mga0n895_16139_c1 3300050512 Bacteria 6844
395 nmdc:mga0n895_305495_c1 3300050512 Bacteria 1613
396 nmdc:mga0n895_597038_c1 3300050512 Unclassified 1107
397 nmdc:mga0n895_873991_c1 3300050512 Bacteria 886
398 nmdc:mga0rr50_137455_c1 3300050513 Unclassified 1963
399 nmdc:mga0rr50_852417_c1 3300050513 Unclassified 777
400 nmdc:mga08x19_1085521_c1 3300050514 Bacteria 568
401 nmdc:mga0a205_2176_c1 3300050515 Bacteria 17241
402 nmdc:mga0a205_219777_c1 3300050515 Unclassified 1786
403 nmdc:mga0a205_265_c1 3300050515 Bacteria 37749
404 nmdc:mga0a205_289595_c1 3300050515 Bacteria 1512
405 nmdc:mga0a205_350243_c1 3300050515 Bacteria 1344
406 nmdc:mga0a205_7162_c1 3300050515 Unclassified 3014
407 Ga0495601_0001369 3300053077 Bacteria 13412
408 Ga0495595_0375850 3300053084 Bacteria 719
409 Ga0495619_0006644 3300053085 Bacteria 7320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10706809 Ga0105245_107068092 126
2 3300009177 Ga0105248_11569255 Ga0105248_115692551 126
3 3300045051 Ga0451576_0418866 Ga0451576_0418866_673_1065 126
4 3300009177 Ga0105248_10006333 Ga0105248_100063339 127
5 3300027907 Ga0207428_10302082 Ga0207428_103020821 127
6 3300028381 Ga0268264_11107344 Ga0268264_111073441 127
7 3300005441 Ga0070700_100476664 Ga0070700_1004766641 128
8 3300005445 Ga0070708_100739402 Ga0070708_1007394022 128
9 3300005844 Ga0068862_101316537 Ga0068862_1013165372 128
10 3300028380 Ga0268265_11018833 Ga0268265_110188331 128
11 3300005364 Ga0070673_101453983 Ga0070673_1014539832 129
12 3300005459 Ga0068867_102293834 Ga0068867_1022938341 129
13 3300005564 Ga0070664_100631087 Ga0070664_1006310872 129
14 3300005617 Ga0068859_102309541 Ga0068859_1023095411 129
15 3300005841 Ga0068863_102059070 Ga0068863_1020590701 129
16 3300006881 Ga0068865_100887122 Ga0068865_1008871222 129
17 3300006931 Ga0097620_102309783 Ga0097620_1023097831 129
18 3300009148 Ga0105243_10977823 Ga0105243_109778232 129
19 3300013297 Ga0157378_11798639 Ga0157378_117986391 129
20 3300013308 Ga0157375_10382268 Ga0157375_103822682 129
21 3300013308 Ga0157375_12907222 Ga0157375_129072222 129
22 3300025937 Ga0207669_10610518 Ga0207669_106105182 129
23 3300025981 Ga0207640_10681184 Ga0207640_106811842 129
24 3300028381 Ga0268264_10528219 Ga0268264_105282192 129
25 3300035120 Ga0373957_0196498 Ga0373957_0196498_76_465 129
26 3300037068 Ga0373925_0476301 Ga0373925_0476301_360_749 129
27 3300046455 Ga0495603_0204610 Ga0495603_0204610_331_720 129
28 3300046525 Ga0495663_0185614 Ga0495663_0185614_154_543 129
29 3300048904 Ga0496101_0725583 Ga0496101_0725583_116_505 129
30 3300005330 Ga0070690_100445324 Ga0070690_1004453241 130
31 3300005440 Ga0070705_101937218 Ga0070705_1019372181 130
32 3300005547 Ga0070693_100208324 Ga0070693_1002083242 130
33 3300005549 Ga0070704_100872728 Ga0070704_1008727281 130
34 3300005937 Ga0081455_10934338 Ga0081455_109343382 130
35 3300006163 Ga0070715_10026811 Ga0070715_100268113 130
36 3300006237 Ga0097621_100096311 Ga0097621_1000963112 130
37 3300006852 Ga0075433_10000341 Ga0075433_100003412 130
38 3300006871 Ga0075434_100066159 Ga0075434_1000661593 130
39 3300009098 Ga0105245_12316064 Ga0105245_123160642 130
40 3300009147 Ga0114129_10165447 Ga0114129_101654472 130
41 3300009176 Ga0105242_10012444 Ga0105242_100124444 130
42 3300009176 Ga0105242_10556972 Ga0105242_105569722 130
43 3300009176 Ga0105242_11460736 Ga0105242_114607362 130
44 3300009177 Ga0105248_10477736 Ga0105248_104777362 130
45 3300013308 Ga0157375_13157837 Ga0157375_131578371 130
46 3300025934 Ga0207686_10505432 Ga0207686_105054322 130
47 3300025941 Ga0207711_10028199 Ga0207711_100281993 130
48 3300031548 Ga0307408_101891594 Ga0307408_1018915941 130
49 3300032002 Ga0307416_100035086 Ga0307416_1000350861 130
50 3300032004 Ga0307414_11156458 Ga0307414_111564581 130
51 3300035170 Ga0373943_0108431 Ga0373943_0108431_796_1188 130
52 3300035172 Ga0373955_0302070 Ga0373955_0302070_537_929 130
53 3300046454 Ga0495592_0027899 Ga0495592_0027899_3747_4139 130
54 3300046472 Ga0495580_0069534 Ga0495580_0069534_945_1337 130
55 3300046511 Ga0495608_0009269 Ga0495608_0009269_1879_2271 130
56 3300046514 Ga0495618_0058752 Ga0495618_0058752_684_1076 130
57 3300046517 Ga0495630_0005354 Ga0495630_0005354_2809_3201 130
58 3300046529 Ga0495652_0240096 Ga0495652_0240096_76_468 130
59 3300046559 Ga0495667_0154264 Ga0495667_0154264_1030_1422 130
60 3300046642 Ga0495634_0026154 Ga0495634_0026154_1996_2388 130
61 3300046689 Ga0495613_0006408 Ga0495613_0006408_4768_5160 130
62 3300046809 Ga0495600_0097095 Ga0495600_0097095_1112_1504 130
63 3300047319 Ga0495674_0007395 Ga0495674_0007395_7762_8154 130
64 3300047471 Ga0495684_0005720 Ga0495684_0005720_5959_6351 130
65 3300048088 Ga0495602_0149914 Ga0495602_0149914_925_1317 130
66 3300048903 Ga0496100_0287553 Ga0496100_0287553_98_505 130
67 3300048904 Ga0496101_0001337 Ga0496101_0001337_4732_5139 130
68 3300048905 Ga0496102_0145157 Ga0496102_0145157_753_1160 130
69 3300048907 Ga0496104_0034023 Ga0496104_0034023_4055_4462 130
70 3300048909 Ga0496106_0403682 Ga0496106_0403682_174_581 130
71 3300048910 Ga0496107_0214518 Ga0496107_0214518_622_1029 130
72 3300048917 Ga0496114_0000423 Ga0496114_0000423_12021_12428 130
73 3300048918 Ga0496115_0622394 Ga0496115_0622394_62_469 130
74 3300050507 nmdc:mga05p37_126521_c1 nmdc:mga05p37_126521_c1_846_1241 130
75 3300050512 nmdc:mga0n895_305495_c1 nmdc:mga0n895_305495_c1_371_766 130
76 3300050515 nmdc:mga0a205_2176_c1 nmdc:mga0a205_2176_c1_11440_11835 130
77 3300053077 Ga0495601_0001369 Ga0495601_0001369_10803_11195 130
78 3300053084 Ga0495595_0375850 Ga0495595_0375850_282_689 130
79 3300053085 Ga0495619_0006644 Ga0495619_0006644_1430_1822 130
80 3300004799 Ga0058863_10027306 Ga0058863_100273062 131
81 3300005327 Ga0070658_10089756 Ga0070658_100897562 131
82 3300005353 Ga0070669_100716271 Ga0070669_1007162712 131
83 3300005353 Ga0070669_101459880 Ga0070669_1014598801 131
84 3300005354 Ga0070675_100107588 Ga0070675_1001075882 131
85 3300005354 Ga0070675_100341627 Ga0070675_1003416272 131
86 3300005354 Ga0070675_100452934 Ga0070675_1004529341 131
87 3300005366 Ga0070659_100180107 Ga0070659_1001801072 131
88 3300005459 Ga0068867_100755703 Ga0068867_1007557032 131
89 3300005467 Ga0070706_100247632 Ga0070706_1002476323 131
90 3300005468 Ga0070707_100003951 Ga0070707_1000039516 131
91 3300005468 Ga0070707_100517840 Ga0070707_1005178402 131
92 3300005535 Ga0070684_101127042 Ga0070684_1011270421 131
93 3300005546 Ga0070696_101106315 Ga0070696_1011063151 131
94 3300005577 Ga0068857_100178500 Ga0068857_1001785002 131
95 3300005719 Ga0068861_101377578 Ga0068861_1013775782 131
96 3300005843 Ga0068860_101633210 Ga0068860_1016332102 131
97 3300005844 Ga0068862_100354437 Ga0068862_1003544372 131
98 3300005844 Ga0068862_100360866 Ga0068862_1003608663 131
99 3300006844 Ga0075428_100035601 Ga0075428_1000356013 131
100 3300006844 Ga0075428_100057437 Ga0075428_1000574372 131
101 3300006844 Ga0075428_100146627 Ga0075428_1001466272 131
102 3300006844 Ga0075428_100273698 Ga0075428_1002736982 131
103 3300006846 Ga0075430_100131780 Ga0075430_1001317802 131
104 3300006846 Ga0075430_100875831 Ga0075430_1008758311 131
105 3300006847 Ga0075431_100020127 Ga0075431_1000201274 131
106 3300006847 Ga0075431_100161136 Ga0075431_1001611362 131
107 3300006847 Ga0075431_100338309 Ga0075431_1003383092 131
108 3300006847 Ga0075431_100520628 Ga0075431_1005206281 131
109 3300006852 Ga0075433_10331729 Ga0075433_103317292 131
110 3300006852 Ga0075433_10451826 Ga0075433_104518262 131
111 3300006852 Ga0075433_10777252 Ga0075433_107772522 131
112 3300006852 Ga0075433_11051847 Ga0075433_110518472 131
113 3300006871 Ga0075434_100009764 Ga0075434_1000097643 131
114 3300006871 Ga0075434_100322745 Ga0075434_1003227453 131
115 3300006880 Ga0075429_100015948 Ga0075429_1000159484 131
116 3300006914 Ga0075436_101213952 Ga0075436_1012139522 131
117 3300007076 Ga0075435_100251075 Ga0075435_1002510752 131
118 3300007076 Ga0075435_100630318 Ga0075435_1006303182 131
119 3300009094 Ga0111539_10140461 Ga0111539_101404614 131
120 3300009094 Ga0111539_11988292 Ga0111539_119882921 131
121 3300009094 Ga0111539_12780015 Ga0111539_127800152 131
122 3300009147 Ga0114129_10001545 Ga0114129_1000154531 131
123 3300009147 Ga0114129_10038173 Ga0114129_100381732 131
124 3300009147 Ga0114129_10300876 Ga0114129_103008762 131
125 3300009147 Ga0114129_10758950 Ga0114129_107589502 131
126 3300009177 Ga0105248_10205927 Ga0105248_102059272 131
127 3300011119 Ga0105246_11215621 Ga0105246_112156212 131
128 3300011119 Ga0105246_11393884 Ga0105246_113938841 131
129 3300013308 Ga0157375_10396853 Ga0157375_103968532 131
130 3300017792 Ga0163161_10346169 Ga0163161_103461692 131
131 3300025922 Ga0207646_10008885 Ga0207646_100088856 131
132 3300025922 Ga0207646_10347683 Ga0207646_103476832 131
133 3300025923 Ga0207681_10800460 Ga0207681_108004601 131
134 3300025923 Ga0207681_11028526 Ga0207681_110285261 131
135 3300025923 Ga0207681_11488183 Ga0207681_114881831 131
136 3300025926 Ga0207659_10031459 Ga0207659_100314593 131
137 3300025941 Ga0207711_10204518 Ga0207711_102045182 131
138 3300025942 Ga0207689_10009838 Ga0207689_100098383 131
139 3300026088 Ga0207641_10499731 Ga0207641_104997312 131
140 3300026116 Ga0207674_11001651 Ga0207674_110016511 131
141 3300026121 Ga0207683_10729962 Ga0207683_107299622 131
142 3300028379 Ga0268266_11625409 Ga0268266_116254091 131
143 3300028380 Ga0268265_10326414 Ga0268265_103264142 131
144 3300028380 Ga0268265_11150591 Ga0268265_111505912 131
145 3300028381 Ga0268264_11024018 Ga0268264_110240182 131
146 3300031731 Ga0307405_11905377 Ga0307405_119053772 131
147 3300032002 Ga0307416_101510728 Ga0307416_1015107282 131
148 3300032004 Ga0307414_11012377 Ga0307414_110123772 131
149 3300036401 Ga0373937_0248730 Ga0373937_0248730_487_882 131
150 3300042008 Ga0439450_116054 Ga0439450_116054_156_551 131
151 3300042439 Ga0439464_0145799 Ga0439464_0145799_246_641 131
152 3300046539 Ga0495621_0253899 Ga0495621_0253899_145_540 131
153 3300046679 Ga0495623_0244565 Ga0495623_0244565_97_492 131
154 3300049568 Ga0501031_1101857 Ga0501031_1101857_17_412 131
155 3300049649 Ga0501198_026011 Ga0501198_026011_33_428 131
156 3300049661 Ga0501217_230666 Ga0501217_230666_176_571 131
157 3300049668 Ga0501233_178384 Ga0501233_178384_83_478 131
158 3300049679 Ga0501249_049015 Ga0501249_049015_65_460 131
159 3300049743 Ga0501081_1120698 Ga0501081_1120698_187_582 131
160 3300050507 nmdc:mga05p37_27663_c1 nmdc:mga05p37_27663_c1_303_698 131
161 3300050507 nmdc:mga05p37_4062_c1 nmdc:mga05p37_4062_c1_427_822 131
162 3300050507 nmdc:mga05p37_57030_c1 nmdc:mga05p37_57030_c1_3463_3858 131
163 3300050507 nmdc:mga05p37_714527_c1 nmdc:mga05p37_714527_c1_528_923 131
164 3300050508 nmdc:mga09592_70690_c1 nmdc:mga09592_70690_c1_2532_2927 131
165 3300050509 nmdc:mga0qj67_404862_c1 nmdc:mga0qj67_404862_c1_615_1010 131
166 3300050509 nmdc:mga0qj67_9710_c1 nmdc:mga0qj67_9710_c1_495_890 131
167 3300050510 nmdc:mga06r32_196704_c1 nmdc:mga06r32_196704_c1_109_504 131
168 3300050510 nmdc:mga06r32_30475_c1 nmdc:mga06r32_30475_c1_964_1359 131
169 3300050510 nmdc:mga06r32_354864_c1 nmdc:mga06r32_354864_c1_532_927 131
170 3300050510 nmdc:mga06r32_569010_c1 nmdc:mga06r32_569010_c1_247_645 131
171 3300050511 nmdc:mga08y16_494103_c1 nmdc:mga08y16_494103_c1_809_1204 131
172 3300050512 nmdc:mga0n895_143118_c1 nmdc:mga0n895_143118_c1_366_761 131
173 3300050512 nmdc:mga0n895_597038_c1 nmdc:mga0n895_597038_c1_307_702 131
174 3300050512 nmdc:mga0n895_873991_c1 nmdc:mga0n895_873991_c1_445_840 131
175 3300050513 nmdc:mga0rr50_852417_c1 nmdc:mga0rr50_852417_c1_11_406 131
176 3300050514 nmdc:mga08x19_1085521_c1 nmdc:mga08x19_1085521_c1_19_414 131
177 3300050515 nmdc:mga0a205_219777_c1 nmdc:mga0a205_219777_c1_568_963 131
178 3300050515 nmdc:mga0a205_350243_c1 nmdc:mga0a205_350243_c1_100_495 131
179 3300050515 nmdc:mga0a205_7162_c1 nmdc:mga0a205_7162_c1_2228_2623 131
180 3300002077 JGI24744J21845_10064818 JGI24744J21845_100648182 132
181 3300004800 Ga0058861_11096727 Ga0058861_110967271 132
182 3300005290 Ga0065712_10279785 Ga0065712_102797851 132
183 3300005293 Ga0065715_10417621 Ga0065715_104176211 132
184 3300005327 Ga0070658_10057865 Ga0070658_100578653 132
185 3300005328 Ga0070676_10030184 Ga0070676_100301845 132
186 3300005328 Ga0070676_10153546 Ga0070676_101535462 132
187 3300005329 Ga0070683_100660704 Ga0070683_1006607042 132
188 3300005330 Ga0070690_100769259 Ga0070690_1007692592 132
189 3300005331 Ga0070670_100053324 Ga0070670_1000533242 132
190 3300005331 Ga0070670_100557858 Ga0070670_1005578581 132
191 3300005331 Ga0070670_101043647 Ga0070670_1010436472 132
192 3300005333 Ga0070677_10105462 Ga0070677_101054622 132
193 3300005335 Ga0070666_10065546 Ga0070666_100655462 132
194 3300005335 Ga0070666_10329446 Ga0070666_103294462 132
195 3300005336 Ga0070680_100138371 Ga0070680_1001383712 132
196 3300005338 Ga0068868_100828114 Ga0068868_1008281142 132
197 3300005340 Ga0070689_100025627 Ga0070689_1000256275 132
198 3300005341 Ga0070691_10015265 Ga0070691_100152654 132
199 3300005344 Ga0070661_100178911 Ga0070661_1001789112 132
200 3300005344 Ga0070661_100212868 Ga0070661_1002128682 132
201 3300005344 Ga0070661_101215360 Ga0070661_1012153602 132
202 3300005353 Ga0070669_100012152 Ga0070669_1000121526 132
203 3300005353 Ga0070669_100034946 Ga0070669_1000349462 132
204 3300005354 Ga0070675_100000327 Ga0070675_10000032719 132
205 3300005354 Ga0070675_100039589 Ga0070675_1000395892 132
206 3300005354 Ga0070675_100184988 Ga0070675_1001849882 132
207 3300005354 Ga0070675_100549274 Ga0070675_1005492742 132
208 3300005354 Ga0070675_101023013 Ga0070675_1010230132 132
209 3300005355 Ga0070671_100227698 Ga0070671_1002276982 132
210 3300005355 Ga0070671_100896301 Ga0070671_1008963011 132
211 3300005356 Ga0070674_100210950 Ga0070674_1002109502 132
212 3300005356 Ga0070674_100820562 Ga0070674_1008205622 132
213 3300005364 Ga0070673_100039663 Ga0070673_1000396632 132
214 3300005364 Ga0070673_100146573 Ga0070673_1001465732 132
215 3300005364 Ga0070673_100237031 Ga0070673_1002370312 132
216 3300005364 Ga0070673_100669987 Ga0070673_1006699872 132
217 3300005364 Ga0070673_101252689 Ga0070673_1012526891 132
218 3300005365 Ga0070688_100360187 Ga0070688_1003601872 132
219 3300005367 Ga0070667_100143805 Ga0070667_1001438053 132
220 3300005367 Ga0070667_101092134 Ga0070667_1010921342 132
221 3300005367 Ga0070667_101134840 Ga0070667_1011348402 132
222 3300005438 Ga0070701_10343440 Ga0070701_103434402 132
223 3300005440 Ga0070705_100000131 Ga0070705_1000001316 132
224 3300005441 Ga0070700_100001233 Ga0070700_1000012333 132
225 3300005441 Ga0070700_100119223 Ga0070700_1001192232 132
226 3300005441 Ga0070700_100121294 Ga0070700_1001212942 132
227 3300005444 Ga0070694_100000044 Ga0070694_10000004412 132
228 3300005444 Ga0070694_100135816 Ga0070694_1001358162 132
229 3300005456 Ga0070678_100632275 Ga0070678_1006322752 132
230 3300005456 Ga0070678_101021758 Ga0070678_1010217581 132
231 3300005456 Ga0070678_101113326 Ga0070678_1011133261 132
232 3300005457 Ga0070662_100179383 Ga0070662_1001793832 132
233 3300005459 Ga0068867_100011237 Ga0068867_1000112377 132
234 3300005459 Ga0068867_100664385 Ga0068867_1006643852 132
235 3300005471 Ga0070698_100480242 Ga0070698_1004802422 132
236 3300005471 Ga0070698_100560731 Ga0070698_1005607312 132
237 3300005518 Ga0070699_100583923 Ga0070699_1005839232 132
238 3300005543 Ga0070672_100145907 Ga0070672_1001459072 132
239 3300005543 Ga0070672_100181401 Ga0070672_1001814012 132
240 3300005543 Ga0070672_101647127 Ga0070672_1016471272 132
241 3300005544 Ga0070686_100022868 Ga0070686_1000228682 132
242 3300005545 Ga0070695_100000526 Ga0070695_10000052612 132
243 3300005546 Ga0070696_100000056 Ga0070696_10000005612 132
244 3300005548 Ga0070665_101506273 Ga0070665_1015062732 132
245 3300005549 Ga0070704_100368597 Ga0070704_1003685973 132
246 3300005564 Ga0070664_100006685 Ga0070664_1000066852 132
247 3300005564 Ga0070664_100037769 Ga0070664_1000377694 132
248 3300005564 Ga0070664_100919473 Ga0070664_1009194731 132
249 3300005564 Ga0070664_100941724 Ga0070664_1009417242 132
250 3300005577 Ga0068857_100469562 Ga0068857_1004695622 132
251 3300005578 Ga0068854_100453783 Ga0068854_1004537832 132
252 3300005615 Ga0070702_100138536 Ga0070702_1001385362 132
253 3300005616 Ga0068852_100632978 Ga0068852_1006329782 132
254 3300005617 Ga0068859_100178388 Ga0068859_1001783882 132
255 3300005617 Ga0068859_101278271 Ga0068859_1012782712 132
256 3300005618 Ga0068864_100450591 Ga0068864_1004505912 132
257 3300005618 Ga0068864_100596892 Ga0068864_1005968921 132
258 3300005718 Ga0068866_10013047 Ga0068866_100130472 132
259 3300005719 Ga0068861_100004918 Ga0068861_1000049189 132
260 3300005840 Ga0068870_10224438 Ga0068870_102244382 132
261 3300005840 Ga0068870_10648192 Ga0068870_106481922 132
262 3300005841 Ga0068863_100329181 Ga0068863_1003291812 132
263 3300005841 Ga0068863_100588368 Ga0068863_1005883682 132
264 3300005842 Ga0068858_100188310 Ga0068858_1001883102 132
265 3300005843 Ga0068860_100047378 Ga0068860_1000473784 132
266 3300005985 Ga0081539_10000108 Ga0081539_1000010823 132
267 3300006058 Ga0075432_10185017 Ga0075432_101850172 132
268 3300006058 Ga0075432_10412908 Ga0075432_104129081 132
269 3300006237 Ga0097621_100508679 Ga0097621_1005086791 132
270 3300006237 Ga0097621_101032935 Ga0097621_1010329352 132
271 3300006844 Ga0075428_100092939 Ga0075428_1000929392 132
272 3300006847 Ga0075431_101172237 Ga0075431_1011722372 132
273 3300006852 Ga0075433_10020192 Ga0075433_100201926 132
274 3300006852 Ga0075433_10981291 Ga0075433_109812912 132
275 3300006871 Ga0075434_100002942 Ga0075434_1000029427 132
276 3300006881 Ga0068865_100002789 Ga0068865_10000278910 132
277 3300006881 Ga0068865_100487335 Ga0068865_1004873352 132
278 3300006931 Ga0097620_100178373 Ga0097620_1001783732 132
279 3300006931 Ga0097620_101278243 Ga0097620_1012782432 132
280 3300007076 Ga0075435_100051866 Ga0075435_1000518663 132
281 3300009094 Ga0111539_10013102 Ga0111539_100131022 132
282 3300009094 Ga0111539_10926635 Ga0111539_109266352 132
283 3300009094 Ga0111539_12455402 Ga0111539_124554022 132
284 3300009147 Ga0114129_10528428 Ga0114129_105284282 132
285 3300009147 Ga0114129_13136551 Ga0114129_131365511 132
286 3300009148 Ga0105243_10089152 Ga0105243_100891523 132
287 3300009176 Ga0105242_10714558 Ga0105242_107145583 132
288 3300009176 Ga0105242_10829382 Ga0105242_108293822 132
289 3300009177 Ga0105248_10126425 Ga0105248_101264252 132
290 3300011119 Ga0105246_10078840 Ga0105246_100788402 132
291 3300011119 Ga0105246_10904742 Ga0105246_109047421 132
292 3300013306 Ga0163162_10306212 Ga0163162_103062121 132
293 3300013306 Ga0163162_10369473 Ga0163162_103694733 132
294 3300013308 Ga0157375_10047731 Ga0157375_100477313 132
295 3300013308 Ga0157375_10176382 Ga0157375_101763823 132
296 3300013308 Ga0157375_11166188 Ga0157375_111661882 132
297 3300014325 Ga0163163_10002567 Ga0163163_100025673 132
298 3300014325 Ga0163163_10084648 Ga0163163_100846482 132
299 3300014326 Ga0157380_10001054 Ga0157380_100010548 132
300 3300014326 Ga0157380_10070376 Ga0157380_100703762 132
301 3300014326 Ga0157380_10337236 Ga0157380_103372361 132
302 3300014745 Ga0157377_10063304 Ga0157377_100633042 132
303 3300014969 Ga0157376_10546106 Ga0157376_105461062 132
304 3300014969 Ga0157376_10845912 Ga0157376_108459122 132
305 3300015262 Ga0182007_10293172 Ga0182007_102931721 132
306 3300017792 Ga0163161_10138730 Ga0163161_101387302 132
307 3300017792 Ga0163161_10249595 Ga0163161_102495952 132
308 3300017792 Ga0163161_11117282 Ga0163161_111172821 132
309 3300025893 Ga0207682_10002391 Ga0207682_100023912 132
310 3300025893 Ga0207682_10071355 Ga0207682_100713552 132
311 3300025899 Ga0207642_10398833 Ga0207642_103988332 132
312 3300025901 Ga0207688_10037800 Ga0207688_100378003 132
313 3300025903 Ga0207680_10027531 Ga0207680_100275312 132
314 3300025907 Ga0207645_10043057 Ga0207645_100430572 132
315 3300025907 Ga0207645_10189523 Ga0207645_101895232 132
316 3300025908 Ga0207643_10071740 Ga0207643_100717402 132
317 3300025908 Ga0207643_10272912 Ga0207643_102729122 132
318 3300025909 Ga0207705_10143761 Ga0207705_101437612 132
319 3300025917 Ga0207660_10511171 Ga0207660_105111712 132
320 3300025920 Ga0207649_10204078 Ga0207649_102040782 132
321 3300025920 Ga0207649_10388260 Ga0207649_103882602 132
322 3300025920 Ga0207649_10734375 Ga0207649_107343752 132
323 3300025922 Ga0207646_10343350 Ga0207646_103433502 132
324 3300025923 Ga0207681_10012655 Ga0207681_100126553 132
325 3300025923 Ga0207681_10521315 Ga0207681_105213151 132
326 3300025924 Ga0207694_10023116 Ga0207694_100231165 132
327 3300025925 Ga0207650_10014231 Ga0207650_100142312 132
328 3300025926 Ga0207659_10000302 Ga0207659_1000030214 132
329 3300025926 Ga0207659_10013066 Ga0207659_100130665 132
330 3300025926 Ga0207659_10378260 Ga0207659_103782602 132
331 3300025926 Ga0207659_11556789 Ga0207659_115567892 132
332 3300025927 Ga0207687_10155611 Ga0207687_101556113 132
333 3300025927 Ga0207687_10629290 Ga0207687_106292902 132
334 3300025931 Ga0207644_10131685 Ga0207644_101316853 132
335 3300025931 Ga0207644_10772396 Ga0207644_107723962 132
336 3300025933 Ga0207706_10103796 Ga0207706_101037962 132
337 3300025933 Ga0207706_11017837 Ga0207706_110178371 132
338 3300025934 Ga0207686_10462441 Ga0207686_104624412 132
339 3300025935 Ga0207709_10053710 Ga0207709_100537102 132
340 3300025937 Ga0207669_10072544 Ga0207669_100725441 132
341 3300025937 Ga0207669_10108190 Ga0207669_101081902 132
342 3300025937 Ga0207669_10370426 Ga0207669_103704262 132
343 3300025937 Ga0207669_10453056 Ga0207669_104530561 132
344 3300025937 Ga0207669_10652649 Ga0207669_106526491 132
345 3300025940 Ga0207691_10171804 Ga0207691_101718043 132
346 3300025940 Ga0207691_10299652 Ga0207691_102996522 132
347 3300025940 Ga0207691_10417573 Ga0207691_104175732 132
348 3300025940 Ga0207691_10859303 Ga0207691_108593032 132
349 3300025942 Ga0207689_10014537 Ga0207689_100145373 132
350 3300025944 Ga0207661_10547842 Ga0207661_105478422 132
351 3300025945 Ga0207679_10005987 Ga0207679_100059876 132
352 3300025945 Ga0207679_10045209 Ga0207679_100452093 132
353 3300025945 Ga0207679_10099731 Ga0207679_100997312 132
354 3300025945 Ga0207679_11033112 Ga0207679_110331121 132
355 3300025960 Ga0207651_10072926 Ga0207651_100729264 132
356 3300025960 Ga0207651_10296288 Ga0207651_102962882 132
357 3300025960 Ga0207651_10549159 Ga0207651_105491592 132
358 3300025960 Ga0207651_11102481 Ga0207651_111024812 132
359 3300025961 Ga0207712_10393397 Ga0207712_103933972 132
360 3300025972 Ga0207668_10574670 Ga0207668_105746702 132
361 3300025986 Ga0207658_10097975 Ga0207658_100979752 132
362 3300025986 Ga0207658_11196809 Ga0207658_111968091 132
363 3300026023 Ga0207677_10283703 Ga0207677_102837032 132
364 3300026035 Ga0207703_10117249 Ga0207703_101172493 132
365 3300026035 Ga0207703_10227200 Ga0207703_102272002 132
366 3300026067 Ga0207678_10031644 Ga0207678_100316442 132
367 3300026075 Ga0207708_10002329 Ga0207708_1000232911 132
368 3300026075 Ga0207708_10158320 Ga0207708_101583203 132
369 3300026075 Ga0207708_10181741 Ga0207708_101817413 132
370 3300026088 Ga0207641_10400891 Ga0207641_104008912 132
371 3300026088 Ga0207641_11643243 Ga0207641_116432431 132
372 3300026089 Ga0207648_10002268 Ga0207648_1000226810 132
373 3300026089 Ga0207648_10921104 Ga0207648_109211042 132
374 3300026095 Ga0207676_10025124 Ga0207676_100251246 132
375 3300026095 Ga0207676_10372269 Ga0207676_103722692 132
376 3300026095 Ga0207676_11263483 Ga0207676_112634832 132
377 3300026118 Ga0207675_100010890 Ga0207675_1000108902 132
378 3300026121 Ga0207683_10052872 Ga0207683_100528722 132
379 3300026121 Ga0207683_10235341 Ga0207683_102353412 132
380 3300026121 Ga0207683_10500140 Ga0207683_105001402 132
381 3300026121 Ga0207683_10733509 Ga0207683_107335092 132
382 3300026142 Ga0207698_10476642 Ga0207698_104766422 132
383 3300026142 Ga0207698_11336117 Ga0207698_113361171 132
384 3300027907 Ga0207428_10012246 Ga0207428_100122466 132
385 3300028379 Ga0268266_11058331 Ga0268266_110583311 132
386 3300028381 Ga0268264_10028830 Ga0268264_100288305 132
387 3300041408 Ga0439453_0029826 Ga0439453_0029826_487_891 132
388 3300042435 Ga0439434_0201811 Ga0439434_0201811_193_594 132
389 3300046499 Ga0495594_0427246 Ga0495594_0427246_37_435 132
390 3300046537 Ga0495598_0099735 Ga0495598_0099735_262_672 132
391 3300046674 Ga0495588_0331876 Ga0495588_0331876_286_696 132
392 3300046681 Ga0495647_0434120 Ga0495647_0434120_81_491 132
393 3300046683 Ga0495658_0019182 Ga0495658_0019182_1845_2255 132
394 3300049521 Ga0501298_031492 Ga0501298_031492_43_465 132
395 3300049665 Ga0501227_255055 Ga0501227_255055_25_447 132
396 3300049707 Ga0501234_060835 Ga0501234_060835_81_503 132
397 3300049774 Ga0501278_038070 Ga0501278_038070_45_467 132
398 3300049779 Ga0501283_008351 Ga0501283_008351_757_1179 132
399 3300050507 nmdc:mga05p37_1265132_c1 nmdc:mga05p37_1265132_c1_181_600 132
400 3300050507 nmdc:mga05p37_2049302_c1 nmdc:mga05p37_2049302_c1_53_478 132
401 3300050507 nmdc:mga05p37_627984_c1 nmdc:mga05p37_627984_c1_157_576 132
402 3300050508 nmdc:mga09592_105816_c1 nmdc:mga09592_105816_c1_1282_1701 132
403 3300050509 nmdc:mga0qj67_107125_c1 nmdc:mga0qj67_107125_c1_72_491 132
404 3300050511 nmdc:mga08y16_6889_c1 nmdc:mga08y16_6889_c1_4906_5325 132
405 3300050511 nmdc:mga08y16_794595_c1 nmdc:mga08y16_794595_c1_143_553 132
406 3300050512 nmdc:mga0n895_16139_c1 nmdc:mga0n895_16139_c1_6234_6656 132
407 3300050513 nmdc:mga0rr50_137455_c1 nmdc:mga0rr50_137455_c1_854_1276 132
408 3300050515 nmdc:mga0a205_265_c1 nmdc:mga0a205_265_c1_29788_30210 132
409 3300050515 nmdc:mga0a205_289595_c1 nmdc:mga0a205_289595_c1_999_1418 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

13

112

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z6k-assembly2.cif.gz_B crystal structure of full-length human rpa14/32 heterodimer 0.7834 35 116
3kdf-assembly3.cif.gz_D x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression 0.7812 35 116
2z6k-assembly1.cif.gz_A crystal structure of full-length human rpa14/32 heterodimer 0.7764 35 116
1quq-assembly3.cif.gz_A complex of replication protein a subunits rpa14 and rpa32 0.7561 35 116
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.7497 35 116
ID Description Score Start End Superfamily
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7703 36 96 2.40.50.140
af_Q58598_204_318_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7641 34 116 2.40.50.140
1vciA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7543 32 97 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7455 36 96 2.40.50.140
af_Q59048_37_141_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7391 34 116 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3N5GG74-F1-model_v4 DNA-binding protein 0.9991 34 132
AF-A0A3N5GG74-F1-model_v4 DNA-binding protein 0.9793 34 132
AF-A0A7Y4SNX0-F1-model_v4 Uncharacterized protein 0.9701 21 132
AF-A0A2V8FIH6-F1-model_v4 DUF5666 domain-containing protein 0.9588 20 126
AF-A0A2V8GRW0-F1-model_v4 DUF5666 domain-containing protein 0.9584 21 122

Feature Viewer

pLDDT pTM Quality
89.41 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map