F436700

General Info

Members Datasets Scaffolds Average Seq Length
408 230 816 206

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10380144|Ga0105240_103801442
Length 222
Sequence MDASIRSRLSRSDRMEQTLGVAHGLFAERGYAEVTMDEIAAEVGVTKPLLYNYFGNKERLYIACMEQAGDSLIKTVGAAIAETDSPGDALGAGVRAFFGFLDSDRAAWAVLFDETLPNSGEVAEKVASYRGQIVALVSASLIAQIPEGSRDAYRVEIEALSAALLGAAEELARWWLRTEAISAGEAAELLISTVEPGIRARSQAAGSKSPTSPKHGKGTPKA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
226 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 10.78
Rhizosphere 83.09
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10380144 3300009093 Bacteria 1595
2 JGI24740J21852_10004409 3300001979 Bacteria 6048
3 JGI25406J46586_10073887 3300003203 Bacteria 1062
4 rootH1_10173423 3300003316 Bacteria 1773
5 JGI25404J52841_10046152 3300003659 Bacteria 918
6 Ga0070658_10096516 3300005327 Bacteria 2440
7 Ga0070658_10540661 3300005327 Bacteria 1008
8 Ga0070683_100002592 3300005329 Bacteria 14452
9 Ga0070683_100013452 3300005329 Bacteria 7136
10 Ga0070683_100018313 3300005329 Bacteria 6200
11 Ga0070683_100103457 3300005329 Bacteria 2683
12 Ga0070683_100446892 3300005329 Bacteria 1233
13 Ga0070683_101337018 3300005329 Bacteria 689
14 Ga0070670_100071744 3300005331 Bacteria 2974
15 Ga0070670_100384610 3300005331 Bacteria 1237
16 Ga0070677_10000620 3300005333 Bacteria 11947
17 Ga0070666_10126424 3300005335 Bacteria 1774
18 Ga0070682_100000013 3300005337 Bacteria 254641
19 Ga0070682_100000117 3300005337 Bacteria 69662
20 Ga0070682_100021208 3300005337 Bacteria 3830
21 Ga0068868_100007532 3300005338 Bacteria 7754
22 Ga0070689_100189059 3300005340 Bacteria 1676
23 Ga0070661_100001375 3300005344 Bacteria 16996
24 Ga0070692_10356792 3300005345 Bacteria 910
25 Ga0070668_100001695 3300005347 Bacteria 15984
26 Ga0070675_100000111 3300005354 Bacteria 47699
27 Ga0070688_100003353 3300005365 Bacteria 8214
28 Ga0070688_100031251 3300005365 Bacteria 3202
29 Ga0070659_100064556 3300005366 Bacteria 2898
30 Ga0070667_100005090 3300005367 Bacteria 11004
31 Ga0070667_100019394 3300005367 Bacteria 5642
32 Ga0070714_100261732 3300005435 Bacteria 1602
33 Ga0070713_100000390 3300005436 Bacteria 28149
34 Ga0070701_10475085 3300005438 Bacteria 807
35 Ga0070663_100000728 3300005455 Bacteria 17736
36 Ga0070678_100463999 3300005456 Bacteria 1112
37 Ga0070681_10010667 3300005458 Bacteria 9081
38 Ga0070681_10121889 3300005458 Bacteria 2541
39 Ga0070685_10004176 3300005466 Bacteria 7284
40 Ga0070685_10014878 3300005466 Bacteria 4127
41 Ga0070685_10313412 3300005466 Bacteria 1061
42 Ga0070679_100000068 3300005530 Bacteria 77184
43 Ga0070679_100007698 3300005530 Bacteria 10085
44 Ga0070684_100077277 3300005535 Bacteria 2940
45 Ga0070684_100397266 3300005535 Bacteria 1271
46 Ga0070684_100425227 3300005535 Bacteria 1226
47 Ga0068853_100082050 3300005539 Bacteria 2824
48 Ga0068853_100242107 3300005539 Bacteria 1654
49 Ga0068853_100261343 3300005539 Bacteria 1591
50 Ga0070672_100000015 3300005543 Bacteria 72591
51 Ga0070665_100000106 3300005548 Bacteria 157315
52 Ga0070665_100165552 3300005548 Bacteria 2213
53 Ga0070665_100304669 3300005548 Bacteria 1596
54 Ga0070665_100843114 3300005548 Bacteria 930
55 Ga0070704_100071437 3300005549 Bacteria 2522
56 Ga0070704_100478625 3300005549 Bacteria 1077
57 Ga0070664_100183538 3300005564 Bacteria 1861
58 Ga0070664_100618987 3300005564 Bacteria 1005
59 Ga0068854_100000183 3300005578 Bacteria 42525
60 Ga0068854_100176779 3300005578 Bacteria 1665
61 Ga0068856_100022587 3300005614 Bacteria 6116
62 Ga0068856_100051020 3300005614 Bacteria 4079
63 Ga0068856_100577977 3300005614 Bacteria 1145
64 Ga0068852_100000093 3300005616 Bacteria 60834
65 Ga0068866_10162368 3300005718 Bacteria 1304
66 Ga0068861_100303863 3300005719 Bacteria 1383
67 Ga0068861_100467985 3300005719 Bacteria 1133
68 Ga0068851_10010103 3300005834 Bacteria 4397
69 Ga0068851_10028087 3300005834 Bacteria 2777
70 Ga0068863_101355275 3300005841 Bacteria 719
71 Ga0068858_100000009 3300005842 Bacteria 237748
72 Ga0068858_100232284 3300005842 Bacteria 1749
73 Ga0068862_100001210 3300005844 Bacteria 24342
74 Ga0081455_10001330 3300005937 Bacteria 30557
75 Ga0081455_10004444 3300005937 Bacteria 15726
76 Ga0081540_1000049 3300005983 Bacteria 127322
77 Ga0081539_10002609 3300005985 Bacteria 24708
78 Ga0070712_100151179 3300006175 Bacteria 1783
79 Ga0068871_100050353 3300006358 Bacteria 3369
80 Ga0068871_100194793 3300006358 Bacteria 1747
81 Ga0068865_100001085 3300006881 Bacteria 15698
82 Ga0111539_11023488 3300009094 Bacteria 960
83 Ga0105245_10001150 3300009098 Bacteria 23924
84 Ga0105245_10001831 3300009098 Bacteria 19354
85 Ga0105245_10001895 3300009098 Bacteria 18997
86 Ga0105245_10137771 3300009098 Bacteria 2295
87 Ga0105247_10000242 3300009101 Bacteria 51204
88 Ga0105243_10093382 3300009148 Bacteria 2483
89 Ga0105242_10002368 3300009176 Bacteria 14878
90 Ga0105242_10002871 3300009176 Bacteria 13495
91 Ga0105248_10000008 3300009177 Bacteria 403910
92 Ga0105237_10688208 3300009545 Bacteria 1029
93 Ga0105238_10000011 3300009551 Bacteria 261080
94 Ga0105249_10000203 3300009553 Bacteria 67783
95 Ga0105249_10032166 3300009553 Bacteria 4745
96 Ga0105239_10633834 3300010375 Bacteria 1220
97 Ga0157371_10035878 3300013102 Bacteria 3552
98 Ga0157370_10042255 3300013104 Bacteria 4394
99 Ga0157369_10000110 3300013105 Bacteria 115514
100 Ga0157374_10022748 3300013296 Bacteria 5596
101 Ga0157374_10042381 3300013296 Bacteria 4199
102 Ga0157374_10605036 3300013296 Bacteria 1106
103 Ga0157378_10044147 3300013297 Bacteria 3957
104 Ga0157378_10307563 3300013297 Bacteria 1536
105 Ga0157372_10001384 3300013307 Bacteria 26176
106 Ga0157375_10023613 3300013308 Bacteria 5676
107 Ga0157375_10232170 3300013308 Bacteria 2004
108 Ga0157375_10238320 3300013308 Bacteria 1979
109 Ga0157375_10401938 3300013308 Bacteria 1536
110 Ga0157375_10787948 3300013308 Bacteria 1100
111 Ga0163163_10166757 3300014325 Bacteria 2249
112 Ga0157380_10012178 3300014326 Bacteria 6231
113 Ga0157377_10237427 3300014745 Bacteria 1175
114 Ga0157379_10015187 3300014968 Bacteria 6754
115 Ga0157379_10068764 3300014968 Bacteria 3166
116 Ga0157376_10015687 3300014969 Bacteria 5730
117 Ga0157376_10214635 3300014969 Bacteria 1778
118 Ga0157376_10756672 3300014969 Bacteria 981
119 Ga0163161_10221621 3300017792 Bacteria 1465
120 Ga0207656_10005438 3300025321 Bacteria 4502
121 Ga0207656_10014349 3300025321 Bacteria 3050
122 Ga0207682_10001227 3300025893 Bacteria 11851
123 Ga0207642_10038121 3300025899 Bacteria 2077
124 Ga0207710_10000531 3300025900 Bacteria 23383
125 Ga0207680_10016106 3300025903 Bacteria 3917
126 Ga0207680_10044688 3300025903 Bacteria 2607
127 Ga0207680_10068710 3300025903 Bacteria 2187
128 Ga0207705_10221920 3300025909 Bacteria 1436
129 Ga0207707_10016440 3300025912 Bacteria 6453
130 Ga0207695_10236449 3300025913 Bacteria 1729
131 Ga0207693_10006065 3300025915 Bacteria 10009
132 Ga0207660_10091942 3300025917 Bacteria 2251
133 Ga0207649_10000009 3300025920 Bacteria 295544
134 Ga0207652_10000044 3300025921 Bacteria 127779
135 Ga0207652_10000378 3300025921 Bacteria 46237
136 Ga0207694_10000004 3300025924 Bacteria 967075
137 Ga0207650_10085403 3300025925 Bacteria 2401
138 Ga0207659_10000010 3300025926 Bacteria 286639
139 Ga0207687_10000007 3300025927 Bacteria 604185
140 Ga0207687_10000013 3300025927 Bacteria 299826
141 Ga0207687_10001023 3300025927 Bacteria 18981
142 Ga0207687_10010273 3300025927 Bacteria 6116
143 Ga0207687_10493988 3300025927 Bacteria 1021
144 Ga0207700_10000027 3300025928 Bacteria 137708
145 Ga0207700_10030365 3300025928 Bacteria 3827
146 Ga0207690_10046888 3300025932 Bacteria 2865
147 Ga0207686_10000048 3300025934 Bacteria 115595
148 Ga0207686_10000468 3300025934 Bacteria 26729
149 Ga0207709_10007242 3300025935 Bacteria 6188
150 Ga0207670_10028551 3300025936 Bacteria 3544
151 Ga0207704_10000157 3300025938 Bacteria 36439
152 Ga0207691_10000044 3300025940 Bacteria 100027
153 Ga0207711_10000006 3300025941 Bacteria 792692
154 Ga0207661_10001262 3300025944 Bacteria 16919
155 Ga0207661_10003433 3300025944 Bacteria 10996
156 Ga0207661_10139465 3300025944 Bacteria 2085
157 Ga0207661_10224160 3300025944 Bacteria 1662
158 Ga0207661_10437744 3300025944 Bacteria 1189
159 Ga0207679_10100465 3300025945 Bacteria 2261
160 Ga0207679_10344103 3300025945 Bacteria 1298
161 Ga0207667_10233850 3300025949 Bacteria 1881
162 Ga0207712_10000007 3300025961 Bacteria 539589
163 Ga0207712_10023834 3300025961 Bacteria 4044
164 Ga0207668_10002674 3300025972 Bacteria 10429
165 Ga0207640_10000200 3300025981 Bacteria 42738
166 Ga0207640_10025065 3300025981 Bacteria 3606
167 Ga0207658_10001150 3300025986 Bacteria 21194
168 Ga0207658_10018315 3300025986 Bacteria 4835
169 Ga0207658_10499787 3300025986 Bacteria 1083
170 Ga0207677_10000525 3300026023 Bacteria 24518
171 Ga0207703_10000023 3300026035 Bacteria 222018
172 Ga0207703_10214216 3300026035 Bacteria 1719
173 Ga0207639_10071693 3300026041 Bacteria 2711
174 Ga0207678_10017704 3300026067 Bacteria 6257
175 Ga0207678_10172596 3300026067 Bacteria 1846
176 Ga0207702_10000060 3300026078 Bacteria 125473
177 Ga0207702_10659088 3300026078 Bacteria 1030
178 Ga0207674_10463031 3300026116 Bacteria 1225
179 Ga0207675_100109012 3300026118 Bacteria 2612
180 Ga0207683_10415991 3300026121 Bacteria 1238
181 Ga0207698_10000440 3300026142 Bacteria 23916
182 Ga0268266_10000047 3300028379 Bacteria 310996
183 Ga0268266_10000527 3300028379 Bacteria 53367
184 Ga0268266_10039181 3300028379 Bacteria 4035
185 Ga0268265_10305825 3300028380 Bacteria 1433
186 Ga0268264_10302342 3300028381 Bacteria 1506
187 Ga0373955_0091195 3300035172 Bacteria 1737
188 Ga0373933_0246565 3300035724 Bacteria 1150
189 Ga0373937_0009742 3300036401 Bacteria 8375
190 Ga0373937_0020559 3300036401 Bacteria 5918
191 Ga0373937_0061433 3300036401 Bacteria 3454
192 Ga0316582_0105479 3300036647 Bacteria 1871
193 Ga0451853_0613006 3300041512 Bacteria 650
194 Ga0451853_1462749 3300041512 Bacteria 2519
195 Ga0466963_0000001 3300044694 Bacteria 110556
196 Ga0466963_0016978 3300044694 Bacteria 4535
197 Ga0466957_0009193 3300044842 Bacteria 5638
198 Ga0466958_0288123 3300045836 Bacteria 1053
199 Ga0466967_0000009 3300045976 Bacteria 122610
200 Ga0466967_0077197 3300045976 Bacteria 2998
201 Ga0466967_0490669 3300045976 Bacteria 1204
202 Ga0466967_0997312 3300045976 Bacteria 834
203 Ga0495592_0065649 3300046454 Bacteria 2656
204 Ga0495592_0139474 3300046454 Bacteria 1688
205 Ga0495603_0013816 3300046455 Bacteria 4887
206 Ga0495629_0002683 3300046459 Bacteria 13624
207 Ga0495629_0011125 3300046459 Bacteria 6537
208 Ga0495629_0037535 3300046459 Bacteria 3415
209 Ga0495629_0194326 3300046459 Bacteria 1404
210 Ga0495629_0226260 3300046459 Bacteria 1290
211 Ga0495638_0056479 3300046460 Bacteria 2436
212 Ga0495641_0000874 3300046461 Bacteria 25824
213 Ga0495641_0020628 3300046461 Bacteria 3336
214 Ga0495641_0053103 3300046461 Bacteria 1845
215 Ga0495653_0221193 3300046463 Bacteria 1273
216 Ga0495662_0012662 3300046476 Bacteria 4113
217 Ga0495664_0111071 3300046477 Bacteria 1655
218 Ga0495594_0000003 3300046499 Bacteria 199267
219 Ga0495608_0000068 3300046511 Bacteria 79694
220 Ga0495608_0041954 3300046511 Bacteria 3060
221 Ga0495618_0153623 3300046514 Bacteria 1470
222 Ga0495620_0001371 3300046515 Bacteria 14718
223 Ga0495628_0000190 3300046516 Bacteria 53586
224 Ga0495628_0156773 3300046516 Bacteria 1731
225 Ga0495628_0457174 3300046516 Bacteria 927
226 Ga0495637_0080796 3300046520 Bacteria 1296
227 Ga0495663_0013132 3300046525 Bacteria 2315
228 Ga0495652_0000546 3300046529 Bacteria 44003
229 Ga0495652_0004685 3300046529 Bacteria 13047
230 Ga0495640_0050295 3300046533 Bacteria 2872
231 Ga0495586_0023070 3300046535 Bacteria 3322
232 Ga0495645_0019514 3300046543 Bacteria 4880
233 Ga0495645_0038728 3300046543 Bacteria 3477
234 Ga0495645_0270703 3300046543 Bacteria 1121
235 Ga0495622_0000133 3300046557 Bacteria 63562
236 Ga0495667_0000018 3300046559 Bacteria 188610
237 Ga0495667_0540567 3300046559 Bacteria 728
238 Ga0495634_0006771 3300046642 Bacteria 8681
239 Ga0495634_0007615 3300046642 Bacteria 8114
240 Ga0495634_0241923 3300046642 Bacteria 1107
241 Ga0495625_0000587 3300046660 Bacteria 52838
242 Ga0495588_0000165 3300046674 Bacteria 85841
243 Ga0495657_0000004 3300046675 Bacteria 266465
244 Ga0495599_0010887 3300046678 Bacteria 5575
245 Ga0495599_0393666 3300046678 Bacteria 826
246 Ga0495623_0239702 3300046679 Bacteria 1025
247 Ga0495647_0000018 3300046681 Bacteria 81701
248 Ga0495647_0000904 3300046681 Bacteria 8893
249 Ga0495669_0000033 3300046684 Bacteria 98629
250 Ga0495669_0007701 3300046684 Bacteria 4520
251 Ga0495613_0000179 3300046689 Bacteria 62109
252 Ga0495613_0105952 3300046689 Bacteria 2029
253 Ga0495624_0000008 3300046690 Bacteria 145035
254 Ga0495624_0000073 3300046690 Bacteria 65582
255 Ga0495624_0144317 3300046690 Bacteria 1457
256 Ga0495671_0173765 3300046692 Bacteria 1047
257 Ga0495649_0000751 3300046694 Bacteria 26125
258 Ga0495600_0259456 3300046809 Bacteria 1104
259 Ga0495604_0000357 3300047317 Bacteria 40931
260 Ga0495604_0041359 3300047317 Bacteria 3615
261 Ga0495674_0000607 3300047319 Bacteria 33608
262 Ga0495674_0217851 3300047319 Bacteria 1579
263 Ga0495674_0573004 3300047319 Unclassified 897
264 Ga0495672_0181230 3300047320 Bacteria 1067
265 Ga0495676_0025439 3300047321 Bacteria 5110
266 Ga0495676_0038803 3300047321 Bacteria 3952
267 Ga0495676_0063988 3300047321 Bacteria 2864
268 Ga0495676_0684100 3300047321 Bacteria 664
269 Ga0495680_0000496 3300047322 Bacteria 44440
270 Ga0495680_0001969 3300047322 Bacteria 21587
271 Ga0495680_0015856 3300047322 Bacteria 6486
272 Ga0495675_0000175 3300047444 Bacteria 46609
273 Ga0495686_0164077 3300047472 Bacteria 1296
274 Ga0495602_0002588 3300048088 Bacteria 18471
275 Ga0495602_0005883 3300048088 Bacteria 12880
276 Ga0495602_0362410 3300048088 Bacteria 1043
277 Ga0495602_0492318 3300048088 Bacteria 858
278 Ga0495602_0562651 3300048088 Bacteria 789
279 Ga0496100_0000002 3300048903 Bacteria 489057
280 Ga0496100_0000018 3300048903 Bacteria 162451
281 Ga0496101_0000001 3300048904 Bacteria 489057
282 Ga0496101_0000062 3300048904 Bacteria 126595
283 Ga0496102_0000039 3300048905 Bacteria 198306
284 Ga0496102_0467574 3300048905 Bacteria 1182
285 Ga0496102_0836538 3300048905 Bacteria 843
286 Ga0496103_0000008 3300048906 Bacteria 340474
287 Ga0496103_0008690 3300048906 Bacteria 6029
288 Ga0496104_0000004 3300048907 Bacteria 641830
289 Ga0496104_0000009 3300048907 Bacteria 488055
290 Ga0496104_0118559 3300048907 Bacteria 2541
291 Ga0496104_0125040 3300048907 Bacteria 2469
292 Ga0496105_0000001 3300048908 Bacteria 1328178
293 Ga0496105_0000007 3300048908 Bacteria 339658
294 Ga0496105_0043598 3300048908 Bacteria 3700
295 Ga0496105_0169304 3300048908 Bacteria 1791
296 Ga0496106_0000061 3300048909 Bacteria 86524
297 Ga0496106_0000122 3300048909 Bacteria 59816
298 Ga0496106_0121050 3300048909 Bacteria 2046
299 Ga0496107_0000006 3300048910 Bacteria 258746
300 Ga0496107_0000013 3300048910 Bacteria 178284
301 Ga0496107_0049127 3300048910 Bacteria 3040
302 Ga0496108_0000001 3300048911 Bacteria 919044
303 Ga0496108_0000062 3300048911 Bacteria 122391
304 Ga0496108_0033537 3300048911 Bacteria 4265
305 Ga0496109_0000003 3300048912 Bacteria 420862
306 Ga0496109_0000121 3300048912 Bacteria 81487
307 Ga0496109_0000129 3300048912 Bacteria 77469
308 Ga0496109_0290618 3300048912 Bacteria 1541
309 Ga0496109_0371416 3300048912 Bacteria 1351
310 Ga0496110_0000089 3300048913 Bacteria 48723
311 Ga0496110_0069667 3300048913 Bacteria 3115
312 Ga0496110_0584238 3300048913 Bacteria 1014
313 Ga0496111_0003847 3300048914 Bacteria 9377
314 Ga0496111_0306719 3300048914 Bacteria 1177
315 Ga0496112_0001770 3300048915 Bacteria 16950
316 Ga0496112_0241253 3300048915 Bacteria 1760
317 Ga0496113_0000628 3300048916 Bacteria 17756
318 Ga0496113_0491829 3300048916 Bacteria 985
319 Ga0496114_0000014 3300048917 Bacteria 297902
320 Ga0496114_0002826 3300048917 Bacteria 13311
321 Ga0496115_0000003 3300048918 Bacteria 354994
322 Ga0496115_0004217 3300048918 Bacteria 10391
323 Ga0496116_0001565 3300048919 Bacteria 25265
324 Ga0496117_0042198 3300048920 Bacteria 3331
325 Ga0496118_0000818 3300048921 Bacteria 49518
326 Ga0496118_0292857 3300048921 Bacteria 898
327 Ga0496118_0316574 3300048921 Bacteria 849
328 Ga0496119_0005786 3300048922 Bacteria 11703
329 Ga0496119_0013028 3300048922 Bacteria 6674
330 Ga0496119_0025637 3300048922 Bacteria 4112
331 Ga0496120_0005134 3300048923 Bacteria 10578
332 Ga0496121_0006714 3300048924 Bacteria 14134
333 Ga0496121_0044624 3300048924 Bacteria 3821
334 Ga0496121_0064471 3300048924 Bacteria 2987
335 Ga0496124_0116716 3300048927 Bacteria 2139
336 Ga0496124_0264146 3300048927 Bacteria 1265
337 Ga0496125_0052796 3300048928 Bacteria 3340
338 Ga0496125_0071031 3300048928 Bacteria 2722
339 Ga0496126_0052939 3300048929 Bacteria 3685
340 Ga0496126_0603356 3300048929 Bacteria 865
341 Ga0501031_0006434 3300049568 Bacteria 7657
342 Ga0501031_0352488 3300049568 Bacteria 953
343 Ga0501031_0502443 3300049568 Bacteria 782
344 Ga0501032_0028840 3300049569 Bacteria 3811
345 Ga0501032_0639080 3300049569 Bacteria 676
346 Ga0501033_0003865 3300049570 Bacteria 12176
347 Ga0501034_0030701 3300049571 Bacteria 5461
348 Ga0501034_0036729 3300049571 Bacteria 4962
349 Ga0501034_0141454 3300049571 Bacteria 2385
350 Ga0501036_0003053 3300049572 Bacteria 13344
351 Ga0501036_1334244 3300049572 Bacteria 582
352 Ga0501037_0525217 3300049573 Bacteria 801
353 Ga0501038_0006019 3300049574 Bacteria 11225
354 Ga0501039_0043596 3300049575 Bacteria 3465
355 Ga0501040_0069912 3300049576 Bacteria 2422
356 Ga0501042_0382225 3300049578 Bacteria 1019
357 Ga0501043_0005761 3300049579 Bacteria 9981
358 Ga0501043_0024076 3300049579 Bacteria 4778
359 Ga0501046_0004837 3300049580 Bacteria 12135
360 Ga0501047_0003503 3300049581 Bacteria 14828
361 Ga0501047_0671950 3300049581 Bacteria 854
362 Ga0501048_0002374 3300049582 Bacteria 14372
363 Ga0501069_0014365 3300049585 Bacteria 4232
364 Ga0501070_0000494 3300049586 Bacteria 35842
365 Ga0501070_0155952 3300049586 Bacteria 1882
366 Ga0501070_0316352 3300049586 Bacteria 1270
367 Ga0501070_0374296 3300049586 Unclassified 1154
368 Ga0501071_0049046 3300049587 Bacteria 3038
369 Ga0501072_0090134 3300049588 Bacteria 2434
370 Ga0501073_0271337 3300049589 Bacteria 1170
371 Ga0501073_0355089 3300049589 Bacteria 1012
372 Ga0501074_0155227 3300049590 Bacteria 1635
373 Ga0501076_0038857 3300049592 Bacteria 3736
374 Ga0501079_0305131 3300049741 Bacteria 1245
375 Ga0501079_0338000 3300049741 Bacteria 1179
376 Ga0501083_0025710 3300049744 Bacteria 4075
377 Ga0501083_0071662 3300049744 Bacteria 2304
378 Ga0501083_0082878 3300049744 Bacteria 2124
379 Ga0501035_0000718 3300049822 Bacteria 35799
380 Ga0501044_0012374 3300049823 Bacteria 9236
381 Ga0501044_0503970 3300049823 Bacteria 1111
382 Ga0501045_0047627 3300049824 Bacteria 3123
383 Ga0501045_0286638 3300049824 Bacteria 1226
384 nmdc:mga08y16_1018643_c1 3300050511 Bacteria 807
385 Ga0495601_0000013 3300053077 Bacteria 226476
386 Ga0495601_0037632 3300053077 Bacteria 3025
387 Ga0495601_0044552 3300053077 Bacteria 2789
388 Ga0495601_0057341 3300053077 Bacteria 2468
389 Ga0495612_0000339 3300053078 Bacteria 18899
390 Ga0495612_0001051 3300053078 Bacteria 11297
391 Ga0495612_0009367 3300053078 Bacteria 3977
392 Ga0495655_0000001 3300053083 Bacteria 419518
393 Ga0495595_0000003 3300053084 Bacteria 266465
394 Ga0495595_0037269 3300053084 Bacteria 2210
395 Ga0495595_0217391 3300053084 Bacteria 953
396 Ga0495619_0000031 3300053085 Bacteria 145508
397 Ga0495619_0000257 3300053085 Bacteria 38653
398 Ga0495619_0001230 3300053085 Bacteria 16755
399 Ga0495619_0022451 3300053085 Bacteria 4039
400 Ga0495619_0226311 3300053085 Bacteria 1296
401 Ga0495619_0414871 3300053085 Bacteria 929
402 Ga0500566_0003364 3300053094 Bacteria 9549
403 Ga0500614_138149 3300053123 Bacteria 727
404 Ga0500628_000010 3300053129 Bacteria 122210
405 Ga0500568_0196789 3300053139 Bacteria 739
406 Ga0501084_0268206 3300054114 Bacteria 1441
407 Ga0501082_0054480 3300060353 Bacteria 3447
408 Ga0530510_0316363 3300061734 Bacteria 1170
409 Ga0105240_10380144
410 JGI24740J21852_10004409
411 JGI25406J46586_10073887
412 rootH1_10173423
413 JGI25404J52841_10046152
414 Ga0070658_10096516
415 Ga0070658_10540661
416 Ga0070683_100002592
417 Ga0070683_100013452
418 Ga0070683_100018313
419 Ga0070683_100103457
420 Ga0070683_100446892
421 Ga0070683_101337018
422 Ga0070670_100071744
423 Ga0070670_100384610
424 Ga0070677_10000620
425 Ga0070666_10126424
426 Ga0070682_100000013
427 Ga0070682_100000117
428 Ga0070682_100021208
429 Ga0068868_100007532
430 Ga0070689_100189059
431 Ga0070661_100001375
432 Ga0070692_10356792
433 Ga0070668_100001695
434 Ga0070675_100000111
435 Ga0070688_100003353
436 Ga0070688_100031251
437 Ga0070659_100064556
438 Ga0070667_100005090
439 Ga0070667_100019394
440 Ga0070714_100261732
441 Ga0070713_100000390
442 Ga0070701_10475085
443 Ga0070663_100000728
444 Ga0070678_100463999
445 Ga0070681_10010667
446 Ga0070681_10121889
447 Ga0070685_10004176
448 Ga0070685_10014878
449 Ga0070685_10313412
450 Ga0070679_100000068
451 Ga0070679_100007698
452 Ga0070684_100077277
453 Ga0070684_100397266
454 Ga0070684_100425227
455 Ga0068853_100082050
456 Ga0068853_100242107
457 Ga0068853_100261343
458 Ga0070672_100000015
459 Ga0070665_100000106
460 Ga0070665_100165552
461 Ga0070665_100304669
462 Ga0070665_100843114
463 Ga0070704_100071437
464 Ga0070704_100478625
465 Ga0070664_100183538
466 Ga0070664_100618987
467 Ga0068854_100000183
468 Ga0068854_100176779
469 Ga0068856_100022587
470 Ga0068856_100051020
471 Ga0068856_100577977
472 Ga0068852_100000093
473 Ga0068866_10162368
474 Ga0068861_100303863
475 Ga0068861_100467985
476 Ga0068851_10010103
477 Ga0068851_10028087
478 Ga0068863_101355275
479 Ga0068858_100000009
480 Ga0068858_100232284
481 Ga0068862_100001210
482 Ga0081455_10001330
483 Ga0081455_10004444
484 Ga0081540_1000049
485 Ga0081539_10002609
486 Ga0070712_100151179
487 Ga0068871_100050353
488 Ga0068871_100194793
489 Ga0068865_100001085
490 Ga0111539_11023488
491 Ga0105245_10001150
492 Ga0105245_10001831
493 Ga0105245_10001895
494 Ga0105245_10137771
495 Ga0105247_10000242
496 Ga0105243_10093382
497 Ga0105242_10002368
498 Ga0105242_10002871
499 Ga0105248_10000008
500 Ga0105237_10688208
501 Ga0105238_10000011
502 Ga0105249_10000203
503 Ga0105249_10032166
504 Ga0105239_10633834
505 Ga0157371_10035878
506 Ga0157370_10042255
507 Ga0157369_10000110
508 Ga0157374_10022748
509 Ga0157374_10042381
510 Ga0157374_10605036
511 Ga0157378_10044147
512 Ga0157378_10307563
513 Ga0157372_10001384
514 Ga0157375_10023613
515 Ga0157375_10232170
516 Ga0157375_10238320
517 Ga0157375_10401938
518 Ga0157375_10787948
519 Ga0163163_10166757
520 Ga0157380_10012178
521 Ga0157377_10237427
522 Ga0157379_10015187
523 Ga0157379_10068764
524 Ga0157376_10015687
525 Ga0157376_10214635
526 Ga0157376_10756672
527 Ga0163161_10221621
528 Ga0207656_10005438
529 Ga0207656_10014349
530 Ga0207682_10001227
531 Ga0207642_10038121
532 Ga0207710_10000531
533 Ga0207680_10016106
534 Ga0207680_10044688
535 Ga0207680_10068710
536 Ga0207705_10221920
537 Ga0207707_10016440
538 Ga0207695_10236449
539 Ga0207693_10006065
540 Ga0207660_10091942
541 Ga0207649_10000009
542 Ga0207652_10000044
543 Ga0207652_10000378
544 Ga0207694_10000004
545 Ga0207650_10085403
546 Ga0207659_10000010
547 Ga0207687_10000007
548 Ga0207687_10000013
549 Ga0207687_10001023
550 Ga0207687_10010273
551 Ga0207687_10493988
552 Ga0207700_10000027
553 Ga0207700_10030365
554 Ga0207690_10046888
555 Ga0207686_10000048
556 Ga0207686_10000468
557 Ga0207709_10007242
558 Ga0207670_10028551
559 Ga0207704_10000157
560 Ga0207691_10000044
561 Ga0207711_10000006
562 Ga0207661_10001262
563 Ga0207661_10003433
564 Ga0207661_10139465
565 Ga0207661_10224160
566 Ga0207661_10437744
567 Ga0207679_10100465
568 Ga0207679_10344103
569 Ga0207667_10233850
570 Ga0207712_10000007
571 Ga0207712_10023834
572 Ga0207668_10002674
573 Ga0207640_10000200
574 Ga0207640_10025065
575 Ga0207658_10001150
576 Ga0207658_10018315
577 Ga0207658_10499787
578 Ga0207677_10000525
579 Ga0207703_10000023
580 Ga0207703_10214216
581 Ga0207639_10071693
582 Ga0207678_10017704
583 Ga0207678_10172596
584 Ga0207702_10000060
585 Ga0207702_10659088
586 Ga0207674_10463031
587 Ga0207675_100109012
588 Ga0207683_10415991
589 Ga0207698_10000440
590 Ga0268266_10000047
591 Ga0268266_10000527
592 Ga0268266_10039181
593 Ga0268265_10305825
594 Ga0268264_10302342
595 Ga0373955_0091195
596 Ga0373933_0246565
597 Ga0373937_0009742
598 Ga0373937_0020559
599 Ga0373937_0061433
600 Ga0316582_0105479
601 Ga0451853_0613006
602 Ga0451853_1462749
603 Ga0466963_0000001
604 Ga0466963_0016978
605 Ga0466957_0009193
606 Ga0466958_0288123
607 Ga0466967_0000009
608 Ga0466967_0077197
609 Ga0466967_0490669
610 Ga0466967_0997312
611 Ga0495592_0065649
612 Ga0495592_0139474
613 Ga0495603_0013816
614 Ga0495629_0002683
615 Ga0495629_0011125
616 Ga0495629_0037535
617 Ga0495629_0194326
618 Ga0495629_0226260
619 Ga0495638_0056479
620 Ga0495641_0000874
621 Ga0495641_0020628
622 Ga0495641_0053103
623 Ga0495653_0221193
624 Ga0495662_0012662
625 Ga0495664_0111071
626 Ga0495594_0000003
627 Ga0495608_0000068
628 Ga0495608_0041954
629 Ga0495618_0153623
630 Ga0495620_0001371
631 Ga0495628_0000190
632 Ga0495628_0156773
633 Ga0495628_0457174
634 Ga0495637_0080796
635 Ga0495663_0013132
636 Ga0495652_0000546
637 Ga0495652_0004685
638 Ga0495640_0050295
639 Ga0495586_0023070
640 Ga0495645_0019514
641 Ga0495645_0038728
642 Ga0495645_0270703
643 Ga0495622_0000133
644 Ga0495667_0000018
645 Ga0495667_0540567
646 Ga0495634_0006771
647 Ga0495634_0007615
648 Ga0495634_0241923
649 Ga0495625_0000587
650 Ga0495588_0000165
651 Ga0495657_0000004
652 Ga0495599_0010887
653 Ga0495599_0393666
654 Ga0495623_0239702
655 Ga0495647_0000018
656 Ga0495647_0000904
657 Ga0495669_0000033
658 Ga0495669_0007701
659 Ga0495613_0000179
660 Ga0495613_0105952
661 Ga0495624_0000008
662 Ga0495624_0000073
663 Ga0495624_0144317
664 Ga0495671_0173765
665 Ga0495649_0000751
666 Ga0495600_0259456
667 Ga0495604_0000357
668 Ga0495604_0041359
669 Ga0495674_0000607
670 Ga0495674_0217851
671 Ga0495674_0573004
672 Ga0495672_0181230
673 Ga0495676_0025439
674 Ga0495676_0038803
675 Ga0495676_0063988
676 Ga0495676_0684100
677 Ga0495680_0000496
678 Ga0495680_0001969
679 Ga0495680_0015856
680 Ga0495675_0000175
681 Ga0495686_0164077
682 Ga0495602_0002588
683 Ga0495602_0005883
684 Ga0495602_0362410
685 Ga0495602_0492318
686 Ga0495602_0562651
687 Ga0496100_0000002
688 Ga0496100_0000018
689 Ga0496101_0000001
690 Ga0496101_0000062
691 Ga0496102_0000039
692 Ga0496102_0467574
693 Ga0496102_0836538
694 Ga0496103_0000008
695 Ga0496103_0008690
696 Ga0496104_0000004
697 Ga0496104_0000009
698 Ga0496104_0118559
699 Ga0496104_0125040
700 Ga0496105_0000001
701 Ga0496105_0000007
702 Ga0496105_0043598
703 Ga0496105_0169304
704 Ga0496106_0000061
705 Ga0496106_0000122
706 Ga0496106_0121050
707 Ga0496107_0000006
708 Ga0496107_0000013
709 Ga0496107_0049127
710 Ga0496108_0000001
711 Ga0496108_0000062
712 Ga0496108_0033537
713 Ga0496109_0000003
714 Ga0496109_0000121
715 Ga0496109_0000129
716 Ga0496109_0290618
717 Ga0496109_0371416
718 Ga0496110_0000089
719 Ga0496110_0069667
720 Ga0496110_0584238
721 Ga0496111_0003847
722 Ga0496111_0306719
723 Ga0496112_0001770
724 Ga0496112_0241253
725 Ga0496113_0000628
726 Ga0496113_0491829
727 Ga0496114_0000014
728 Ga0496114_0002826
729 Ga0496115_0000003
730 Ga0496115_0004217
731 Ga0496116_0001565
732 Ga0496117_0042198
733 Ga0496118_0000818
734 Ga0496118_0292857
735 Ga0496118_0316574
736 Ga0496119_0005786
737 Ga0496119_0013028
738 Ga0496119_0025637
739 Ga0496120_0005134
740 Ga0496121_0006714
741 Ga0496121_0044624
742 Ga0496121_0064471
743 Ga0496124_0116716
744 Ga0496124_0264146
745 Ga0496125_0052796
746 Ga0496125_0071031
747 Ga0496126_0052939
748 Ga0496126_0603356
749 Ga0501031_0006434
750 Ga0501031_0352488
751 Ga0501031_0502443
752 Ga0501032_0028840
753 Ga0501032_0639080
754 Ga0501033_0003865
755 Ga0501034_0030701
756 Ga0501034_0036729
757 Ga0501034_0141454
758 Ga0501036_0003053
759 Ga0501036_1334244
760 Ga0501037_0525217
761 Ga0501038_0006019
762 Ga0501039_0043596
763 Ga0501040_0069912
764 Ga0501042_0382225
765 Ga0501043_0005761
766 Ga0501043_0024076
767 Ga0501046_0004837
768 Ga0501047_0003503
769 Ga0501047_0671950
770 Ga0501048_0002374
771 Ga0501069_0014365
772 Ga0501070_0000494
773 Ga0501070_0155952
774 Ga0501070_0316352
775 Ga0501070_0374296
776 Ga0501071_0049046
777 Ga0501072_0090134
778 Ga0501073_0271337
779 Ga0501073_0355089
780 Ga0501074_0155227
781 Ga0501076_0038857
782 Ga0501079_0305131
783 Ga0501079_0338000
784 Ga0501083_0025710
785 Ga0501083_0071662
786 Ga0501083_0082878
787 Ga0501035_0000718
788 Ga0501044_0012374
789 Ga0501044_0503970
790 Ga0501045_0047627
791 Ga0501045_0286638
792 nmdc:mga08y16_1018643_c1
793 Ga0495601_0000013
794 Ga0495601_0037632
795 Ga0495601_0044552
796 Ga0495601_0057341
797 Ga0495612_0000339
798 Ga0495612_0001051
799 Ga0495612_0009367
800 Ga0495655_0000001
801 Ga0495595_0000003
802 Ga0495595_0037269
803 Ga0495595_0217391
804 Ga0495619_0000031
805 Ga0495619_0000257
806 Ga0495619_0001230
807 Ga0495619_0022451
808 Ga0495619_0226311
809 Ga0495619_0414871
810 Ga0500566_0003364
811 Ga0500614_138149
812 Ga0500628_000010
813 Ga0500568_0196789
814 Ga0501084_0268206
815 Ga0501082_0054480
816 Ga0530510_0316363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

19

64

0.95

PF21943

TetR_C_46

Tetracyclin repressor-like, C-terminal domain

86

195

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f1b-assembly1.cif.gz_A-2 the crystal structure of a tetr-like transcriptional regulator from rhodococcus sp. rha1. 0.8807 2 185
6o6o-assembly1.cif.gz_B structure of the regulator fasr from mycobacterium tuberculosis 0.8338 2 185
3f1b-assembly1.cif.gz_A-2 the crystal structure of a tetr-like transcriptional regulator from rhodococcus sp. rha1. 0.833 2 185
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.829 2 185
3ccy-assembly1.cif.gz_A-2 crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822 0.8083 2 177
ID Description Score Start End Superfamily
3bqzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9857 2 46 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9828 3 49 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9809 2 49 1.10.10.60
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9787 2 49 1.10.10.60
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9773 2 49 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2T4UFY3-F1-model_v4 HTH tetR-type domain-containing protein 0.9328 2 188 GO:0000976
GO:0003700
AF-A0A7X0HC12-F1-model_v4 AcrR family transcriptional regulator 0.9266 2 126 GO:0000976
GO:0003700
AF-A0A7W1M276-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9254 3 203 GO:0000976
GO:0003700
AF-A0A6N7ZBZ9-F1-model_v4 TetR family transcriptional regulator 0.9241 2 188 GO:0000976
GO:0003700
AF-A0A2V4B8J2-F1-model_v4 TetR family transcriptional regulator 0.9172 2 188 GO:0000976
GO:0003700

Map