F436653

General Info

Members Datasets Scaffolds Average Seq Length
408 150 816 487

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100011534|Ga0070688_1000115344
Length 537
Sequence MRSIEPDVRTTCRFSGDRFRKASRITMVALKKGMAALRTRRLECLRTXXARGTYVAPAWIVVARGATPTIPITTAPGSDVAHIVEARRRADFAAMQTFRPGYGFWRHVFTLPDGSIAFGSASDGRLLATFPARGDWTRHAVWVDPTLAGLLDGQQLARKVGERRDQVAELLERATGPVLQNSTRGDALLRSVPKYGSFVAEWGAIYERFGVPGEIGLAQVILESGLNGTRRSEANAVGFCQWLRKNWKRLNYFSPDPIEQENQTSQAPYCAAYLSVLATKYGSFIPALSEHNAGGTNVGRALINGEHLGAQDVRAQYFLGSKLARDLRTLQSKEYEDVYYSYGPRSYLYAEMVFGNTFNVTELAASIPQEPIHAMRTPRVLSLAEIVRRTGLARAEVQRFNPALGDRLQSGETLYLPYYVSGFGPDVAFWHRPPAAAYLTVLDDFLRLDAGPEQWDDPTFAPVLADFRRRFRNTNTEEGTVMDTVLAYVMDQAYTSSRRTLLSDFRRDEKVQRLIERGVRELDILHAPSLPVSPATF

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100011534 3300005365 Bacteria 4913
2 Ga0065704_10075061 3300005289 Bacteria 5811
3 Ga0065704_10090839 3300005289 Bacteria 2760
4 Ga0065712_10015575 3300005290 Bacteria 3157
5 Ga0065712_10067909 3300005290 Bacteria 21602
6 Ga0065712_10068677 3300005290 Bacteria 9418
7 Ga0065712_10069251 3300005290 Bacteria 7656
8 Ga0065707_10002135 3300005295 Bacteria 9610
9 Ga0065707_10087185 3300005295 Bacteria 5127
10 Ga0070676_10009187 3300005328 Bacteria 5343
11 Ga0070670_100027558 3300005331 Bacteria 4887
12 Ga0070670_100090811 3300005331 Bacteria 2625
13 Ga0070666_10099339 3300005335 Bacteria 2004
14 Ga0068868_100030364 3300005338 Bacteria 4144
15 Ga0070689_100014235 3300005340 Bacteria 5774
16 Ga0070689_100039268 3300005340 Unclassified 3624
17 Ga0070687_100004759 3300005343 Bacteria 5433
18 Ga0070669_100000378 3300005353 Bacteria 34229
19 Ga0070669_100001379 3300005353 Bacteria 17527
20 Ga0070675_100002152 3300005354 Bacteria 14577
21 Ga0070675_100003596 3300005354 Bacteria 11796
22 Ga0070675_100011666 3300005354 Bacteria 6886
23 Ga0070675_100026765 3300005354 Bacteria 4628
24 Ga0070675_100033624 3300005354 Bacteria 4159
25 Ga0070675_100038438 3300005354 Unclassified 3900
26 Ga0070675_100044976 3300005354 Bacteria 3612
27 Ga0070674_100007790 3300005356 Bacteria 6331
28 Ga0070673_100034776 3300005364 Bacteria 3816
29 Ga0070688_100009750 3300005365 Bacteria 5272
30 Ga0070659_100042878 3300005366 Bacteria 3538
31 Ga0070667_100008327 3300005367 Bacteria 8592
32 Ga0070701_10005380 3300005438 Bacteria 5281
33 Ga0070701_10020739 3300005438 Bacteria 3124
34 Ga0070705_100064040 3300005440 Bacteria 2195
35 Ga0070700_100012562 3300005441 Bacteria 4731
36 Ga0070700_100021095 3300005441 Bacteria 3784
37 Ga0070700_100047835 3300005441 Bacteria 2649
38 Ga0070694_100002356 3300005444 Bacteria 11162
39 Ga0070708_100126467 3300005445 Unclassified 2363
40 Ga0070662_100029546 3300005457 Bacteria 3826
41 Ga0070662_100086002 3300005457 Unclassified 2351
42 Ga0068867_100026808 3300005459 Bacteria 4139
43 Ga0070685_10003309 3300005466 Bacteria 8186
44 Ga0070685_10007909 3300005466 Bacteria 5447
45 Ga0070707_100013059 3300005468 Bacteria 7761
46 Ga0070698_100010609 3300005471 Bacteria 9814
47 Ga0070698_100084436 3300005471 Bacteria 3163
48 Ga0070698_100103115 3300005471 Bacteria 2823
49 Ga0070699_100001167 3300005518 Bacteria 24363
50 Ga0070699_100007128 3300005518 Bacteria 9714
51 Ga0070699_100018376 3300005518 Bacteria 6007
52 Ga0070684_100003173 3300005535 Bacteria 12291
53 Ga0070697_100015884 3300005536 Bacteria 5915
54 Ga0070672_100012198 3300005543 Bacteria 6021
55 Ga0070672_100018593 3300005543 Bacteria 5028
56 Ga0070672_100156407 3300005543 Bacteria 1888
57 Ga0070686_100108089 3300005544 Bacteria 1890
58 Ga0070695_100000310 3300005545 Bacteria 24777
59 Ga0070695_100114826 3300005545 Bacteria 1834
60 Ga0070696_100000106 3300005546 Bacteria 43183
61 Ga0070696_100010693 3300005546 Bacteria 6148
62 Ga0070696_100028486 3300005546 Bacteria 3812
63 Ga0070696_100037673 3300005546 Bacteria 3336
64 Ga0070704_100002804 3300005549 Bacteria 9866
65 Ga0070704_100003593 3300005549 Bacteria 8916
66 Ga0070704_100007155 3300005549 Bacteria 6630
67 Ga0070664_100001164 3300005564 Bacteria 20870
68 Ga0070664_100002714 3300005564 Bacteria 14286
69 Ga0070664_100064641 3300005564 Bacteria 3121
70 Ga0070664_100123926 3300005564 Bacteria 2265
71 Ga0068857_100028567 3300005577 Bacteria 4922
72 Ga0070702_100015726 3300005615 Bacteria 3868
73 Ga0068859_100000705 3300005617 Bacteria 33548
74 Ga0068859_100002900 3300005617 Bacteria 17417
75 Ga0068859_100052624 3300005617 Bacteria 4094
76 Ga0068859_100059218 3300005617 Bacteria 3858
77 Ga0068859_100061275 3300005617 Bacteria 3791
78 Ga0068864_100028712 3300005618 Bacteria 4706
79 Ga0068864_100029994 3300005618 Bacteria 4609
80 Ga0068861_100002762 3300005719 Bacteria 11510
81 Ga0068870_10004239 3300005840 Bacteria 6162
82 Ga0068870_10006732 3300005840 Bacteria 5088
83 Ga0068870_10012037 3300005840 Bacteria 4029
84 Ga0068863_100023314 3300005841 Bacteria 5913
85 Ga0068863_100133393 3300005841 Bacteria 2372
86 Ga0068863_100197720 3300005841 Bacteria 1933
87 Ga0068858_100035854 3300005842 Bacteria 4600
88 Ga0068862_100000408 3300005844 Bacteria 46486
89 Ga0068862_100006706 3300005844 Bacteria 9555
90 Ga0068862_100024827 3300005844 Bacteria 5029
91 Ga0068862_100104519 3300005844 Unclassified 2481
92 Ga0068871_100038724 3300006358 Bacteria 3810
93 Ga0075428_100001453 3300006844 Bacteria 25347
94 Ga0075428_100001462 3300006844 Bacteria 25269
95 Ga0075428_100001727 3300006844 Bacteria 23339
96 Ga0075428_100001787 3300006844 Bacteria 22982
97 Ga0075428_100008874 3300006844 Bacteria 11153
98 Ga0075428_100009227 3300006844 Bacteria 10943
99 Ga0075428_100010559 3300006844 Bacteria 10265
100 Ga0075428_100036647 3300006844 Bacteria 5402
101 Ga0075428_100038507 3300006844 Bacteria 5262
102 Ga0075428_100041204 3300006844 Bacteria 5079
103 Ga0075428_100041259 3300006844 Bacteria 5075
104 Ga0075428_100069822 3300006844 Bacteria 3841
105 Ga0075428_100070386 3300006844 Bacteria 3824
106 Ga0075428_100128651 3300006844 Bacteria 2755
107 Ga0075428_100142726 3300006844 Bacteria 2603
108 Ga0075430_100009704 3300006846 Bacteria 8133
109 Ga0075430_100012071 3300006846 Bacteria 7354
110 Ga0075430_100014628 3300006846 Bacteria 6683
111 Ga0075430_100026954 3300006846 Bacteria 4887
112 Ga0075430_100037668 3300006846 Bacteria 4099
113 Ga0075430_100059128 3300006846 Bacteria 3222
114 Ga0075430_100070687 3300006846 Bacteria 2927
115 Ga0075431_100000722 3300006847 Bacteria 28493
116 Ga0075431_100000913 3300006847 Bacteria 26025
117 Ga0075431_100001873 3300006847 Bacteria 19923
118 Ga0075431_100008792 3300006847 Bacteria 10119
119 Ga0075431_100015845 3300006847 Bacteria 7644
120 Ga0075431_100020638 3300006847 Bacteria 6732
121 Ga0075431_100036652 3300006847 Bacteria 5052
122 Ga0075431_100044617 3300006847 Unclassified 4572
123 Ga0075431_100046944 3300006847 Bacteria 4453
124 Ga0075431_100140428 3300006847 Bacteria 2490
125 Ga0075431_100158744 3300006847 Unclassified 2326
126 Ga0075433_10004080 3300006852 Bacteria 11322
127 Ga0075433_10005616 3300006852 Bacteria 9859
128 Ga0075433_10007720 3300006852 Bacteria 8546
129 Ga0075433_10020989 3300006852 Bacteria 5471
130 Ga0075433_10031847 3300006852 Bacteria 4511
131 Ga0075433_10074401 3300006852 Bacteria 2989
132 Ga0075433_10114681 3300006852 Unclassified 2391
133 Ga0075434_100002065 3300006871 Bacteria 17458
134 Ga0075434_100008041 3300006871 Bacteria 9778
135 Ga0075434_100010218 3300006871 Bacteria 8791
136 Ga0075434_100016302 3300006871 Bacteria 7141
137 Ga0075434_100019389 3300006871 Bacteria 6582
138 Ga0075434_100027372 3300006871 Bacteria 5597
139 Ga0075434_100050410 3300006871 Bacteria 4135
140 Ga0075434_100092711 3300006871 Bacteria 3023
141 Ga0075429_100002032 3300006880 Bacteria 16840
142 Ga0075429_100014556 3300006880 Bacteria 6817
143 Ga0075429_100014828 3300006880 Bacteria 6756
144 Ga0075429_100033924 3300006880 Unclassified 4435
145 Ga0075429_100075756 3300006880 Bacteria 2931
146 Ga0075429_100088761 3300006880 Bacteria 2695
147 Ga0068865_100064185 3300006881 Bacteria 2584
148 Ga0097620_100000705 3300006931 Bacteria 33548
149 Ga0097620_100002900 3300006931 Bacteria 17417
150 Ga0097620_100052622 3300006931 Bacteria 4094
151 Ga0097620_100059219 3300006931 Bacteria 3858
152 Ga0097620_100061275 3300006931 Bacteria 3791
153 Ga0097620_100180220 3300006931 Bacteria 2195
154 Ga0075435_100007192 3300007076 Bacteria 7916
155 Ga0075435_100013703 3300007076 Bacteria 6041
156 Ga0075435_100015568 3300007076 Bacteria 5721
157 Ga0075435_100129139 3300007076 Bacteria 2114
158 Ga0111539_10001639 3300009094 Bacteria 29898
159 Ga0111539_10001686 3300009094 Bacteria 29455
160 Ga0111539_10006246 3300009094 Bacteria 15377
161 Ga0111539_10014370 3300009094 Bacteria 9881
162 Ga0111539_10019704 3300009094 Bacteria 8319
163 Ga0111539_10022565 3300009094 Bacteria 7732
164 Ga0111539_10041470 3300009094 Bacteria 5534
165 Ga0111539_10070451 3300009094 Bacteria 4128
166 Ga0111539_10075046 3300009094 Bacteria 3984
167 Ga0111539_10088607 3300009094 Bacteria 3636
168 Ga0111539_10098263 3300009094 Bacteria 3439
169 Ga0111539_10118739 3300009094 Bacteria 3099
170 Ga0105245_10323978 3300009098 Unclassified 1519
171 Ga0114129_10005321 3300009147 Bacteria 18164
172 Ga0114129_10011548 3300009147 Bacteria 12577
173 Ga0114129_10035258 3300009147 Bacteria 7069
174 Ga0114129_10035504 3300009147 Bacteria 7042
175 Ga0114129_10064047 3300009147 Bacteria 5130
176 Ga0114129_10155688 3300009147 Bacteria 3125
177 Ga0114129_10205931 3300009147 Bacteria 2662
178 Ga0105242_10145718 3300009176 Bacteria 2060
179 Ga0105248_10126687 3300009177 Bacteria 2880
180 Ga0105248_10289185 3300009177 Unclassified 1845
181 Ga0105249_10001932 3300009553 Bacteria 17999
182 Ga0105249_10016012 3300009553 Bacteria 6646
183 Ga0157374_10198106 3300013296 Bacteria 1966
184 Ga0163162_10069986 3300013306 Bacteria 3560
185 Ga0157375_10007094 3300013308 Bacteria 9786
186 Ga0157375_10062893 3300013308 Unclassified 3690
187 Ga0157375_10181303 3300013308 Bacteria 2257
188 Ga0157375_10273667 3300013308 Unclassified 1851
189 Ga0163163_10070702 3300014325 Bacteria 3476
190 Ga0163163_10109530 3300014325 Bacteria 2789
191 Ga0157380_10021000 3300014326 Bacteria 4891
192 Ga0157380_10043531 3300014326 Bacteria 3516
193 Ga0157380_10194001 3300014326 Unclassified 1796
194 Ga0157380_10256548 3300014326 Bacteria 1586
195 Ga0157377_10009424 3300014745 Bacteria 4791
196 Ga0157377_10015010 3300014745 Bacteria 3951
197 Ga0157377_10018838 3300014745 Bacteria 3595
198 Ga0157377_10022253 3300014745 Unclassified 3344
199 Ga0157377_10025349 3300014745 Bacteria 3162
200 Ga0157377_10031382 3300014745 Bacteria 2887
201 Ga0157379_10134114 3300014968 Bacteria 2230
202 Ga0207697_10000363 3300025315 Bacteria 25398
203 Ga0207697_10011881 3300025315 Unclassified 3669
204 Ga0207682_10002458 3300025893 Bacteria 8293
205 Ga0207682_10012835 3300025893 Bacteria 3268
206 Ga0207688_10008642 3300025901 Bacteria 5543
207 Ga0207688_10034557 3300025901 Bacteria 2800
208 Ga0207688_10051426 3300025901 Unclassified 2308
209 Ga0207645_10013943 3300025907 Bacteria 5390
210 Ga0207645_10132649 3300025907 Bacteria 1622
211 Ga0207643_10000637 3300025908 Bacteria 21989
212 Ga0207643_10001038 3300025908 Bacteria 16475
213 Ga0207662_10008244 3300025918 Bacteria 5701
214 Ga0207662_10013617 3300025918 Bacteria 4551
215 Ga0207662_10017945 3300025918 Bacteria 4007
216 Ga0207662_10043348 3300025918 Bacteria 2654
217 Ga0207646_10077972 3300025922 Bacteria 2961
218 Ga0207681_10006806 3300025923 Bacteria 7009
219 Ga0207681_10008216 3300025923 Bacteria 6385
220 Ga0207650_10018315 3300025925 Bacteria 4913
221 Ga0207650_10022471 3300025925 Unclassified 4464
222 Ga0207650_10080001 3300025925 Bacteria 2477
223 Ga0207659_10004063 3300025926 Bacteria 8830
224 Ga0207659_10004192 3300025926 Bacteria 8709
225 Ga0207659_10008140 3300025926 Bacteria 6488
226 Ga0207659_10019772 3300025926 Bacteria 4439
227 Ga0207659_10024511 3300025926 Bacteria 4043
228 Ga0207659_10054022 3300025926 Bacteria 2867
229 Ga0207659_10101579 3300025926 Bacteria 2169
230 Ga0207706_10046898 3300025933 Bacteria 3825
231 Ga0207706_10224026 3300025933 Bacteria 1646
232 Ga0207670_10041472 3300025936 Bacteria 3027
233 Ga0207669_10001561 3300025937 Bacteria 9768
234 Ga0207691_10036503 3300025940 Bacteria 4554
235 Ga0207691_10039634 3300025940 Bacteria 4358
236 Ga0207691_10056730 3300025940 Bacteria 3567
237 Ga0207691_10075894 3300025940 Bacteria 3030
238 Ga0207689_10005045 3300025942 Bacteria 11901
239 Ga0207689_10090189 3300025942 Bacteria 2519
240 Ga0207661_10033822 3300025944 Unclassified 3970
241 Ga0207679_10016928 3300025945 Bacteria 4848
242 Ga0207679_10018172 3300025945 Unclassified 4706
243 Ga0207679_10088676 3300025945 Bacteria 2386
244 Ga0207651_10090730 3300025960 Bacteria 2235
245 Ga0207651_10170357 3300025960 Bacteria 1716
246 Ga0207712_10015712 3300025961 Bacteria 4888
247 Ga0207712_10065716 3300025961 Bacteria 2590
248 Ga0207712_10118908 3300025961 Bacteria 1996
249 Ga0207668_10075816 3300025972 Bacteria 2419
250 Ga0207703_10093374 3300026035 Bacteria 2534
251 Ga0207703_10106330 3300026035 Unclassified 2387
252 Ga0207678_10031410 3300026067 Unclassified 4633
253 Ga0207678_10054039 3300026067 Bacteria 3460
254 Ga0207708_10025606 3300026075 Bacteria 4465
255 Ga0207708_10038629 3300026075 Bacteria 3636
256 Ga0207648_10001857 3300026089 Bacteria 23069
257 Ga0207676_10021292 3300026095 Bacteria 4756
258 Ga0207674_10036167 3300026116 Bacteria 5149
259 Ga0207674_10061451 3300026116 Bacteria 3796
260 Ga0207674_10196026 3300026116 Bacteria 1969
261 Ga0207675_100002454 3300026118 Bacteria 18360
262 Ga0207675_100003435 3300026118 Bacteria 15486
263 Ga0207683_10003653 3300026121 Bacteria 13380
264 Ga0207683_10087275 3300026121 Bacteria 2774
265 Ga0207698_10051291 3300026142 Bacteria 3153
266 Ga0207428_10000351 3300027907 Bacteria 59538
267 Ga0207428_10000649 3300027907 Bacteria 40775
268 Ga0207428_10001042 3300027907 Bacteria 30543
269 Ga0207428_10002209 3300027907 Bacteria 19539
270 Ga0207428_10002723 3300027907 Bacteria 17610
271 Ga0207428_10008217 3300027907 Bacteria 9436
272 Ga0207428_10027503 3300027907 Bacteria 4734
273 Ga0268265_10002374 3300028380 Bacteria 14243
274 Ga0268265_10013384 3300028380 Bacteria 5574
275 Ga0307408_100009109 3300031548 Bacteria 6549
276 Ga0307408_100012919 3300031548 Bacteria 5537
277 Ga0307405_10013830 3300031731 Bacteria 4317
278 Ga0307405_10027206 3300031731 Bacteria 3312
279 Ga0307405_10030981 3300031731 Bacteria 3143
280 Ga0307410_10009583 3300031852 Bacteria 5441
281 Ga0307407_10010571 3300031903 Bacteria 4360
282 Ga0307412_10010208 3300031911 Bacteria 5405
283 Ga0307409_100005295 3300031995 Bacteria 7401
284 Ga0307409_100131530 3300031995 Bacteria 2139
285 Ga0307416_100007648 3300032002 Bacteria 6895
286 Ga0307416_100024041 3300032002 Bacteria 4437
287 Ga0307411_10001143 3300032005 Bacteria 10401
288 Ga0307415_100006389 3300032126 Bacteria 6350
289 Ga0439453_0003333 3300041408 Bacteria 2304
290 Ga0451577_0044237 3300042876 Unclassified 3987
291 Ga0451576_0003586 3300045051 Bacteria 21106
292 Ga0451576_0037430 3300045051 Bacteria 5140
293 Ga0451576_0061088 3300045051 Bacteria 3930
294 Ga0451576_0087346 3300045051 Unclassified 3243
295 Ga0495598_0037675 3300046537 Bacteria 1396
296 Ga0495656_0030134 3300046615 Unclassified 2191
297 Ga0495659_0001709 3300046664 Bacteria 7328
298 Ga0495588_0014553 3300046674 Unclassified 3767
299 Ga0495636_0006972 3300047318 Unclassified 4447
300 Ga0495685_024879 3300047447 Bacteria 2061
301 Ga0496104_0013846 3300048907 Bacteria 7277
302 Ga0496108_0002620 3300048911 Bacteria 14405
303 Ga0496108_0171100 3300048911 Bacteria 1879
304 Ga0496109_0001022 3300048912 Bacteria 23125
305 Ga0496110_0042293 3300048913 Unclassified 3977
306 Ga0496112_0006693 3300048915 Bacteria 10149
307 Ga0501036_0172167 3300049572 Bacteria 1824
308 Ga0501036_0174719 3300049572 Bacteria 1809
309 Ga0501038_0028699 3300049574 Bacteria 4942
310 Ga0501038_0225423 3300049574 Bacteria 1494
311 Ga0501039_0019602 3300049575 Bacteria 5187
312 Ga0501039_0088929 3300049575 Bacteria 2406
313 Ga0501040_0015542 3300049576 Bacteria 5030
314 Ga0501041_0007333 3300049577 Bacteria 6470
315 Ga0501041_0070755 3300049577 Unclassified 2142
316 Ga0501042_0005630 3300049578 Bacteria 8080
317 Ga0501042_0020052 3300049578 Bacteria 4651
318 Ga0501046_0081258 3300049580 Bacteria 2503
319 Ga0501068_0096230 3300049584 Bacteria 1831
320 Ga0501071_0038263 3300049587 Bacteria 3428
321 Ga0501072_0008069 3300049588 Bacteria 7993
322 Ga0501072_0029971 3300049588 Bacteria 4252
323 Ga0501072_0062393 3300049588 Unclassified 2940
324 Ga0501072_0064525 3300049588 Unclassified 2888
325 Ga0501072_0213342 3300049588 Bacteria 1538
326 Ga0501074_0060840 3300049590 Bacteria 2721
327 Ga0501074_0143133 3300049590 Bacteria 1710
328 Ga0501075_0011205 3300049591 Bacteria 6340
329 Ga0501075_0027972 3300049591 Bacteria 4158
330 Ga0501075_0063018 3300049591 Bacteria 2795
331 Ga0501076_0011829 3300049592 Bacteria 6516
332 Ga0501076_0018571 3300049592 Bacteria 5304
333 Ga0501076_0035897 3300049592 Bacteria 3881
334 Ga0501079_0022006 3300049741 Bacteria 4884
335 Ga0501079_0173942 3300049741 Bacteria 1679
336 Ga0501080_0054045 3300049742 Bacteria 3740
337 Ga0501083_0070141 3300049744 Unclassified 2331
338 Ga0501045_0034486 3300049824 Bacteria 3674
339 Ga0501045_0055025 3300049824 Bacteria 2910
340 nmdc:mga05p37_121256_c1 3300050507 Bacteria 3212
341 nmdc:mga05p37_139311_c1 3300050507 Bacteria 2973
342 nmdc:mga05p37_15096_c1 3300050507 Bacteria 9273
343 nmdc:mga05p37_179717_c1 3300050507 Bacteria 2575
344 nmdc:mga05p37_26387_c1 3300050507 Bacteria 7065
345 nmdc:mga05p37_266331_c1 3300050507 Bacteria 2049
346 nmdc:mga05p37_3974_c1 3300050507 Bacteria 17307
347 nmdc:mga05p37_49391_c1 3300050507 Bacteria 5174
348 nmdc:mga05p37_62198_c1 3300050507 Bacteria 4142
349 nmdc:mga05p37_66350_c1 3300050507 Bacteria 4439
350 nmdc:mga09592_123481_c1 3300050508 Unclassified 2225
351 nmdc:mga09592_154298_c1 3300050508 Bacteria 1982
352 nmdc:mga09592_1662_c1 3300050508 Bacteria 17911
353 nmdc:mga09592_395_c2 3300050508 Bacteria 28310
354 nmdc:mga09592_44207_c1 3300050508 Unclassified 3749
355 nmdc:mga09592_70362_c1 3300050508 Bacteria 2969
356 nmdc:mga09592_91708_c1 3300050508 Bacteria 2596
357 nmdc:mga0qj67_13784_c1 3300050509 Bacteria 6101
358 nmdc:mga0qj67_24057_c1 3300050509 Bacteria 4693
359 nmdc:mga0qj67_242484_c1 3300050509 Bacteria 1462
360 nmdc:mga0qj67_2427_c1 3300050509 Bacteria 13268
361 nmdc:mga0qj67_26264_c1 3300050509 Bacteria 4508
362 nmdc:mga0qj67_2993_c1 3300050509 Bacteria 12125
363 nmdc:mga0qj67_32499_c1 3300050509 Bacteria 4069
364 nmdc:mga06r32_1347_c1 3300050510 Bacteria 22152
365 nmdc:mga06r32_278028_c1 3300050510 Unclassified 1661
366 nmdc:mga06r32_28104_c1 3300050510 Bacteria 5260
367 nmdc:mga06r32_35955_c1 3300050510 Unclassified 4676
368 nmdc:mga06r32_36568_c1 3300050510 Bacteria 4641
369 nmdc:mga06r32_46435_c1 3300050510 Bacteria 4144
370 nmdc:mga06r32_4882_c1 3300050510 Bacteria 12079
371 nmdc:mga06r32_8200_c1 3300050510 Bacteria 9403
372 nmdc:mga06r32_89975_c1 3300050510 Bacteria 2998
373 nmdc:mga08y16_113347_c1 3300050511 Bacteria 2823
374 nmdc:mga08y16_13519_c1 3300050511 Bacteria 8589
375 nmdc:mga08y16_14522_c1 3300050511 Bacteria 8286
376 nmdc:mga08y16_1522_c1 3300050511 Bacteria 23323
377 nmdc:mga08y16_24449_c1 3300050511 Bacteria 6376
378 nmdc:mga08y16_2804_c2 3300050511 Bacteria 11050
379 nmdc:mga08y16_34014_c1 3300050511 Bacteria 5354
380 nmdc:mga08y16_52367_c1 3300050511 Bacteria 4271
381 nmdc:mga08y16_56388_c1 3300050511 Bacteria 4107
382 nmdc:mga0n895_124640_c1 3300050512 Bacteria 2599
383 nmdc:mga0n895_143056_c1 3300050512 Unclassified 2421
384 nmdc:mga0n895_18212_c1 3300050512 Bacteria 6493
385 nmdc:mga0n895_40022_c1 3300050512 Bacteria 4553
386 nmdc:mga0n895_6608_c1 3300050512 Bacteria 9871
387 nmdc:mga0n895_7309_c1 3300050512 Bacteria 9468
388 nmdc:mga0n895_83949_c1 3300050512 Bacteria 3178
389 nmdc:mga0rr50_4528_c1 3300050513 Bacteria 8185
390 nmdc:mga0a205_137892_c1 3300050515 Bacteria 2339
391 nmdc:mga0a205_14436_c1 3300050515 Bacteria 7367
392 nmdc:mga0a205_2302_c1 3300050515 Bacteria 16855
393 nmdc:mga0a205_320_c1 3300050515 Bacteria 35863
394 nmdc:mga0a205_34957_c1 3300050515 Unclassified 2824
395 nmdc:mga0a205_627_c1 3300050515 Bacteria 28069
396 nmdc:mga0a205_71930_c1 3300050515 Bacteria 3340
397 nmdc:mga0a205_87581_c1 3300050515 Bacteria 3009
398 nmdc:mga0a205_9298_c1 3300050515 Bacteria 8976
399 Ga0501084_0062504 3300054114 Bacteria 3117
400 Ga0590071_002945 3300059421 Bacteria 4230
401 Ga0501082_0023826 3300060353 Bacteria 5278
402 Ga0501082_0140630 3300060353 Unclassified 2095
403 Ga0501082_0186580 3300060353 Bacteria 1804
404 Ga0530510_0002330 3300061734 Bacteria 13036
405 Ga0530510_0006656 3300061734 Bacteria 8059
406 Ga0530510_0008167 3300061734 Bacteria 7301
407 Ga0530510_0047676 3300061734 Bacteria 3096
408 Ga0530510_0131098 3300061734 Bacteria 1844
409 Ga0070688_100011534
410 Ga0065704_10075061
411 Ga0065704_10090839
412 Ga0065712_10015575
413 Ga0065712_10067909
414 Ga0065712_10068677
415 Ga0065712_10069251
416 Ga0065707_10002135
417 Ga0065707_10087185
418 Ga0070676_10009187
419 Ga0070670_100027558
420 Ga0070670_100090811
421 Ga0070666_10099339
422 Ga0068868_100030364
423 Ga0070689_100014235
424 Ga0070689_100039268
425 Ga0070687_100004759
426 Ga0070669_100000378
427 Ga0070669_100001379
428 Ga0070675_100002152
429 Ga0070675_100003596
430 Ga0070675_100011666
431 Ga0070675_100026765
432 Ga0070675_100033624
433 Ga0070675_100038438
434 Ga0070675_100044976
435 Ga0070674_100007790
436 Ga0070673_100034776
437 Ga0070688_100009750
438 Ga0070659_100042878
439 Ga0070667_100008327
440 Ga0070701_10005380
441 Ga0070701_10020739
442 Ga0070705_100064040
443 Ga0070700_100012562
444 Ga0070700_100021095
445 Ga0070700_100047835
446 Ga0070694_100002356
447 Ga0070708_100126467
448 Ga0070662_100029546
449 Ga0070662_100086002
450 Ga0068867_100026808
451 Ga0070685_10003309
452 Ga0070685_10007909
453 Ga0070707_100013059
454 Ga0070698_100010609
455 Ga0070698_100084436
456 Ga0070698_100103115
457 Ga0070699_100001167
458 Ga0070699_100007128
459 Ga0070699_100018376
460 Ga0070684_100003173
461 Ga0070697_100015884
462 Ga0070672_100012198
463 Ga0070672_100018593
464 Ga0070672_100156407
465 Ga0070686_100108089
466 Ga0070695_100000310
467 Ga0070695_100114826
468 Ga0070696_100000106
469 Ga0070696_100010693
470 Ga0070696_100028486
471 Ga0070696_100037673
472 Ga0070704_100002804
473 Ga0070704_100003593
474 Ga0070704_100007155
475 Ga0070664_100001164
476 Ga0070664_100002714
477 Ga0070664_100064641
478 Ga0070664_100123926
479 Ga0068857_100028567
480 Ga0070702_100015726
481 Ga0068859_100000705
482 Ga0068859_100002900
483 Ga0068859_100052624
484 Ga0068859_100059218
485 Ga0068859_100061275
486 Ga0068864_100028712
487 Ga0068864_100029994
488 Ga0068861_100002762
489 Ga0068870_10004239
490 Ga0068870_10006732
491 Ga0068870_10012037
492 Ga0068863_100023314
493 Ga0068863_100133393
494 Ga0068863_100197720
495 Ga0068858_100035854
496 Ga0068862_100000408
497 Ga0068862_100006706
498 Ga0068862_100024827
499 Ga0068862_100104519
500 Ga0068871_100038724
501 Ga0075428_100001453
502 Ga0075428_100001462
503 Ga0075428_100001727
504 Ga0075428_100001787
505 Ga0075428_100008874
506 Ga0075428_100009227
507 Ga0075428_100010559
508 Ga0075428_100036647
509 Ga0075428_100038507
510 Ga0075428_100041204
511 Ga0075428_100041259
512 Ga0075428_100069822
513 Ga0075428_100070386
514 Ga0075428_100128651
515 Ga0075428_100142726
516 Ga0075430_100009704
517 Ga0075430_100012071
518 Ga0075430_100014628
519 Ga0075430_100026954
520 Ga0075430_100037668
521 Ga0075430_100059128
522 Ga0075430_100070687
523 Ga0075431_100000722
524 Ga0075431_100000913
525 Ga0075431_100001873
526 Ga0075431_100008792
527 Ga0075431_100015845
528 Ga0075431_100020638
529 Ga0075431_100036652
530 Ga0075431_100044617
531 Ga0075431_100046944
532 Ga0075431_100140428
533 Ga0075431_100158744
534 Ga0075433_10004080
535 Ga0075433_10005616
536 Ga0075433_10007720
537 Ga0075433_10020989
538 Ga0075433_10031847
539 Ga0075433_10074401
540 Ga0075433_10114681
541 Ga0075434_100002065
542 Ga0075434_100008041
543 Ga0075434_100010218
544 Ga0075434_100016302
545 Ga0075434_100019389
546 Ga0075434_100027372
547 Ga0075434_100050410
548 Ga0075434_100092711
549 Ga0075429_100002032
550 Ga0075429_100014556
551 Ga0075429_100014828
552 Ga0075429_100033924
553 Ga0075429_100075756
554 Ga0075429_100088761
555 Ga0068865_100064185
556 Ga0097620_100000705
557 Ga0097620_100002900
558 Ga0097620_100052622
559 Ga0097620_100059219
560 Ga0097620_100061275
561 Ga0097620_100180220
562 Ga0075435_100007192
563 Ga0075435_100013703
564 Ga0075435_100015568
565 Ga0075435_100129139
566 Ga0111539_10001639
567 Ga0111539_10001686
568 Ga0111539_10006246
569 Ga0111539_10014370
570 Ga0111539_10019704
571 Ga0111539_10022565
572 Ga0111539_10041470
573 Ga0111539_10070451
574 Ga0111539_10075046
575 Ga0111539_10088607
576 Ga0111539_10098263
577 Ga0111539_10118739
578 Ga0105245_10323978
579 Ga0114129_10005321
580 Ga0114129_10011548
581 Ga0114129_10035258
582 Ga0114129_10035504
583 Ga0114129_10064047
584 Ga0114129_10155688
585 Ga0114129_10205931
586 Ga0105242_10145718
587 Ga0105248_10126687
588 Ga0105248_10289185
589 Ga0105249_10001932
590 Ga0105249_10016012
591 Ga0157374_10198106
592 Ga0163162_10069986
593 Ga0157375_10007094
594 Ga0157375_10062893
595 Ga0157375_10181303
596 Ga0157375_10273667
597 Ga0163163_10070702
598 Ga0163163_10109530
599 Ga0157380_10021000
600 Ga0157380_10043531
601 Ga0157380_10194001
602 Ga0157380_10256548
603 Ga0157377_10009424
604 Ga0157377_10015010
605 Ga0157377_10018838
606 Ga0157377_10022253
607 Ga0157377_10025349
608 Ga0157377_10031382
609 Ga0157379_10134114
610 Ga0207697_10000363
611 Ga0207697_10011881
612 Ga0207682_10002458
613 Ga0207682_10012835
614 Ga0207688_10008642
615 Ga0207688_10034557
616 Ga0207688_10051426
617 Ga0207645_10013943
618 Ga0207645_10132649
619 Ga0207643_10000637
620 Ga0207643_10001038
621 Ga0207662_10008244
622 Ga0207662_10013617
623 Ga0207662_10017945
624 Ga0207662_10043348
625 Ga0207646_10077972
626 Ga0207681_10006806
627 Ga0207681_10008216
628 Ga0207650_10018315
629 Ga0207650_10022471
630 Ga0207650_10080001
631 Ga0207659_10004063
632 Ga0207659_10004192
633 Ga0207659_10008140
634 Ga0207659_10019772
635 Ga0207659_10024511
636 Ga0207659_10054022
637 Ga0207659_10101579
638 Ga0207706_10046898
639 Ga0207706_10224026
640 Ga0207670_10041472
641 Ga0207669_10001561
642 Ga0207691_10036503
643 Ga0207691_10039634
644 Ga0207691_10056730
645 Ga0207691_10075894
646 Ga0207689_10005045
647 Ga0207689_10090189
648 Ga0207661_10033822
649 Ga0207679_10016928
650 Ga0207679_10018172
651 Ga0207679_10088676
652 Ga0207651_10090730
653 Ga0207651_10170357
654 Ga0207712_10015712
655 Ga0207712_10065716
656 Ga0207712_10118908
657 Ga0207668_10075816
658 Ga0207703_10093374
659 Ga0207703_10106330
660 Ga0207678_10031410
661 Ga0207678_10054039
662 Ga0207708_10025606
663 Ga0207708_10038629
664 Ga0207648_10001857
665 Ga0207676_10021292
666 Ga0207674_10036167
667 Ga0207674_10061451
668 Ga0207674_10196026
669 Ga0207675_100002454
670 Ga0207675_100003435
671 Ga0207683_10003653
672 Ga0207683_10087275
673 Ga0207698_10051291
674 Ga0207428_10000351
675 Ga0207428_10000649
676 Ga0207428_10001042
677 Ga0207428_10002209
678 Ga0207428_10002723
679 Ga0207428_10008217
680 Ga0207428_10027503
681 Ga0268265_10002374
682 Ga0268265_10013384
683 Ga0307408_100009109
684 Ga0307408_100012919
685 Ga0307405_10013830
686 Ga0307405_10027206
687 Ga0307405_10030981
688 Ga0307410_10009583
689 Ga0307407_10010571
690 Ga0307412_10010208
691 Ga0307409_100005295
692 Ga0307409_100131530
693 Ga0307416_100007648
694 Ga0307416_100024041
695 Ga0307411_10001143
696 Ga0307415_100006389
697 Ga0439453_0003333
698 Ga0451577_0044237
699 Ga0451576_0003586
700 Ga0451576_0037430
701 Ga0451576_0061088
702 Ga0451576_0087346
703 Ga0495598_0037675
704 Ga0495656_0030134
705 Ga0495659_0001709
706 Ga0495588_0014553
707 Ga0495636_0006972
708 Ga0495685_024879
709 Ga0496104_0013846
710 Ga0496108_0002620
711 Ga0496108_0171100
712 Ga0496109_0001022
713 Ga0496110_0042293
714 Ga0496112_0006693
715 Ga0501036_0172167
716 Ga0501036_0174719
717 Ga0501038_0028699
718 Ga0501038_0225423
719 Ga0501039_0019602
720 Ga0501039_0088929
721 Ga0501040_0015542
722 Ga0501041_0007333
723 Ga0501041_0070755
724 Ga0501042_0005630
725 Ga0501042_0020052
726 Ga0501046_0081258
727 Ga0501068_0096230
728 Ga0501071_0038263
729 Ga0501072_0008069
730 Ga0501072_0029971
731 Ga0501072_0062393
732 Ga0501072_0064525
733 Ga0501072_0213342
734 Ga0501074_0060840
735 Ga0501074_0143133
736 Ga0501075_0011205
737 Ga0501075_0027972
738 Ga0501075_0063018
739 Ga0501076_0011829
740 Ga0501076_0018571
741 Ga0501076_0035897
742 Ga0501079_0022006
743 Ga0501079_0173942
744 Ga0501080_0054045
745 Ga0501083_0070141
746 Ga0501045_0034486
747 Ga0501045_0055025
748 nmdc:mga05p37_121256_c1
749 nmdc:mga05p37_139311_c1
750 nmdc:mga05p37_15096_c1
751 nmdc:mga05p37_179717_c1
752 nmdc:mga05p37_26387_c1
753 nmdc:mga05p37_266331_c1
754 nmdc:mga05p37_3974_c1
755 nmdc:mga05p37_49391_c1
756 nmdc:mga05p37_62198_c1
757 nmdc:mga05p37_66350_c1
758 nmdc:mga09592_123481_c1
759 nmdc:mga09592_154298_c1
760 nmdc:mga09592_1662_c1
761 nmdc:mga09592_395_c2
762 nmdc:mga09592_44207_c1
763 nmdc:mga09592_70362_c1
764 nmdc:mga09592_91708_c1
765 nmdc:mga0qj67_13784_c1
766 nmdc:mga0qj67_24057_c1
767 nmdc:mga0qj67_242484_c1
768 nmdc:mga0qj67_2427_c1
769 nmdc:mga0qj67_26264_c1
770 nmdc:mga0qj67_2993_c1
771 nmdc:mga0qj67_32499_c1
772 nmdc:mga06r32_1347_c1
773 nmdc:mga06r32_278028_c1
774 nmdc:mga06r32_28104_c1
775 nmdc:mga06r32_35955_c1
776 nmdc:mga06r32_36568_c1
777 nmdc:mga06r32_46435_c1
778 nmdc:mga06r32_4882_c1
779 nmdc:mga06r32_8200_c1
780 nmdc:mga06r32_89975_c1
781 nmdc:mga08y16_113347_c1
782 nmdc:mga08y16_13519_c1
783 nmdc:mga08y16_14522_c1
784 nmdc:mga08y16_1522_c1
785 nmdc:mga08y16_24449_c1
786 nmdc:mga08y16_2804_c2
787 nmdc:mga08y16_34014_c1
788 nmdc:mga08y16_52367_c1
789 nmdc:mga08y16_56388_c1
790 nmdc:mga0n895_124640_c1
791 nmdc:mga0n895_143056_c1
792 nmdc:mga0n895_18212_c1
793 nmdc:mga0n895_40022_c1
794 nmdc:mga0n895_6608_c1
795 nmdc:mga0n895_7309_c1
796 nmdc:mga0n895_83949_c1
797 nmdc:mga0rr50_4528_c1
798 nmdc:mga0a205_137892_c1
799 nmdc:mga0a205_14436_c1
800 nmdc:mga0a205_2302_c1
801 nmdc:mga0a205_320_c1
802 nmdc:mga0a205_34957_c1
803 nmdc:mga0a205_627_c1
804 nmdc:mga0a205_71930_c1
805 nmdc:mga0a205_87581_c1
806 nmdc:mga0a205_9298_c1
807 Ga0501084_0062504
808 Ga0590071_002945
809 Ga0501082_0023826
810 Ga0501082_0140630
811 Ga0501082_0186580
812 Ga0530510_0002330
813 Ga0530510_0006656
814 Ga0530510_0008167
815 Ga0530510_0047676
816 Ga0530510_0131098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uz3-assembly3.cif.gz_C crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl-chitohexaose 0.7535 347 391
7eyb-assembly1.cif.gz_J core proteins 0.7503 168 265
4xcm-assembly1.cif.gz_B crystal structure of the putative nlpc/p60 d,l endopeptidase from t. thermophilus 0.7474 347 390
4oxv-assembly1.cif.gz_A crystal structure of mltf from pseudomonas aeruginosa complexed with valine 0.7407 160 337
4oz9-assembly1.cif.gz_A crystal structure of mltf from pseudomonas aeruginosa complexed with isoleucine 0.7357 160 337
ID Description Score Start End Superfamily
4uz3C00 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.7535 347 391 3.10.350.10
af_C0PJ37_1_183_3.10.350.10 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.742 345 389 3.10.350.10
af_A0A0R0GJZ6_1_72_3.10.350.10 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.7212 343 389 3.10.350.10
af_P0AEZ7_97_250_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7187 163 335 1.10.530.10
4uz3C00 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.718 347 391 3.10.350.10
ID Description Score Start End GO Terms
AF-A0A7Y4WRA5-F1-model_v4 Transglycosylase SLT domain-containing protein 0.9757 56 471
AF-A0A7Y2MVP0-F1-model_v4 Transglycosylase SLT domain-containing protein 0.9393 56 471
AF-A0A2V8DTH6-F1-model_v4 Transglycosylase SLT domain-containing protein 0.9177 31 471
AF-A0A7Y3DCH7-F1-model_v4 Transglycosylase SLT domain-containing protein 0.9062 56 272
AF-A0A7Y4SJQ7-F1-model_v4 Transglycosylase SLT domain-containing protein 0.9056 27 475

Map