F436691

General Info

Members Datasets Scaffolds Average Seq Length
408 215 816 208

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10122463|Ga0075433_101224632
Length 232
Sequence MTFGYWLVVSGSRSTTNDQLPMSLADIRREYLGEPLSEAHCAEDPMRQFAHWFEQVRSVEPDPTAMALATASPNGRPSVRTVLLKGVDDRGFIFYTNYDSRKAREMEATGRASLLFFWPSLERQVRIDGTVERVSPAESDAYFETRPLDSRLSVYASRQSEAIESREVLEDAFERVRRTYGDGPVPRPDWWGGYRIVPDEFEFWQGRASRLHDRLRYVKGGDGAWHRERLAP

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
214 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
215 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.98
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 11.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10122463 3300006852 Unclassified 2310
2 Ga0065712_10001491 3300005290 Bacteria 6627
3 Ga0065712_10001589 3300005290 Bacteria 6586
4 Ga0065715_10001634 3300005293 Bacteria 5803
5 Ga0065715_10019593 3300005293 Bacteria 1723
6 Ga0065715_10283005 3300005293 Bacteria 1081
7 Ga0065707_10167064 3300005295 Bacteria 1514
8 Ga0070676_10054663 3300005328 Unclassified 2354
9 Ga0070676_10784693 3300005328 Bacteria 702
10 Ga0070683_100154135 3300005329 Bacteria 2179
11 Ga0070683_100642219 3300005329 Bacteria 1016
12 Ga0070690_100037742 3300005330 Bacteria 3046
13 Ga0070690_100072971 3300005330 Bacteria 2232
14 Ga0070690_100609414 3300005330 Bacteria 830
15 Ga0070670_100047583 3300005331 Unclassified 3691
16 Ga0070670_100335113 3300005331 Bacteria 1327
17 Ga0070677_10008661 3300005333 Bacteria 3431
18 Ga0070677_10073969 3300005333 Bacteria 1440
19 Ga0068869_100146104 3300005334 Bacteria 1830
20 Ga0068869_100157194 3300005334 Unclassified 1767
21 Ga0070666_10050128 3300005335 Bacteria 2807
22 Ga0070680_100058281 3300005336 Bacteria 3158
23 Ga0070682_100242173 3300005337 Bacteria 1295
24 Ga0068868_100140136 3300005338 Bacteria 1984
25 Ga0070660_100145756 3300005339 Bacteria 1902
26 Ga0070660_100312018 3300005339 Bacteria 1291
27 Ga0070660_100782361 3300005339 Unclassified 802
28 Ga0070689_100037728 3300005340 Bacteria 3695
29 Ga0070689_100077904 3300005340 Bacteria 2598
30 Ga0070691_10031900 3300005341 Bacteria 2473
31 Ga0070687_100070920 3300005343 Unclassified 1870
32 Ga0070687_100081974 3300005343 Bacteria 1763
33 Ga0070661_100383747 3300005344 Bacteria 1108
34 Ga0070692_10017075 3300005345 Bacteria 3463
35 Ga0070668_100039693 3300005347 Bacteria 3600
36 Ga0070668_100294121 3300005347 Unclassified 1360
37 Ga0070669_100007112 3300005353 Bacteria 8042
38 Ga0070669_100007569 3300005353 Bacteria 7775
39 Ga0070669_100444839 3300005353 Unclassified 1067
40 Ga0070675_100065931 3300005354 Bacteria 2994
41 Ga0070675_100082156 3300005354 Unclassified 2688
42 Ga0070675_100087468 3300005354 Bacteria 2606
43 Ga0070675_100275029 3300005354 Bacteria 1479
44 Ga0070675_100283900 3300005354 Unclassified 1455
45 Ga0070675_100466425 3300005354 Bacteria 1134
46 Ga0070675_100489579 3300005354 Unclassified 1107
47 Ga0070671_100036778 3300005355 Bacteria 4060
48 Ga0070674_100023346 3300005356 Bacteria 4002
49 Ga0070674_100170343 3300005356 Bacteria 1659
50 Ga0070673_100087161 3300005364 Bacteria 2544
51 Ga0070673_100232524 3300005364 Bacteria 1600
52 Ga0070688_100003766 3300005365 Bacteria 7858
53 Ga0070688_100159698 3300005365 Bacteria 1548
54 Ga0070688_100189255 3300005365 Unclassified 1433
55 Ga0070659_100079569 3300005366 Bacteria 2616
56 Ga0070659_100187392 3300005366 Unclassified 1700
57 Ga0070659_100457722 3300005366 Unclassified 1083
58 Ga0070667_100112607 3300005367 Bacteria 2360
59 Ga0070701_10006027 3300005438 Bacteria 5065
60 Ga0070701_10013210 3300005438 Bacteria 3750
61 Ga0070701_10506577 3300005438 Unclassified 785
62 Ga0070705_100001914 3300005440 Bacteria 10699
63 Ga0070700_100008615 3300005441 Bacteria 5558
64 Ga0070694_100001272 3300005444 Bacteria 14646
65 Ga0070663_100151292 3300005455 Bacteria 1780
66 Ga0070678_100003345 3300005456 Bacteria 8927
67 Ga0070678_100146362 3300005456 Bacteria 1897
68 Ga0070678_100149071 3300005456 Bacteria 1882
69 Ga0070662_100071771 3300005457 Bacteria 2554
70 Ga0070681_10020566 3300005458 Bacteria 6614
71 Ga0068867_100000356 3300005459 Bacteria 30408
72 Ga0068867_100018382 3300005459 Bacteria 4968
73 Ga0068867_100170784 3300005459 Bacteria 1722
74 Ga0070685_10001332 3300005466 Bacteria 12962
75 Ga0070706_100195051 3300005467 Bacteria 1892
76 Ga0070698_100007776 3300005471 Bacteria 11602
77 Ga0070699_100004832 3300005518 Bacteria 11893
78 Ga0070699_100029414 3300005518 Bacteria 4737
79 Ga0070679_100078151 3300005530 Bacteria 3298
80 Ga0070684_100193400 3300005535 Bacteria 1852
81 Ga0070684_100611742 3300005535 Bacteria 1013
82 Ga0070684_100911477 3300005535 Unclassified 824
83 Ga0070697_100060633 3300005536 Bacteria 3084
84 Ga0070672_100023513 3300005543 Unclassified 4544
85 Ga0070672_100472969 3300005543 Bacteria 1081
86 Ga0070695_100001165 3300005545 Bacteria 14432
87 Ga0070695_100066027 3300005545 Bacteria 2357
88 Ga0070696_100033030 3300005546 Bacteria 3554
89 Ga0070696_100140281 3300005546 Bacteria 1766
90 Ga0070665_100523500 3300005548 Bacteria 1197
91 Ga0070704_100000375 3300005549 Bacteria 20394
92 Ga0070704_100369287 3300005549 Bacteria 1216
93 Ga0068855_100001226 3300005563 Bacteria 31818
94 Ga0070664_100013590 3300005564 Bacteria 6632
95 Ga0070664_100028213 3300005564 Bacteria 4669
96 Ga0070664_100054840 3300005564 Bacteria 3384
97 Ga0068857_100063967 3300005577 Bacteria 3271
98 Ga0068857_100084121 3300005577 Bacteria 2843
99 Ga0068857_100111136 3300005577 Unclassified 2463
100 Ga0068857_100712978 3300005577 Bacteria 954
101 Ga0068856_100035016 3300005614 Bacteria 4920
102 Ga0068856_100504415 3300005614 Bacteria 1231
103 Ga0070702_100064011 3300005615 Bacteria 2150
104 Ga0068859_100010900 3300005617 Bacteria 9150
105 Ga0068859_100011091 3300005617 Bacteria 9066
106 Ga0068859_100066695 3300005617 Bacteria 3634
107 Ga0068859_100119716 3300005617 Bacteria 2700
108 Ga0068859_100207737 3300005617 Bacteria 2044
109 Ga0068864_100034686 3300005618 Unclassified 4293
110 Ga0068864_100767720 3300005618 Bacteria 946
111 Ga0068861_100080101 3300005719 Bacteria 2555
112 Ga0068861_100747765 3300005719 Bacteria 913
113 Ga0068870_10003420 3300005840 Bacteria 6728
114 Ga0068870_10005995 3300005840 Bacteria 5339
115 Ga0068870_10008067 3300005840 Bacteria 4717
116 Ga0068870_10126746 3300005840 Bacteria 1478
117 Ga0068863_100005278 3300005841 Bacteria 12756
118 Ga0068863_100142315 3300005841 Bacteria 2293
119 Ga0068863_100369644 3300005841 Unclassified 1399
120 Ga0068858_100017351 3300005842 Bacteria 6752
121 Ga0068858_100064812 3300005842 Bacteria 3382
122 Ga0068860_100019720 3300005843 Bacteria 6538
123 Ga0068862_100002727 3300005844 Bacteria 15505
124 Ga0068862_100011199 3300005844 Bacteria 7406
125 Ga0081455_10056635 3300005937 Bacteria 3327
126 Ga0097621_100096297 3300006237 Bacteria 2484
127 Ga0075428_100001524 3300006844 Bacteria 24782
128 Ga0075428_100021841 3300006844 Bacteria 7087
129 Ga0075428_100026900 3300006844 Bacteria 6370
130 Ga0075428_100475757 3300006844 Bacteria 1337
131 Ga0075430_100000437 3300006846 Bacteria 30984
132 Ga0075430_100173287 3300006846 Bacteria 1795
133 Ga0075431_100002085 3300006847 Bacteria 19088
134 Ga0075431_100472028 3300006847 Bacteria 1248
135 Ga0075433_10002050 3300006852 Bacteria 15223
136 Ga0075434_100000556 3300006871 Bacteria 28600
137 Ga0075434_100019933 3300006871 Bacteria 6495
138 Ga0075434_100105023 3300006871 Bacteria 2835
139 Ga0075429_100002924 3300006880 Bacteria 14487
140 Ga0075429_100063763 3300006880 Bacteria 3210
141 Ga0075429_100094860 3300006880 Bacteria 2602
142 Ga0068865_100300898 3300006881 Bacteria 1284
143 Ga0097620_100010900 3300006931 Bacteria 9150
144 Ga0097620_100011091 3300006931 Bacteria 9066
145 Ga0097620_100066692 3300006931 Bacteria 3634
146 Ga0097620_100119720 3300006931 Bacteria 2700
147 Ga0097620_100207721 3300006931 Bacteria 2044
148 Ga0075435_100031541 3300007076 Bacteria 4176
149 Ga0075435_100054375 3300007076 Unclassified 3231
150 Ga0075435_100537498 3300007076 Bacteria 1012
151 Ga0111539_10002697 3300009094 Bacteria 23524
152 Ga0111539_10007921 3300009094 Bacteria 13546
153 Ga0111539_10249261 3300009094 Bacteria 2068
154 Ga0111539_10443751 3300009094 Bacteria 1511
155 Ga0114129_10003660 3300009147 Bacteria 21613
156 Ga0114129_10009332 3300009147 Bacteria 13994
157 Ga0114129_10066997 3300009147 Bacteria 5007
158 Ga0114129_10091017 3300009147 Bacteria 4228
159 Ga0114129_10194408 3300009147 Bacteria 2752
160 Ga0105243_10288965 3300009148 Bacteria 1480
161 Ga0105243_10451871 3300009148 Bacteria 1206
162 Ga0105241_10559945 3300009174 Unclassified 1027
163 Ga0105242_10137621 3300009176 Bacteria 2115
164 Ga0105242_10975373 3300009176 Bacteria 853
165 Ga0105248_10055016 3300009177 Bacteria 4463
166 Ga0105248_10337506 3300009177 Bacteria 1697
167 Ga0105237_10000885 3300009545 Bacteria 40373
168 Ga0105238_11194613 3300009551 Unclassified 785
169 Ga0105249_10000242 3300009553 Bacteria 60635
170 Ga0105249_10035212 3300009553 Bacteria 4540
171 Ga0105246_10005714 3300011119 Bacteria 7594
172 Ga0157374_10290664 3300013296 Unclassified 1615
173 Ga0163162_10040900 3300013306 Bacteria 4637
174 Ga0163162_10234612 3300013306 Bacteria 1965
175 Ga0157375_10009416 3300013308 Bacteria 8575
176 Ga0157375_10014376 3300013308 Bacteria 7059
177 Ga0157375_10058393 3300013308 Bacteria 3816
178 Ga0157375_10192327 3300013308 Bacteria 2195
179 Ga0157375_10828499 3300013308 Bacteria 1073
180 Ga0163163_10200854 3300014325 Bacteria 2042
181 Ga0157380_10002081 3300014326 Bacteria 13416
182 Ga0157380_10008570 3300014326 Bacteria 7309
183 Ga0157380_10149132 3300014326 Bacteria 2019
184 Ga0157377_10002691 3300014745 Bacteria 7896
185 Ga0157377_10014074 3300014745 Bacteria 4064
186 Ga0157377_10038312 3300014745 Unclassified 2646
187 Ga0157377_10049082 3300014745 Bacteria 2371
188 Ga0157377_10142202 3300014745 Bacteria 1475
189 Ga0157377_10250205 3300014745 Bacteria 1148
190 Ga0157379_10015590 3300014968 Bacteria 6673
191 Ga0157376_10309048 3300014969 Bacteria 1499
192 Ga0207697_10003516 3300025315 Bacteria 7726
193 Ga0207682_10001096 3300025893 Bacteria 12518
194 Ga0207682_10014961 3300025893 Bacteria 3022
195 Ga0207688_10004447 3300025901 Bacteria 7632
196 Ga0207688_10011618 3300025901 Bacteria 4788
197 Ga0207645_10004248 3300025907 Bacteria 10636
198 Ga0207643_10000360 3300025908 Bacteria 30533
199 Ga0207643_10037937 3300025908 Bacteria 2705
200 Ga0207643_10053560 3300025908 Bacteria 2292
201 Ga0207643_10110124 3300025908 Bacteria 1622
202 Ga0207684_10482264 3300025910 Bacteria 1063
203 Ga0207707_10413530 3300025912 Bacteria 1157
204 Ga0207671_10000817 3300025914 Bacteria 39405
205 Ga0207662_10000923 3300025918 Bacteria 13612
206 Ga0207662_10083718 3300025918 Bacteria 1950
207 Ga0207662_10135041 3300025918 Bacteria 1559
208 Ga0207657_10282109 3300025919 Bacteria 1318
209 Ga0207646_10858771 3300025922 Unclassified 806
210 Ga0207681_10006669 3300025923 Bacteria 7087
211 Ga0207681_10057915 3300025923 Bacteria 2650
212 Ga0207650_10717489 3300025925 Bacteria 845
213 Ga0207659_10002893 3300025926 Bacteria 10215
214 Ga0207659_10057455 3300025926 Bacteria 2790
215 Ga0207659_10396272 3300025926 Unclassified 1154
216 Ga0207659_10428119 3300025926 Bacteria 1111
217 Ga0207659_10511424 3300025926 Bacteria 1017
218 Ga0207659_10602412 3300025926 Unclassified 937
219 Ga0207644_10081026 3300025931 Unclassified 2398
220 Ga0207690_10242201 3300025932 Bacteria 1389
221 Ga0207706_10002433 3300025933 Bacteria 18176
222 Ga0207706_10186198 3300025933 Bacteria 1823
223 Ga0207706_10263863 3300025933 Bacteria 1503
224 Ga0207709_10145970 3300025935 Bacteria 1632
225 Ga0207670_10008954 3300025936 Bacteria 5681
226 Ga0207670_10048231 3300025936 Bacteria 2841
227 Ga0207670_10091226 3300025936 Bacteria 2154
228 Ga0207670_10495050 3300025936 Unclassified 992
229 Ga0207669_10000463 3300025937 Bacteria 17697
230 Ga0207691_10003205 3300025940 Bacteria 15956
231 Ga0207691_10009150 3300025940 Bacteria 9505
232 Ga0207691_10246834 3300025940 Unclassified 1542
233 Ga0207711_10040184 3300025941 Bacteria 3979
234 Ga0207689_10001341 3300025942 Bacteria 23699
235 Ga0207689_10163532 3300025942 Bacteria 1834
236 Ga0207689_10739162 3300025942 Unclassified 830
237 Ga0207661_10106565 3300025944 Bacteria 2363
238 Ga0207661_10730108 3300025944 Bacteria 911
239 Ga0207661_10978175 3300025944 Bacteria 779
240 Ga0207679_10035424 3300025945 Bacteria 3531
241 Ga0207667_10008766 3300025949 Bacteria 11977
242 Ga0207651_10005750 3300025960 Bacteria 6404
243 Ga0207651_10017184 3300025960 Bacteria 4264
244 Ga0207651_10103976 3300025960 Bacteria 2115
245 Ga0207712_10232482 3300025961 Unclassified 1481
246 Ga0207668_10090535 3300025972 Bacteria 2246
247 Ga0207668_10150113 3300025972 Bacteria 1803
248 Ga0207658_10072702 3300025986 Bacteria 2608
249 Ga0207658_10184419 3300025986 Bacteria 1729
250 Ga0207677_10114648 3300026023 Bacteria 2014
251 Ga0207677_10409357 3300026023 Unclassified 1152
252 Ga0207703_10036964 3300026035 Bacteria 3889
253 Ga0207703_10135748 3300026035 Unclassified 2130
254 Ga0207708_10005330 3300026075 Bacteria 9474
255 Ga0207641_10021430 3300026088 Bacteria 5310
256 Ga0207641_11061011 3300026088 Bacteria 808
257 Ga0207648_10004960 3300026089 Bacteria 13537
258 Ga0207648_10028254 3300026089 Bacteria 4974
259 Ga0207648_10099526 3300026089 Bacteria 2546
260 Ga0207648_10235878 3300026089 Bacteria 1628
261 Ga0207648_10270518 3300026089 Bacteria 1518
262 Ga0207676_10080492 3300026095 Bacteria 2644
263 Ga0207676_10141533 3300026095 Bacteria 2060
264 Ga0207676_10258660 3300026095 Unclassified 1570
265 Ga0207674_10012688 3300026116 Bacteria 9414
266 Ga0207674_10057494 3300026116 Bacteria 3943
267 Ga0207674_10267683 3300026116 Bacteria 1656
268 Ga0207675_100002140 3300026118 Bacteria 19602
269 Ga0207675_100005529 3300026118 Bacteria 12084
270 Ga0207675_100186366 3300026118 Bacteria 1989
271 Ga0207675_100462846 3300026118 Bacteria 1258
272 Ga0207683_10003052 3300026121 Bacteria 14645
273 Ga0207683_10030931 3300026121 Bacteria 4643
274 Ga0207428_10000579 3300027907 Bacteria 43267
275 Ga0207428_10004360 3300027907 Bacteria 13502
276 Ga0268265_10001311 3300028380 Bacteria 21331
277 Ga0268265_10194698 3300028380 Bacteria 1753
278 Ga0268264_10084986 3300028381 Bacteria 2714
279 Ga0265332_10005863 3300031238 Bacteria 5625
280 Ga0265339_10000285 3300031249 Bacteria 40872
281 Ga0265316_10001954 3300031344 Bacteria 21657
282 Ga0265314_10000001 3300031711 Bacteria 3792860
283 Ga0373958_0003648 3300034819 Unclassified 2235
284 Ga0373926_0073032 3300035083 Bacteria 1262
285 Ga0373949_0032512 3300035090 Unclassified 1249
286 Ga0373932_0005554 3300035112 Bacteria 2966
287 Ga0373960_0087485 3300035121 Unclassified 991
288 Ga0373955_0024321 3300035172 Bacteria 3097
289 Ga0373942_0017151 3300035207 Bacteria 1783
290 Ga0373962_0175784 3300035242 Bacteria 713
291 Ga0373931_0113650 3300035691 Bacteria 1539
292 Ga0373937_0022324 3300036401 Bacteria 5690
293 Ga0395905_0611407 3300037471 Bacteria 992
294 Ga0395905_0913695 3300037471 Unclassified 781
295 Ga0436364_0364271 3300037853 Bacteria 1137
296 Ga0436365_1744975 3300039437 Bacteria 17913
297 Ga0436365_1796636 3300039437 Bacteria 1376
298 Ga0451807_1650344 3300041486 Bacteria 2867
299 Ga0439445_0032877 3300042004 Bacteria 1354
300 Ga0439435_0065655 3300042436 Bacteria 1065
301 Ga0451577_0018691 3300042876 Bacteria 6379
302 Ga0451576_0004132 3300045051 Bacteria 19144
303 Ga0451576_0009196 3300045051 Bacteria 11481
304 Ga0451576_0025202 3300045051 Bacteria 6410
305 Ga0451576_0087287 3300045051 Bacteria 3244
306 Ga0451576_0354708 3300045051 Bacteria 1536
307 Ga0495580_0488887 3300046472 Unclassified 822
308 Ga0495584_0064638 3300046491 Bacteria 1840
309 Ga0495594_0041308 3300046499 Bacteria 2526
310 Ga0495630_0481122 3300046517 Bacteria 952
311 Ga0495644_0089853 3300046523 Unclassified 1159
312 Ga0495663_0094042 3300046525 Bacteria 980
313 Ga0495642_0124535 3300046528 Unclassified 1107
314 Ga0495598_0204567 3300046537 Bacteria 714
315 Ga0495609_0103509 3300046538 Bacteria 1232
316 Ga0495621_0058574 3300046539 Bacteria 1394
317 Ga0495645_0172909 3300046543 Bacteria 1486
318 Ga0495633_0239821 3300046558 Unclassified 828
319 Ga0495656_0499644 3300046615 Bacteria 645
320 Ga0495659_0007820 3300046664 Bacteria 3390
321 Ga0495659_0054400 3300046664 Bacteria 1464
322 Ga0495670_0040185 3300046691 Unclassified 2333
323 Ga0495636_0318090 3300047318 Bacteria 730
324 Ga0495677_0035110 3300047445 Bacteria 1830
325 Ga0495677_0136151 3300047445 Bacteria 942
326 Ga0496104_0309731 3300048907 Bacteria 1492
327 Ga0496109_0096371 3300048912 Bacteria 2741
328 Ga0496113_0235416 3300048916 Bacteria 1461
329 Ga0501033_0042476 3300049570 Bacteria 3390
330 Ga0501036_0080811 3300049572 Bacteria 2747
331 Ga0501037_0067530 3300049573 Bacteria 2603
332 Ga0501038_0048691 3300049574 Bacteria 3666
333 Ga0501038_0151278 3300049574 Unclassified 1892
334 Ga0501038_0227116 3300049574 Bacteria 1487
335 Ga0501039_0024721 3300049575 Bacteria 4615
336 Ga0501039_0641478 3300049575 Bacteria 832
337 Ga0501040_0009183 3300049576 Bacteria 6441
338 Ga0501040_0059971 3300049576 Bacteria 2614
339 Ga0501041_0061982 3300049577 Bacteria 2290
340 Ga0501041_0411443 3300049577 Bacteria 857
341 Ga0501042_0015826 3300049578 Bacteria 5169
342 Ga0501042_0024770 3300049578 Bacteria 4211
343 Ga0501042_0074699 3300049578 Bacteria 2426
344 Ga0501043_0195462 3300049579 Bacteria 1572
345 Ga0501043_0464647 3300049579 Bacteria 949
346 Ga0501046_0016342 3300049580 Bacteria 6218
347 Ga0501046_0223809 3300049580 Bacteria 1392
348 Ga0501048_0168636 3300049582 Bacteria 1550
349 Ga0501068_0068485 3300049584 Bacteria 2163
350 Ga0501071_0119190 3300049587 Bacteria 1955
351 Ga0501072_0035798 3300049588 Bacteria 3890
352 Ga0501072_0059761 3300049588 Bacteria 3005
353 Ga0501075_0109846 3300049591 Bacteria 2096
354 Ga0501076_0015340 3300049592 Bacteria 5789
355 Ga0501077_0040978 3300049593 Bacteria 2949
356 Ga0501079_0082553 3300049741 Bacteria 2485
357 Ga0501079_0116758 3300049741 Bacteria 2074
358 Ga0501079_0257916 3300049741 Bacteria 1363
359 Ga0501080_0028101 3300049742 Bacteria 5230
360 Ga0501080_0068348 3300049742 Bacteria 3305
361 Ga0501081_0011513 3300049743 Bacteria 5787
362 Ga0501081_0016855 3300049743 Bacteria 4828
363 Ga0501035_0055140 3300049822 Bacteria 3550
364 Ga0501035_0064995 3300049822 Bacteria 3241
365 Ga0501035_0215890 3300049822 Bacteria 1640
366 Ga0501035_0717946 3300049822 Bacteria 805
367 Ga0501044_0038597 3300049823 Bacteria 4987
368 Ga0501045_0009385 3300049824 Bacteria 6841
369 Ga0501045_0781918 3300049824 Bacteria 703
370 nmdc:mga07m45_203049_c1 3300050496 Bacteria 1153
371 nmdc:mga05p37_102104_c1 3300050507 Bacteria 3532
372 nmdc:mga05p37_118744_c1 3300050507 Bacteria 3249
373 nmdc:mga05p37_180477_c2 3300050507 Bacteria 2133
374 nmdc:mga05p37_207761_c1 3300050507 Bacteria 2368
375 nmdc:mga05p37_6873_c1 3300050507 Bacteria 13410
376 nmdc:mga09592_123675_c1 3300050508 Bacteria 2223
377 nmdc:mga09592_146748_c1 3300050508 Bacteria 2034
378 nmdc:mga09592_185460_c1 3300050508 Unclassified 1800
379 nmdc:mga09592_3450_c1 3300050508 Bacteria 12773
380 nmdc:mga09592_374235_c1 3300050508 Bacteria 1232
381 nmdc:mga09592_395831_c1 3300050508 Bacteria 1194
382 nmdc:mga0qj67_246031_c1 3300050509 Bacteria 1451
383 nmdc:mga0qj67_882_c1 3300050509 Bacteria 20549
384 nmdc:mga06r32_131_c1 3300050510 Bacteria 54857
385 nmdc:mga06r32_482651_c1 3300050510 Bacteria 1217
386 nmdc:mga08y16_3360_c1 3300050511 Bacteria 16582
387 nmdc:mga08y16_351842_c1 3300050511 Bacteria 1513
388 nmdc:mga08y16_5466_c1 3300050511 Bacteria 13285
389 nmdc:mga0n895_2069_c1 3300050512 Bacteria 15443
390 nmdc:mga0n895_2961_c1 3300050512 Bacteria 13476
391 nmdc:mga0n895_58251_c1 3300050512 Bacteria 3808
392 nmdc:mga0n895_94217_c1 3300050512 Bacteria 2998
393 nmdc:mga0a205_11330_c1 3300050515 Bacteria 8208
394 nmdc:mga0a205_124016_c1 3300050515 Bacteria 2483
395 nmdc:mga0a205_1373_c1 3300050515 Bacteria 20563
396 Ga0501084_0014202 3300054114 Bacteria 6594
397 Ga0501084_0188165 3300054114 Bacteria 1742
398 Ga0590071_004818 3300059421 Bacteria 3258
399 Ga0590075_000158 3300059424 Bacteria 18391
400 Ga0590077_000014 3300059426 Bacteria 39311
401 Ga0590077_001201 3300059426 Bacteria 6274
402 Ga0501082_0010614 3300060353 Bacteria 7928
403 Ga0501082_0087687 3300060353 Bacteria 2685
404 Ga0530510_0012569 3300061734 Bacteria 5950
405 Ga0530510_0432550 3300061734 Bacteria 994
406 2739611759 2739367655 Bacteria 4051151
407 2881931518 2881927736 Bacteria 3993927
408 2887377659 2887375801 Bacteria 5334027
409 Ga0075433_10122463
410 Ga0065712_10001491
411 Ga0065712_10001589
412 Ga0065715_10001634
413 Ga0065715_10019593
414 Ga0065715_10283005
415 Ga0065707_10167064
416 Ga0070676_10054663
417 Ga0070676_10784693
418 Ga0070683_100154135
419 Ga0070683_100642219
420 Ga0070690_100037742
421 Ga0070690_100072971
422 Ga0070690_100609414
423 Ga0070670_100047583
424 Ga0070670_100335113
425 Ga0070677_10008661
426 Ga0070677_10073969
427 Ga0068869_100146104
428 Ga0068869_100157194
429 Ga0070666_10050128
430 Ga0070680_100058281
431 Ga0070682_100242173
432 Ga0068868_100140136
433 Ga0070660_100145756
434 Ga0070660_100312018
435 Ga0070660_100782361
436 Ga0070689_100037728
437 Ga0070689_100077904
438 Ga0070691_10031900
439 Ga0070687_100070920
440 Ga0070687_100081974
441 Ga0070661_100383747
442 Ga0070692_10017075
443 Ga0070668_100039693
444 Ga0070668_100294121
445 Ga0070669_100007112
446 Ga0070669_100007569
447 Ga0070669_100444839
448 Ga0070675_100065931
449 Ga0070675_100082156
450 Ga0070675_100087468
451 Ga0070675_100275029
452 Ga0070675_100283900
453 Ga0070675_100466425
454 Ga0070675_100489579
455 Ga0070671_100036778
456 Ga0070674_100023346
457 Ga0070674_100170343
458 Ga0070673_100087161
459 Ga0070673_100232524
460 Ga0070688_100003766
461 Ga0070688_100159698
462 Ga0070688_100189255
463 Ga0070659_100079569
464 Ga0070659_100187392
465 Ga0070659_100457722
466 Ga0070667_100112607
467 Ga0070701_10006027
468 Ga0070701_10013210
469 Ga0070701_10506577
470 Ga0070705_100001914
471 Ga0070700_100008615
472 Ga0070694_100001272
473 Ga0070663_100151292
474 Ga0070678_100003345
475 Ga0070678_100146362
476 Ga0070678_100149071
477 Ga0070662_100071771
478 Ga0070681_10020566
479 Ga0068867_100000356
480 Ga0068867_100018382
481 Ga0068867_100170784
482 Ga0070685_10001332
483 Ga0070706_100195051
484 Ga0070698_100007776
485 Ga0070699_100004832
486 Ga0070699_100029414
487 Ga0070679_100078151
488 Ga0070684_100193400
489 Ga0070684_100611742
490 Ga0070684_100911477
491 Ga0070697_100060633
492 Ga0070672_100023513
493 Ga0070672_100472969
494 Ga0070695_100001165
495 Ga0070695_100066027
496 Ga0070696_100033030
497 Ga0070696_100140281
498 Ga0070665_100523500
499 Ga0070704_100000375
500 Ga0070704_100369287
501 Ga0068855_100001226
502 Ga0070664_100013590
503 Ga0070664_100028213
504 Ga0070664_100054840
505 Ga0068857_100063967
506 Ga0068857_100084121
507 Ga0068857_100111136
508 Ga0068857_100712978
509 Ga0068856_100035016
510 Ga0068856_100504415
511 Ga0070702_100064011
512 Ga0068859_100010900
513 Ga0068859_100011091
514 Ga0068859_100066695
515 Ga0068859_100119716
516 Ga0068859_100207737
517 Ga0068864_100034686
518 Ga0068864_100767720
519 Ga0068861_100080101
520 Ga0068861_100747765
521 Ga0068870_10003420
522 Ga0068870_10005995
523 Ga0068870_10008067
524 Ga0068870_10126746
525 Ga0068863_100005278
526 Ga0068863_100142315
527 Ga0068863_100369644
528 Ga0068858_100017351
529 Ga0068858_100064812
530 Ga0068860_100019720
531 Ga0068862_100002727
532 Ga0068862_100011199
533 Ga0081455_10056635
534 Ga0097621_100096297
535 Ga0075428_100001524
536 Ga0075428_100021841
537 Ga0075428_100026900
538 Ga0075428_100475757
539 Ga0075430_100000437
540 Ga0075430_100173287
541 Ga0075431_100002085
542 Ga0075431_100472028
543 Ga0075433_10002050
544 Ga0075434_100000556
545 Ga0075434_100019933
546 Ga0075434_100105023
547 Ga0075429_100002924
548 Ga0075429_100063763
549 Ga0075429_100094860
550 Ga0068865_100300898
551 Ga0097620_100010900
552 Ga0097620_100011091
553 Ga0097620_100066692
554 Ga0097620_100119720
555 Ga0097620_100207721
556 Ga0075435_100031541
557 Ga0075435_100054375
558 Ga0075435_100537498
559 Ga0111539_10002697
560 Ga0111539_10007921
561 Ga0111539_10249261
562 Ga0111539_10443751
563 Ga0114129_10003660
564 Ga0114129_10009332
565 Ga0114129_10066997
566 Ga0114129_10091017
567 Ga0114129_10194408
568 Ga0105243_10288965
569 Ga0105243_10451871
570 Ga0105241_10559945
571 Ga0105242_10137621
572 Ga0105242_10975373
573 Ga0105248_10055016
574 Ga0105248_10337506
575 Ga0105237_10000885
576 Ga0105238_11194613
577 Ga0105249_10000242
578 Ga0105249_10035212
579 Ga0105246_10005714
580 Ga0157374_10290664
581 Ga0163162_10040900
582 Ga0163162_10234612
583 Ga0157375_10009416
584 Ga0157375_10014376
585 Ga0157375_10058393
586 Ga0157375_10192327
587 Ga0157375_10828499
588 Ga0163163_10200854
589 Ga0157380_10002081
590 Ga0157380_10008570
591 Ga0157380_10149132
592 Ga0157377_10002691
593 Ga0157377_10014074
594 Ga0157377_10038312
595 Ga0157377_10049082
596 Ga0157377_10142202
597 Ga0157377_10250205
598 Ga0157379_10015590
599 Ga0157376_10309048
600 Ga0207697_10003516
601 Ga0207682_10001096
602 Ga0207682_10014961
603 Ga0207688_10004447
604 Ga0207688_10011618
605 Ga0207645_10004248
606 Ga0207643_10000360
607 Ga0207643_10037937
608 Ga0207643_10053560
609 Ga0207643_10110124
610 Ga0207684_10482264
611 Ga0207707_10413530
612 Ga0207671_10000817
613 Ga0207662_10000923
614 Ga0207662_10083718
615 Ga0207662_10135041
616 Ga0207657_10282109
617 Ga0207646_10858771
618 Ga0207681_10006669
619 Ga0207681_10057915
620 Ga0207650_10717489
621 Ga0207659_10002893
622 Ga0207659_10057455
623 Ga0207659_10396272
624 Ga0207659_10428119
625 Ga0207659_10511424
626 Ga0207659_10602412
627 Ga0207644_10081026
628 Ga0207690_10242201
629 Ga0207706_10002433
630 Ga0207706_10186198
631 Ga0207706_10263863
632 Ga0207709_10145970
633 Ga0207670_10008954
634 Ga0207670_10048231
635 Ga0207670_10091226
636 Ga0207670_10495050
637 Ga0207669_10000463
638 Ga0207691_10003205
639 Ga0207691_10009150
640 Ga0207691_10246834
641 Ga0207711_10040184
642 Ga0207689_10001341
643 Ga0207689_10163532
644 Ga0207689_10739162
645 Ga0207661_10106565
646 Ga0207661_10730108
647 Ga0207661_10978175
648 Ga0207679_10035424
649 Ga0207667_10008766
650 Ga0207651_10005750
651 Ga0207651_10017184
652 Ga0207651_10103976
653 Ga0207712_10232482
654 Ga0207668_10090535
655 Ga0207668_10150113
656 Ga0207658_10072702
657 Ga0207658_10184419
658 Ga0207677_10114648
659 Ga0207677_10409357
660 Ga0207703_10036964
661 Ga0207703_10135748
662 Ga0207708_10005330
663 Ga0207641_10021430
664 Ga0207641_11061011
665 Ga0207648_10004960
666 Ga0207648_10028254
667 Ga0207648_10099526
668 Ga0207648_10235878
669 Ga0207648_10270518
670 Ga0207676_10080492
671 Ga0207676_10141533
672 Ga0207676_10258660
673 Ga0207674_10012688
674 Ga0207674_10057494
675 Ga0207674_10267683
676 Ga0207675_100002140
677 Ga0207675_100005529
678 Ga0207675_100186366
679 Ga0207675_100462846
680 Ga0207683_10003052
681 Ga0207683_10030931
682 Ga0207428_10000579
683 Ga0207428_10004360
684 Ga0268265_10001311
685 Ga0268265_10194698
686 Ga0268264_10084986
687 Ga0265332_10005863
688 Ga0265339_10000285
689 Ga0265316_10001954
690 Ga0265314_10000001
691 Ga0373958_0003648
692 Ga0373926_0073032
693 Ga0373949_0032512
694 Ga0373932_0005554
695 Ga0373960_0087485
696 Ga0373955_0024321
697 Ga0373942_0017151
698 Ga0373962_0175784
699 Ga0373931_0113650
700 Ga0373937_0022324
701 Ga0395905_0611407
702 Ga0395905_0913695
703 Ga0436364_0364271
704 Ga0436365_1744975
705 Ga0436365_1796636
706 Ga0451807_1650344
707 Ga0439445_0032877
708 Ga0439435_0065655
709 Ga0451577_0018691
710 Ga0451576_0004132
711 Ga0451576_0009196
712 Ga0451576_0025202
713 Ga0451576_0087287
714 Ga0451576_0354708
715 Ga0495580_0488887
716 Ga0495584_0064638
717 Ga0495594_0041308
718 Ga0495630_0481122
719 Ga0495644_0089853
720 Ga0495663_0094042
721 Ga0495642_0124535
722 Ga0495598_0204567
723 Ga0495609_0103509
724 Ga0495621_0058574
725 Ga0495645_0172909
726 Ga0495633_0239821
727 Ga0495656_0499644
728 Ga0495659_0007820
729 Ga0495659_0054400
730 Ga0495670_0040185
731 Ga0495636_0318090
732 Ga0495677_0035110
733 Ga0495677_0136151
734 Ga0496104_0309731
735 Ga0496109_0096371
736 Ga0496113_0235416
737 Ga0501033_0042476
738 Ga0501036_0080811
739 Ga0501037_0067530
740 Ga0501038_0048691
741 Ga0501038_0151278
742 Ga0501038_0227116
743 Ga0501039_0024721
744 Ga0501039_0641478
745 Ga0501040_0009183
746 Ga0501040_0059971
747 Ga0501041_0061982
748 Ga0501041_0411443
749 Ga0501042_0015826
750 Ga0501042_0024770
751 Ga0501042_0074699
752 Ga0501043_0195462
753 Ga0501043_0464647
754 Ga0501046_0016342
755 Ga0501046_0223809
756 Ga0501048_0168636
757 Ga0501068_0068485
758 Ga0501071_0119190
759 Ga0501072_0035798
760 Ga0501072_0059761
761 Ga0501075_0109846
762 Ga0501076_0015340
763 Ga0501077_0040978
764 Ga0501079_0082553
765 Ga0501079_0116758
766 Ga0501079_0257916
767 Ga0501080_0028101
768 Ga0501080_0068348
769 Ga0501081_0011513
770 Ga0501081_0016855
771 Ga0501035_0055140
772 Ga0501035_0064995
773 Ga0501035_0215890
774 Ga0501035_0717946
775 Ga0501044_0038597
776 Ga0501045_0009385
777 Ga0501045_0781918
778 nmdc:mga07m45_203049_c1
779 nmdc:mga05p37_102104_c1
780 nmdc:mga05p37_118744_c1
781 nmdc:mga05p37_180477_c2
782 nmdc:mga05p37_207761_c1
783 nmdc:mga05p37_6873_c1
784 nmdc:mga09592_123675_c1
785 nmdc:mga09592_146748_c1
786 nmdc:mga09592_185460_c1
787 nmdc:mga09592_3450_c1
788 nmdc:mga09592_374235_c1
789 nmdc:mga09592_395831_c1
790 nmdc:mga0qj67_246031_c1
791 nmdc:mga0qj67_882_c1
792 nmdc:mga06r32_131_c1
793 nmdc:mga06r32_482651_c1
794 nmdc:mga08y16_3360_c1
795 nmdc:mga08y16_351842_c1
796 nmdc:mga08y16_5466_c1
797 nmdc:mga0n895_2069_c1
798 nmdc:mga0n895_2961_c1
799 nmdc:mga0n895_58251_c1
800 nmdc:mga0n895_94217_c1
801 nmdc:mga0a205_11330_c1
802 nmdc:mga0a205_124016_c1
803 nmdc:mga0a205_1373_c1
804 Ga0501084_0014202
805 Ga0501084_0188165
806 Ga0590071_004818
807 Ga0590075_000158
808 Ga0590077_000014
809 Ga0590077_001201
810 Ga0501082_0010614
811 Ga0501082_0087687
812 Ga0530510_0012569
813 Ga0530510_0432550
814 2739611759
815 2881931518
816 2887377659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

191

232

0.99

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

53

138

0.95

PF12766

Pyridox_oxase_2

Pyridoxamine 5'-phosphate oxidase

44

135

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ci0-assembly1.cif.gz_B pnp oxidase from saccharomyces cerevisiae 0.9613 14 209
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9593 1 209
6ylz-assembly1.cif.gz_AAA-2 x-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli 0.9569 13 209
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9548 1 209
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.9534 13 209
ID Description Score Start End Superfamily
af_Q9LTX3_323_519_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9761 10 198 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9678 10 159 2.30.110.10
af_Q9VHZ5_37_246_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9625 22 209 2.30.110.10
af_Q54YS6_26_227_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9557 13 209 2.30.110.10
af_Q20939_8_226_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9542 3 209 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A519I4P0-F1-model_v4 deleted 0.9837 39 209
AF-A0A356SFP4-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9828 58 184 GO:0004733
GO:0008615
GO:0010181
AF-A0A7X4B8B1-F1-model_v4 Multifunctional fusion protein [Includes: Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase); Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (Pyridoxal 5'-phosphate synthase) (PNPOx)] 0.9815 13 209 GO:0004733
GO:0008113
GO:0008615
GO:0010181
GO:0036211
AF-A0A4Y9SP62-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9811 3 209 GO:0004733
GO:0008615
GO:0010181
AF-A0A527H0Q6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9807 45 209 GO:0004733
GO:0008615
GO:0010181

Map