F436719

General Info

Members Datasets Scaffolds Average Seq Length
408 204 816 428

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10014827|Ga0157374_100148274
Length 477
Sequence LKKIALAFKWAKVSTMAVLGKPENEKEAPVTSPLVTRWKLIPGWIEPWRSRLSNFGKRTRFWRRRLLLFLAVVGPGVITSNVDNDAGGISVYSQAGAMYGYALLWSLIPMTIALYVTEEMCARMGVVTGKGLSDLIREEFGFRPTFFVILAGLVVDMGNVCAEFAGVAASMQLFGISKYISVPIAALAVWILVLRGTSRQVEKIFLAACVLYLSYVASAFLAKPDWLLAARSTVIPTMHLDGGYLLMLTALIGTTIAPWQFFYLQAGFVEKRVSARQYAQARMDVLFGSVSCMVIVFFIIVCTGATLFVTGHHVINDAGDAAQALVPLAGKWAAKLFAFGLLNASLFAASILPLSTAHVICEGMGFEAGIDHKFNDAPIFYSLYTGMIVVGAAVILFPRAPLQKILVLSQVGNGIWLPVVLIFMLMLINRRDLMGEFVNTKTFNVVAWVTAVAVIALALVLAYVTIAQPNGLPAGSG

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
107 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.21
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10014827 3300013296 Bacteria 6828
2 rootH2_10090309 3300003320 Bacteria 2589
3 rootL2_10083392 3300003322 Bacteria 2676
4 Ga0070658_10087948 3300005327 Bacteria 2558
5 Ga0070683_100177529 3300005329 Bacteria 2022
6 Ga0070690_100000146 3300005330 Bacteria 35905
7 Ga0068869_100001335 3300005334 Bacteria 14613
8 Ga0070666_10001461 3300005335 Bacteria 14342
9 Ga0070680_100032949 3300005336 Unclassified 4172
10 Ga0068868_100081560 3300005338 Bacteria 2593
11 Ga0070660_100034551 3300005339 Bacteria 3821
12 Ga0070660_100089478 3300005339 Unclassified 2425
13 Ga0070689_100007899 3300005340 Bacteria 7463
14 Ga0070661_100026420 3300005344 Bacteria 4176
15 Ga0070661_100165870 3300005344 Unclassified 1675
16 Ga0070667_100000282 3300005367 Bacteria 57538
17 Ga0070713_100016173 3300005436 Bacteria 5606
18 Ga0070711_100007795 3300005439 Bacteria 6523
19 Ga0070711_100141664 3300005439 Unclassified 1803
20 Ga0070705_100002438 3300005440 Bacteria 9351
21 Ga0070694_100005001 3300005444 Bacteria 7995
22 Ga0070708_100004620 3300005445 Bacteria 10844
23 Ga0070708_100028621 3300005445 Bacteria 4797
24 Ga0070708_100076741 3300005445 Bacteria 3018
25 Ga0070708_100130487 3300005445 Bacteria 2325
26 Ga0070708_100139633 3300005445 Bacteria 2246
27 Ga0070708_100160748 3300005445 Bacteria 2093
28 Ga0070681_10010349 3300005458 Bacteria 9208
29 Ga0070681_10022494 3300005458 Bacteria 6330
30 Ga0070681_10039628 3300005458 Unclassified 4722
31 Ga0070681_10056326 3300005458 Bacteria 3913
32 Ga0070681_10128392 3300005458 Bacteria 2468
33 Ga0068867_100035056 3300005459 Unclassified 3639
34 Ga0068867_100094967 3300005459 Bacteria 2268
35 Ga0070706_100011845 3300005467 Bacteria 8094
36 Ga0070706_100013524 3300005467 Bacteria 7549
37 Ga0070706_100027715 3300005467 Bacteria 5211
38 Ga0070706_100059935 3300005467 Bacteria 3513
39 Ga0070707_100000016 3300005468 Bacteria 141729
40 Ga0070707_100009521 3300005468 Bacteria 9028
41 Ga0070707_100017200 3300005468 Bacteria 6794
42 Ga0070707_100031879 3300005468 Bacteria 5021
43 Ga0070707_100119884 3300005468 Bacteria 2554
44 Ga0070707_100159435 3300005468 Bacteria 2198
45 Ga0070698_100000639 3300005471 Bacteria 37630
46 Ga0070698_100013121 3300005471 Bacteria 8768
47 Ga0070698_100025710 3300005471 Bacteria 6133
48 Ga0070698_100176159 3300005471 Bacteria 2078
49 Ga0070699_100047012 3300005518 Unclassified 3734
50 Ga0070699_100071943 3300005518 Bacteria 3008
51 Ga0070699_100075229 3300005518 Bacteria 2939
52 Ga0070699_100187093 3300005518 Bacteria 1839
53 Ga0070699_100254954 3300005518 Bacteria 1568
54 Ga0070679_100014705 3300005530 Bacteria 7523
55 Ga0070679_100014808 3300005530 Bacteria 7493
56 Ga0070679_100048760 3300005530 Bacteria 4218
57 Ga0070684_100062268 3300005535 Bacteria 3268
58 Ga0070697_100002259 3300005536 Bacteria 14778
59 Ga0070697_100004479 3300005536 Bacteria 10747
60 Ga0070697_100157273 3300005536 Bacteria 1919
61 Ga0068853_100075720 3300005539 Bacteria 2937
62 Ga0068853_100098091 3300005539 Unclassified 2587
63 Ga0068853_100112716 3300005539 Bacteria 2417
64 Ga0070695_100007966 3300005545 Bacteria 6274
65 Ga0070695_100009897 3300005545 Bacteria 5681
66 Ga0070695_100073652 3300005545 Bacteria 2242
67 Ga0070696_100032444 3300005546 Bacteria 3583
68 Ga0070693_100000486 3300005547 Bacteria 17813
69 Ga0070693_100025023 3300005547 Unclassified 3208
70 Ga0070665_100008925 3300005548 Bacteria 10156
71 Ga0068855_100000908 3300005563 Bacteria 36747
72 Ga0068855_100005316 3300005563 Bacteria 15726
73 Ga0068855_100048910 3300005563 Unclassified 4989
74 Ga0068855_100058367 3300005563 Bacteria 4519
75 Ga0068855_100074834 3300005563 Bacteria 3933
76 Ga0070664_100018231 3300005564 Bacteria 5761
77 Ga0068856_100000558 3300005614 Bacteria 40948
78 Ga0068856_100009138 3300005614 Bacteria 9636
79 Ga0068856_100155511 3300005614 Bacteria 2296
80 Ga0068856_100164039 3300005614 Bacteria 2233
81 Ga0068852_100024251 3300005616 Bacteria 4900
82 Ga0068852_100106863 3300005616 Bacteria 2538
83 Ga0068852_100185690 3300005616 Bacteria 1958
84 Ga0068866_10063756 3300005718 Bacteria 1922
85 Ga0068863_100034460 3300005841 Bacteria 4822
86 Ga0068863_100042672 3300005841 Bacteria 4310
87 Ga0068863_100114729 3300005841 Unclassified 2566
88 Ga0068858_100001093 3300005842 Bacteria 28076
89 Ga0068858_100001835 3300005842 Bacteria 21644
90 Ga0068858_100080617 3300005842 Bacteria 3025
91 Ga0068860_100003050 3300005843 Bacteria 17296
92 Ga0068860_100060236 3300005843 Bacteria 3608
93 Ga0081539_10008920 3300005985 Bacteria 8554
94 Ga0070716_100009627 3300006173 Bacteria 4819
95 Ga0097621_100003487 3300006237 Bacteria 10847
96 Ga0097621_100057939 3300006237 Unclassified 3170
97 Ga0097621_100062485 3300006237 Bacteria 3057
98 Ga0097621_100095553 3300006237 Bacteria 2493
99 Ga0068871_100000507 3300006358 Bacteria 26656
100 Ga0068871_100092793 3300006358 Archaea 2518
101 Ga0068871_100112890 3300006358 Bacteria 2288
102 Ga0068871_100127835 3300006358 Bacteria 2152
103 Ga0068865_100123010 3300006881 Bacteria 1932
104 Ga0075436_100006053 3300006914 Bacteria 8304
105 Ga0075435_100234469 3300007076 Bacteria 1559
106 Ga0099794_10004379 3300007265 Bacteria 5534
107 Ga0099794_10015102 3300007265 Bacteria 3401
108 Ga0099794_10059115 3300007265 Bacteria 1859
109 Ga0099794_10082924 3300007265 Archaea 1583
110 Ga0105240_10009151 3300009093 Bacteria 14052
111 Ga0105240_10067281 3300009093 Bacteria 4441
112 Ga0105240_10151836 3300009093 Bacteria 2758
113 Ga0105240_10193423 3300009093 Archaea 2390
114 Ga0105247_10166048 3300009101 Bacteria 1465
115 Ga0114129_10048357 3300009147 Bacteria 5976
116 Ga0105243_10038739 3300009148 Bacteria 3713
117 Ga0105241_10025715 3300009174 Bacteria 4376
118 Ga0105241_10033500 3300009174 Bacteria 3856
119 Ga0105242_10035810 3300009176 Bacteria 3980
120 Ga0105248_10106671 3300009177 Bacteria 3158
121 Ga0105237_10010525 3300009545 Bacteria 9829
122 Ga0105237_10054791 3300009545 Bacteria 3995
123 Ga0105238_10000057 3300009551 Bacteria 134757
124 Ga0105238_10101148 3300009551 Bacteria 2865
125 Ga0105249_10054704 3300009553 Unclassified 3650
126 Ga0099796_10035614 3300010159 Bacteria 1652
127 Ga0105239_10019348 3300010375 Bacteria 7520
128 Ga0105239_10036022 3300010375 Bacteria 5432
129 Ga0105239_10185982 3300010375 Bacteria 2325
130 Ga0157373_10069379 3300013100 Bacteria 2492
131 Ga0157370_10039895 3300013104 Bacteria 4535
132 Ga0157369_10000321 3300013105 Bacteria 64359
133 Ga0157369_10032959 3300013105 Bacteria 5694
134 Ga0157369_10052058 3300013105 Bacteria 4430
135 Ga0157369_10119782 3300013105 Unclassified 2793
136 Ga0157374_10001041 3300013296 Bacteria 24059
137 Ga0157374_10048757 3300013296 Bacteria 3931
138 Ga0157374_10161642 3300013296 Unclassified 2181
139 Ga0157378_10000041 3300013297 Bacteria 112069
140 Ga0157378_10000278 3300013297 Bacteria 49905
141 Ga0157378_10001098 3300013297 Bacteria 24688
142 Ga0157378_10002788 3300013297 Bacteria 15577
143 Ga0157378_10027852 3300013297 Bacteria 4983
144 Ga0163162_10013312 3300013306 Bacteria 8035
145 Ga0157372_10000185 3300013307 Bacteria 69055
146 Ga0157372_10005271 3300013307 Bacteria 13727
147 Ga0157372_10080155 3300013307 Bacteria 3693
148 Ga0157372_10151511 3300013307 Bacteria 2677
149 Ga0157372_10209607 3300013307 Unclassified 2258
150 Ga0157372_10235003 3300013307 Unclassified 2126
151 Ga0163163_10214100 3300014325 Bacteria 1976
152 Ga0157379_10001148 3300014968 Bacteria 21593
153 Ga0157379_10006619 3300014968 Bacteria 9997
154 Ga0157379_10079145 3300014968 Bacteria 2943
155 Ga0157376_10005331 3300014969 Bacteria 8978
156 Ga0157376_10066201 3300014969 Bacteria 3054
157 Ga0157376_10100478 3300014969 Bacteria 2526
158 Ga0213872_10005881 3300021361 Bacteria 6228
159 Ga0213872_10012859 3300021361 Bacteria 3927
160 Ga0213874_10000369 3300021377 Bacteria 8893
161 Ga0213876_10004241 3300021384 Bacteria 8043
162 Ga0213875_10000001 3300021388 Bacteria 2793540
163 Ga0224572_1002318 3300024225 Bacteria 3048
164 Ga0224572_1007136 3300024225 Unclassified 2039
165 Ga0228598_1001514 3300024227 Bacteria 5095
166 Ga0207653_10007482 3300025885 Bacteria 3404
167 Ga0207680_10001178 3300025903 Bacteria 12345
168 Ga0207705_10062828 3300025909 Bacteria 2683
169 Ga0207684_10013909 3300025910 Bacteria 6951
170 Ga0207684_10025820 3300025910 Bacteria 5007
171 Ga0207654_10101499 3300025911 Unclassified 1773
172 Ga0207707_10023692 3300025912 Bacteria 5368
173 Ga0207707_10120174 3300025912 Unclassified 2297
174 Ga0207695_10049044 3300025913 Bacteria 4454
175 Ga0207695_10104815 3300025913 Bacteria 2816
176 Ga0207671_10128678 3300025914 Bacteria 1942
177 Ga0207660_10021601 3300025917 Unclassified 4330
178 Ga0207657_10026464 3300025919 Bacteria 5331
179 Ga0207657_10075966 3300025919 Bacteria 2835
180 Ga0207652_10008095 3300025921 Bacteria 8439
181 Ga0207652_10027017 3300025921 Bacteria 4783
182 Ga0207652_10031645 3300025921 Bacteria 4445
183 Ga0207646_10000057 3300025922 Bacteria 158121
184 Ga0207646_10013520 3300025922 Bacteria 7798
185 Ga0207646_10046875 3300025922 Bacteria 3878
186 Ga0207646_10122829 3300025922 Bacteria 2334
187 Ga0207646_10244829 3300025922 Bacteria 1620
188 Ga0207694_10001779 3300025924 Bacteria 18010
189 Ga0207694_10053519 3300025924 Bacteria 3130
190 Ga0207665_10001611 3300025939 Bacteria 15221
191 Ga0207711_10000874 3300025941 Bacteria 29100
192 Ga0207711_10063571 3300025941 Bacteria 3186
193 Ga0207689_10003426 3300025942 Bacteria 14480
194 Ga0207679_10024143 3300025945 Bacteria 4166
195 Ga0207667_10000326 3300025949 Bacteria 66227
196 Ga0207667_10003587 3300025949 Bacteria 19176
197 Ga0207667_10055904 3300025949 Bacteria 4147
198 Ga0207667_10091643 3300025949 Bacteria 3139
199 Ga0207667_10305657 3300025949 Unclassified 1625
200 Ga0207712_10047180 3300025961 Unclassified 2989
201 Ga0207658_10000882 3300025986 Bacteria 24968
202 Ga0207703_10001288 3300026035 Bacteria 23228
203 Ga0207703_10059844 3300026035 Bacteria 3112
204 Ga0207703_10067151 3300026035 Bacteria 2951
205 Ga0207639_10026841 3300026041 Bacteria 4188
206 Ga0207639_10142010 3300026041 Bacteria 2001
207 Ga0207678_10006213 3300026067 Bacteria 10614
208 Ga0207702_10001241 3300026078 Bacteria 25764
209 Ga0207702_10042785 3300026078 Unclassified 3801
210 Ga0207702_10074846 3300026078 Bacteria 2924
211 Ga0207641_10021524 3300026088 Bacteria 5299
212 Ga0207641_10097677 3300026088 Unclassified 2582
213 Ga0207648_10087355 3300026089 Bacteria 2721
214 Ga0207648_10120383 3300026089 Bacteria 2308
215 Ga0207675_100235924 3300026118 Unclassified 1766
216 Ga0207698_10100371 3300026142 Bacteria 2397
217 Ga0209588_1005074 3300027671 Bacteria 3751
218 Ga0209588_1005109 3300027671 Bacteria 3741
219 Ga0209588_1021039 3300027671 Unclassified 2046
220 Ga0209588_1034110 3300027671 Unclassified 1633
221 Ga0265354_1000015 3300028016 Bacteria 26137
222 Ga0265356_1000016 3300028017 Bacteria 27396
223 Ga0268266_10017987 3300028379 Bacteria 6026
224 Ga0268264_10002089 3300028381 Bacteria 17838
225 Ga0268264_10030086 3300028381 Bacteria 4452
226 Ga0265318_10000632 3300028577 Bacteria 24255
227 Ga0265338_10004289 3300028800 Bacteria 19356
228 Ga0265338_10007511 3300028800 Bacteria 13495
229 Ga0265765_1000128 3300030879 Bacteria 4523
230 Ga0265760_10000007 3300031090 Bacteria 117681
231 Ga0265760_10000942 3300031090 Bacteria 8395
232 Ga0265760_10007884 3300031090 Archaea 3042
233 Ga0265760_10018071 3300031090 Bacteria 2027
234 Ga0265320_10000237 3300031240 Bacteria 45268
235 Ga0265325_10001693 3300031241 Bacteria 15312
236 Ga0265325_10004809 3300031241 Bacteria 8461
237 Ga0265325_10022884 3300031241 Unclassified 3419
238 Ga0265325_10025820 3300031241 Bacteria 3187
239 Ga0265329_10000614 3300031242 Bacteria 18313
240 Ga0265340_10007588 3300031247 Bacteria 5885
241 Ga0265331_10000242 3300031250 Bacteria 65281
242 Ga0265316_10010536 3300031344 Bacteria 8418
243 Ga0265313_10001481 3300031595 Bacteria 21884
244 Ga0265342_10001694 3300031712 Bacteria 20220
245 Ga0265342_10032991 3300031712 Bacteria 3188
246 Ga0316578_10063216 3300031728 Bacteria 2183
247 Ga0373926_0005624 3300035083 Bacteria 4135
248 Ga0373926_0009682 3300035083 Bacteria 3219
249 Ga0373934_0000899 3300035086 Bacteria 10737
250 Ga0373923_0001116 3300035111 Bacteria 7399
251 Ga0373923_0057930 3300035111 Bacteria 1639
252 Ga0373941_0010701 3300035115 Bacteria 2352
253 Ga0373953_0000741 3300035117 Bacteria 9038
254 Ga0373954_0017237 3300035118 Unclassified 3241
255 Ga0373954_0029884 3300035118 Bacteria 2512
256 Ga0373956_0001815 3300035119 Bacteria 8812
257 Ga0373956_0018556 3300035119 Archaea 2946
258 Ga0373946_0012343 3300035171 Bacteria 3196
259 Ga0373955_0029245 3300035172 Unclassified 2864
260 Ga0373935_0002402 3300035692 Bacteria 10712
261 Ga0373927_0000087 3300035695 Bacteria 69531
262 Ga0373927_0008972 3300035695 Bacteria 6712
263 Ga0373933_0001359 3300035724 Bacteria 14411
264 Ga0373933_0002213 3300035724 Bacteria 11101
265 Ga0373933_0042594 3300035724 Bacteria 2684
266 Ga0373937_0000047 3300036401 Bacteria 106871
267 Ga0373937_0000506 3300036401 Bacteria 35587
268 Ga0373937_0009034 3300036401 Bacteria 8651
269 Ga0373937_0116597 3300036401 Bacteria 2487
270 Ga0373925_0001552 3300037068 Bacteria 19542
271 Ga0395905_0038051 3300037471 Bacteria 4513
272 Ga0395905_0113834 3300037471 Unclassified 2542
273 Ga0436364_0067706 3300037853 Bacteria 2631
274 Ga0436364_0273345 3300037853 Bacteria 2794207
275 Ga0436364_1096387 3300037853 Bacteria 2058
276 Ga0436364_1519924 3300037853 Unclassified 3227
277 Ga0436365_1139962 3300039437 Eukaryota 3246
278 Ga0436365_1342341 3300039437 Bacteria 8058
279 Ga0436360_0034261 3300039438 Bacteria 7937
280 Ga0436360_0109303 3300039438 Bacteria 11781
281 Ga0436361_0125620 3300039447 Bacteria 6710
282 Ga0436361_0203498 3300039447 Unclassified 1386
283 Ga0436361_0315902 3300039447 Bacteria 6640
284 Ga0436361_0481929 3300039447 Unclassified 3429
285 Ga0436361_0652505 3300039447 Bacteria 10301
286 Ga0436361_0675031 3300039447 Bacteria 71701
287 Ga0436361_0768308 3300039447 Unclassified 4237
288 Ga0436363_1142989 3300039450 Bacteria 9292
289 Ga0436362_0065260 3300039453 Bacteria 5373
290 Ga0436362_0564172 3300039453 Unclassified 2574
291 Ga0436362_1191356 3300039453 Bacteria 6994
292 Ga0436362_1287976 3300039453 Bacteria 1848
293 Ga0451577_0000107 3300042876 Bacteria 184348
294 Ga0451577_0264203 3300042876 Bacteria 1558
295 Ga0453683_0000074 3300044673 Bacteria 150735
296 Ga0453683_0085890 3300044673 Bacteria 1971
297 Ga0466966_0003487 3300044684 Bacteria 10369
298 Ga0453684_0000371 3300044712 Bacteria 184376
299 Ga0453684_0000513 3300044712 Bacteria 149882
300 Ga0453684_0036898 3300044712 Bacteria 6724
301 Ga0453684_0282527 3300044712 Unclassified 1892
302 Ga0453684_0411475 3300044712 Bacteria 1512
303 Ga0451576_0180018 3300045051 Unclassified 2207
304 Ga0466967_0001003 3300045976 Bacteria 15411
305 Ga0466967_0008980 3300045976 Bacteria 7384
306 Ga0466967_0157511 3300045976 Unclassified 2129
307 Ga0495592_0020914 3300046454 Bacteria 4978
308 Ga0495592_0032372 3300046454 Bacteria 3946
309 Ga0495592_0071267 3300046454 Bacteria 2530
310 Ga0495629_0169270 3300046459 Bacteria 1516
311 Ga0495651_0000035 3300046462 Bacteria 98834
312 Ga0495651_0003344 3300046462 Bacteria 12311
313 Ga0495651_0005136 3300046462 Bacteria 9982
314 Ga0495651_0137818 3300046462 Bacteria 1773
315 Ga0495653_0003017 3300046463 Bacteria 13495
316 Ga0495653_0003518 3300046463 Bacteria 12615
317 Ga0495580_0010057 3300046472 Bacteria 7394
318 Ga0495580_0061921 3300046472 Bacteria 2626
319 Ga0495580_0125378 3300046472 Viruses 1782
320 Ga0495582_0023200 3300046473 Bacteria 3394
321 Ga0495664_0024107 3300046477 Bacteria 3534
322 Ga0495608_0008770 3300046511 Bacteria 7074
323 Ga0495608_0043303 3300046511 Bacteria 3008
324 Ga0495618_0037274 3300046514 Bacteria 3053
325 Ga0495628_0003047 3300046516 Bacteria 15014
326 Ga0495628_0024270 3300046516 Bacteria 4965
327 Ga0495628_0055056 3300046516 Bacteria 3134
328 Ga0495630_0001335 3300046517 Bacteria 16941
329 Ga0495630_0009787 3300046517 Bacteria 6900
330 Ga0495630_0024008 3300046517 Bacteria 4508
331 Ga0495666_0048924 3300046526 Bacteria 2035
332 Ga0495652_0002457 3300046529 Bacteria 19056
333 Ga0495652_0009419 3300046529 Bacteria 8874
334 Ga0495652_0041822 3300046529 Bacteria 3954
335 Ga0495665_0000947 3300046531 Bacteria 15296
336 Ga0495640_0044756 3300046533 Bacteria 3076
337 Ga0495587_0000194 3300046536 Bacteria 44828
338 Ga0495587_0008225 3300046536 Bacteria 6717
339 Ga0495587_0011041 3300046536 Bacteria 5728
340 Ga0495587_0018549 3300046536 Bacteria 4315
341 Ga0495645_0007031 3300046543 Bacteria 7827
342 Ga0495645_0008503 3300046543 Bacteria 7168
343 Ga0495645_0029768 3300046543 Unclassified 3974
344 Ga0495645_0080993 3300046543 Bacteria 2330
345 Ga0495667_0007461 3300046559 Bacteria 7414
346 Ga0495667_0007980 3300046559 Bacteria 7180
347 Ga0495667_0012803 3300046559 Bacteria 5684
348 Ga0495635_0011309 3300046663 Bacteria 6260
349 Ga0495657_0003956 3300046675 Bacteria 11889
350 Ga0495657_0026622 3300046675 Bacteria 4093
351 Ga0495599_0011133 3300046678 Bacteria 5521
352 Ga0495623_0014380 3300046679 Bacteria 5122
353 Ga0495623_0020338 3300046679 Bacteria 4290
354 Ga0495646_0001651 3300046680 Bacteria 13320
355 Ga0495647_0009427 3300046681 Bacteria 3308
356 Ga0495613_0040088 3300046689 Bacteria 3471
357 Ga0495624_0002466 3300046690 Bacteria 14027
358 Ga0495600_0011904 3300046809 Bacteria 5434
359 Ga0495600_0057899 3300046809 Bacteria 2531
360 Ga0495604_0001277 3300047317 Bacteria 20583
361 Ga0495604_0003610 3300047317 Bacteria 12332
362 Ga0495604_0004184 3300047317 Bacteria 11445
363 Ga0495604_0034150 3300047317 Bacteria 4025
364 Ga0495674_0029309 3300047319 Bacteria 5014
365 Ga0495674_0041065 3300047319 Bacteria 4134
366 Ga0495676_0040002 3300047321 Bacteria 3875
367 Ga0495680_0002706 3300047322 Bacteria 17892
368 Ga0495680_0006770 3300047322 Bacteria 10589
369 Ga0495675_0000071 3300047444 Bacteria 70594
370 Ga0495675_0012860 3300047444 Bacteria 5274
371 Ga0495675_0014508 3300047444 Bacteria 4980
372 Ga0495675_0037099 3300047444 Bacteria 3105
373 Ga0495675_0119953 3300047444 Unclassified 1638
374 Ga0495684_0005312 3300047471 Bacteria 10031
375 Ga0495684_0010411 3300047471 Bacteria 7193
376 Ga0495684_0014855 3300047471 Bacteria 5996
377 Ga0495684_0023432 3300047471 Bacteria 4745
378 Ga0495684_0039398 3300047471 Bacteria 3622
379 Ga0495593_0011281 3300047673 Bacteria 5135
380 Ga0495602_0000158 3300048088 Bacteria 62985
381 Ga0495602_0002891 3300048088 Bacteria 17604
382 Ga0495602_0085503 3300048088 Bacteria 2635
383 Ga0495602_0109879 3300048088 Bacteria 2242
384 Ga0495614_0012105 3300048089 Bacteria 3788
385 Ga0496101_0055010 3300048904 Bacteria 2873
386 Ga0496102_0015333 3300048905 Bacteria 6674
387 Ga0496102_0032091 3300048905 Unclassified 4717
388 Ga0496104_0090058 3300048907 Bacteria 2931
389 Ga0496105_0167278 3300048908 Unclassified 1804
390 Ga0496107_0014926 3300048910 Bacteria 5439
391 Ga0496112_0007300 3300048915 Bacteria 9799
392 Ga0496112_0073091 3300048915 Bacteria 3390
393 Ga0496112_0121924 3300048915 Bacteria 2577
394 Ga0501067_0046607 3300049583 Bacteria 2406
395 Ga0501070_0149061 3300049586 Bacteria 1930
396 Ga0501073_0012947 3300049589 Bacteria 6082
397 Ga0501083_0072929 3300049744 Bacteria 2282
398 Ga0501044_0010265 3300049823 Bacteria 10172
399 nmdc:mga05p37_48396_c1 3300050507 Bacteria 5229
400 nmdc:mga0n895_239026_c1 3300050512 Bacteria 1843
401 nmdc:mga08x19_1879_c1 3300050514 Bacteria 12868
402 nmdc:mga08x19_95354_c1 3300050514 Bacteria 1968
403 Ga0495601_0105302 3300053077 Bacteria 1824
404 Ga0495612_0008004 3300053078 Bacteria 4303
405 Ga0495619_0025211 3300053085 Bacteria 3817
406 Ga0495619_0046001 3300053085 Bacteria 2868
407 Ga0501084_0011034 3300054114 Bacteria 7483
408 Ga0501082_0133047 3300060353 Bacteria 2158
409 Ga0157374_10014827
410 rootH2_10090309
411 rootL2_10083392
412 Ga0070658_10087948
413 Ga0070683_100177529
414 Ga0070690_100000146
415 Ga0068869_100001335
416 Ga0070666_10001461
417 Ga0070680_100032949
418 Ga0068868_100081560
419 Ga0070660_100034551
420 Ga0070660_100089478
421 Ga0070689_100007899
422 Ga0070661_100026420
423 Ga0070661_100165870
424 Ga0070667_100000282
425 Ga0070713_100016173
426 Ga0070711_100007795
427 Ga0070711_100141664
428 Ga0070705_100002438
429 Ga0070694_100005001
430 Ga0070708_100004620
431 Ga0070708_100028621
432 Ga0070708_100076741
433 Ga0070708_100130487
434 Ga0070708_100139633
435 Ga0070708_100160748
436 Ga0070681_10010349
437 Ga0070681_10022494
438 Ga0070681_10039628
439 Ga0070681_10056326
440 Ga0070681_10128392
441 Ga0068867_100035056
442 Ga0068867_100094967
443 Ga0070706_100011845
444 Ga0070706_100013524
445 Ga0070706_100027715
446 Ga0070706_100059935
447 Ga0070707_100000016
448 Ga0070707_100009521
449 Ga0070707_100017200
450 Ga0070707_100031879
451 Ga0070707_100119884
452 Ga0070707_100159435
453 Ga0070698_100000639
454 Ga0070698_100013121
455 Ga0070698_100025710
456 Ga0070698_100176159
457 Ga0070699_100047012
458 Ga0070699_100071943
459 Ga0070699_100075229
460 Ga0070699_100187093
461 Ga0070699_100254954
462 Ga0070679_100014705
463 Ga0070679_100014808
464 Ga0070679_100048760
465 Ga0070684_100062268
466 Ga0070697_100002259
467 Ga0070697_100004479
468 Ga0070697_100157273
469 Ga0068853_100075720
470 Ga0068853_100098091
471 Ga0068853_100112716
472 Ga0070695_100007966
473 Ga0070695_100009897
474 Ga0070695_100073652
475 Ga0070696_100032444
476 Ga0070693_100000486
477 Ga0070693_100025023
478 Ga0070665_100008925
479 Ga0068855_100000908
480 Ga0068855_100005316
481 Ga0068855_100048910
482 Ga0068855_100058367
483 Ga0068855_100074834
484 Ga0070664_100018231
485 Ga0068856_100000558
486 Ga0068856_100009138
487 Ga0068856_100155511
488 Ga0068856_100164039
489 Ga0068852_100024251
490 Ga0068852_100106863
491 Ga0068852_100185690
492 Ga0068866_10063756
493 Ga0068863_100034460
494 Ga0068863_100042672
495 Ga0068863_100114729
496 Ga0068858_100001093
497 Ga0068858_100001835
498 Ga0068858_100080617
499 Ga0068860_100003050
500 Ga0068860_100060236
501 Ga0081539_10008920
502 Ga0070716_100009627
503 Ga0097621_100003487
504 Ga0097621_100057939
505 Ga0097621_100062485
506 Ga0097621_100095553
507 Ga0068871_100000507
508 Ga0068871_100092793
509 Ga0068871_100112890
510 Ga0068871_100127835
511 Ga0068865_100123010
512 Ga0075436_100006053
513 Ga0075435_100234469
514 Ga0099794_10004379
515 Ga0099794_10015102
516 Ga0099794_10059115
517 Ga0099794_10082924
518 Ga0105240_10009151
519 Ga0105240_10067281
520 Ga0105240_10151836
521 Ga0105240_10193423
522 Ga0105247_10166048
523 Ga0114129_10048357
524 Ga0105243_10038739
525 Ga0105241_10025715
526 Ga0105241_10033500
527 Ga0105242_10035810
528 Ga0105248_10106671
529 Ga0105237_10010525
530 Ga0105237_10054791
531 Ga0105238_10000057
532 Ga0105238_10101148
533 Ga0105249_10054704
534 Ga0099796_10035614
535 Ga0105239_10019348
536 Ga0105239_10036022
537 Ga0105239_10185982
538 Ga0157373_10069379
539 Ga0157370_10039895
540 Ga0157369_10000321
541 Ga0157369_10032959
542 Ga0157369_10052058
543 Ga0157369_10119782
544 Ga0157374_10001041
545 Ga0157374_10048757
546 Ga0157374_10161642
547 Ga0157378_10000041
548 Ga0157378_10000278
549 Ga0157378_10001098
550 Ga0157378_10002788
551 Ga0157378_10027852
552 Ga0163162_10013312
553 Ga0157372_10000185
554 Ga0157372_10005271
555 Ga0157372_10080155
556 Ga0157372_10151511
557 Ga0157372_10209607
558 Ga0157372_10235003
559 Ga0163163_10214100
560 Ga0157379_10001148
561 Ga0157379_10006619
562 Ga0157379_10079145
563 Ga0157376_10005331
564 Ga0157376_10066201
565 Ga0157376_10100478
566 Ga0213872_10005881
567 Ga0213872_10012859
568 Ga0213874_10000369
569 Ga0213876_10004241
570 Ga0213875_10000001
571 Ga0224572_1002318
572 Ga0224572_1007136
573 Ga0228598_1001514
574 Ga0207653_10007482
575 Ga0207680_10001178
576 Ga0207705_10062828
577 Ga0207684_10013909
578 Ga0207684_10025820
579 Ga0207654_10101499
580 Ga0207707_10023692
581 Ga0207707_10120174
582 Ga0207695_10049044
583 Ga0207695_10104815
584 Ga0207671_10128678
585 Ga0207660_10021601
586 Ga0207657_10026464
587 Ga0207657_10075966
588 Ga0207652_10008095
589 Ga0207652_10027017
590 Ga0207652_10031645
591 Ga0207646_10000057
592 Ga0207646_10013520
593 Ga0207646_10046875
594 Ga0207646_10122829
595 Ga0207646_10244829
596 Ga0207694_10001779
597 Ga0207694_10053519
598 Ga0207665_10001611
599 Ga0207711_10000874
600 Ga0207711_10063571
601 Ga0207689_10003426
602 Ga0207679_10024143
603 Ga0207667_10000326
604 Ga0207667_10003587
605 Ga0207667_10055904
606 Ga0207667_10091643
607 Ga0207667_10305657
608 Ga0207712_10047180
609 Ga0207658_10000882
610 Ga0207703_10001288
611 Ga0207703_10059844
612 Ga0207703_10067151
613 Ga0207639_10026841
614 Ga0207639_10142010
615 Ga0207678_10006213
616 Ga0207702_10001241
617 Ga0207702_10042785
618 Ga0207702_10074846
619 Ga0207641_10021524
620 Ga0207641_10097677
621 Ga0207648_10087355
622 Ga0207648_10120383
623 Ga0207675_100235924
624 Ga0207698_10100371
625 Ga0209588_1005074
626 Ga0209588_1005109
627 Ga0209588_1021039
628 Ga0209588_1034110
629 Ga0265354_1000015
630 Ga0265356_1000016
631 Ga0268266_10017987
632 Ga0268264_10002089
633 Ga0268264_10030086
634 Ga0265318_10000632
635 Ga0265338_10004289
636 Ga0265338_10007511
637 Ga0265765_1000128
638 Ga0265760_10000007
639 Ga0265760_10000942
640 Ga0265760_10007884
641 Ga0265760_10018071
642 Ga0265320_10000237
643 Ga0265325_10001693
644 Ga0265325_10004809
645 Ga0265325_10022884
646 Ga0265325_10025820
647 Ga0265329_10000614
648 Ga0265340_10007588
649 Ga0265331_10000242
650 Ga0265316_10010536
651 Ga0265313_10001481
652 Ga0265342_10001694
653 Ga0265342_10032991
654 Ga0316578_10063216
655 Ga0373926_0005624
656 Ga0373926_0009682
657 Ga0373934_0000899
658 Ga0373923_0001116
659 Ga0373923_0057930
660 Ga0373941_0010701
661 Ga0373953_0000741
662 Ga0373954_0017237
663 Ga0373954_0029884
664 Ga0373956_0001815
665 Ga0373956_0018556
666 Ga0373946_0012343
667 Ga0373955_0029245
668 Ga0373935_0002402
669 Ga0373927_0000087
670 Ga0373927_0008972
671 Ga0373933_0001359
672 Ga0373933_0002213
673 Ga0373933_0042594
674 Ga0373937_0000047
675 Ga0373937_0000506
676 Ga0373937_0009034
677 Ga0373937_0116597
678 Ga0373925_0001552
679 Ga0395905_0038051
680 Ga0395905_0113834
681 Ga0436364_0067706
682 Ga0436364_0273345
683 Ga0436364_1096387
684 Ga0436364_1519924
685 Ga0436365_1139962
686 Ga0436365_1342341
687 Ga0436360_0034261
688 Ga0436360_0109303
689 Ga0436361_0125620
690 Ga0436361_0203498
691 Ga0436361_0315902
692 Ga0436361_0481929
693 Ga0436361_0652505
694 Ga0436361_0675031
695 Ga0436361_0768308
696 Ga0436363_1142989
697 Ga0436362_0065260
698 Ga0436362_0564172
699 Ga0436362_1191356
700 Ga0436362_1287976
701 Ga0451577_0000107
702 Ga0451577_0264203
703 Ga0453683_0000074
704 Ga0453683_0085890
705 Ga0466966_0003487
706 Ga0453684_0000371
707 Ga0453684_0000513
708 Ga0453684_0036898
709 Ga0453684_0282527
710 Ga0453684_0411475
711 Ga0451576_0180018
712 Ga0466967_0001003
713 Ga0466967_0008980
714 Ga0466967_0157511
715 Ga0495592_0020914
716 Ga0495592_0032372
717 Ga0495592_0071267
718 Ga0495629_0169270
719 Ga0495651_0000035
720 Ga0495651_0003344
721 Ga0495651_0005136
722 Ga0495651_0137818
723 Ga0495653_0003017
724 Ga0495653_0003518
725 Ga0495580_0010057
726 Ga0495580_0061921
727 Ga0495580_0125378
728 Ga0495582_0023200
729 Ga0495664_0024107
730 Ga0495608_0008770
731 Ga0495608_0043303
732 Ga0495618_0037274
733 Ga0495628_0003047
734 Ga0495628_0024270
735 Ga0495628_0055056
736 Ga0495630_0001335
737 Ga0495630_0009787
738 Ga0495630_0024008
739 Ga0495666_0048924
740 Ga0495652_0002457
741 Ga0495652_0009419
742 Ga0495652_0041822
743 Ga0495665_0000947
744 Ga0495640_0044756
745 Ga0495587_0000194
746 Ga0495587_0008225
747 Ga0495587_0011041
748 Ga0495587_0018549
749 Ga0495645_0007031
750 Ga0495645_0008503
751 Ga0495645_0029768
752 Ga0495645_0080993
753 Ga0495667_0007461
754 Ga0495667_0007980
755 Ga0495667_0012803
756 Ga0495635_0011309
757 Ga0495657_0003956
758 Ga0495657_0026622
759 Ga0495599_0011133
760 Ga0495623_0014380
761 Ga0495623_0020338
762 Ga0495646_0001651
763 Ga0495647_0009427
764 Ga0495613_0040088
765 Ga0495624_0002466
766 Ga0495600_0011904
767 Ga0495600_0057899
768 Ga0495604_0001277
769 Ga0495604_0003610
770 Ga0495604_0004184
771 Ga0495604_0034150
772 Ga0495674_0029309
773 Ga0495674_0041065
774 Ga0495676_0040002
775 Ga0495680_0002706
776 Ga0495680_0006770
777 Ga0495675_0000071
778 Ga0495675_0012860
779 Ga0495675_0014508
780 Ga0495675_0037099
781 Ga0495675_0119953
782 Ga0495684_0005312
783 Ga0495684_0010411
784 Ga0495684_0014855
785 Ga0495684_0023432
786 Ga0495684_0039398
787 Ga0495593_0011281
788 Ga0495602_0000158
789 Ga0495602_0002891
790 Ga0495602_0085503
791 Ga0495602_0109879
792 Ga0495614_0012105
793 Ga0496101_0055010
794 Ga0496102_0015333
795 Ga0496102_0032091
796 Ga0496104_0090058
797 Ga0496105_0167278
798 Ga0496107_0014926
799 Ga0496112_0007300
800 Ga0496112_0073091
801 Ga0496112_0121924
802 Ga0501067_0046607
803 Ga0501070_0149061
804 Ga0501073_0012947
805 Ga0501083_0072929
806 Ga0501044_0010265
807 nmdc:mga05p37_48396_c1
808 nmdc:mga0n895_239026_c1
809 nmdc:mga08x19_1879_c1
810 nmdc:mga08x19_95354_c1
811 Ga0495601_0105302
812 Ga0495612_0008004
813 Ga0495619_0025211
814 Ga0495619_0046001
815 Ga0501084_0011034
816 Ga0501082_0133047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

89

441

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.9232 16 418
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.9169 16 418
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.8723 21 412
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.8697 21 418
6d9w-assembly1.cif.gz_A crystal structure of deinococcus radiodurans mnth, an nramp-family transition metal transporter, in the inward-open apo state 0.8599 21 421
ID Description Score Start End Superfamily
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8668 37 391 1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8622 37 391 1.20.1740.10
af_P0A769_38_384_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8571 37 391 1.20.1740.10
af_Q2QN30_93_531_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8559 23 419 1.20.1740.10
af_P0A769_38_384_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8526 37 391 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2V8UHT2-F1-model_v4 Mn transporter 0.9782 35 418 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A3N6BCL1-F1-model_v4 Divalent metal cation transporter 0.9724 29 419 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A7C5P6T7-F1-model_v4 Divalent metal cation transporter 0.9716 157 419 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A1F2T6N9-F1-model_v4 Mn transporter 0.9708 97 416 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A2V8UHT2-F1-model_v4 Mn transporter 0.9706 35 418 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755

Map