F436486

General Info

Members Datasets Scaffolds Average Seq Length
407 216 814 317

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10052384|Ga0207677_100523842
Length 355
Sequence MSLARGPATKARKKKAEPRVSRNRHPATTRRVASRSTGASSAEXXAALALPRDVDNVEVRLGPRSVRLTNLRKLFWPELGLTKGDLIQYYADVSPWLLPHIHDRAMVMKRYPHGAAGEFFFMKRAPTPRPDWIEICAIEHESGNVIDFPMIQDLPSLLWVINLGCIDLNQWYARCDDVDRPDYVHFDLDPVKGRTPVPFERVRETALIVHSGLEALGMPAYAKTTGSRGIHVYVPIVRGPTQKDVWSFAKRFAEGLAALHPSVITAEYRISSRPQGRVLVDYNQNAWGRTLASIYSVRPHPQAAVSTPVGWDEIEAGITIEQFTVRNVPARIRERGDLWAPLLSMKGRFRLEKYL

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 2.21
Rhizosphere 92.87
Stem 0
Stem Tuber 0
Unclassified 13.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10052384 3300026023 Bacteria 2772
2 CNAas_1000091 3300000532 Bacteria 7053
3 JGI24746J21847_1004464 3300001977 Bacteria 2204
4 Ga0065712_10000644 3300005290 Bacteria 9844
5 Ga0065712_10149439 3300005290 Unclassified 1382
6 Ga0065715_10009971 3300005293 Bacteria 3716
7 Ga0065715_10039053 3300005293 Unclassified 1143
8 Ga0065715_10159699 3300005293 Unclassified 1639
9 Ga0065707_10084466 3300005295 Bacteria 7172
10 Ga0065707_10097547 3300005295 Bacteria 3165
11 Ga0065707_10227900 3300005295 Unclassified 1199
12 Ga0065707_10237230 3300005295 Bacteria 1168
13 Ga0070658_10014582 3300005327 Bacteria 6307
14 Ga0070683_100000122 3300005329 Bacteria 50833
15 Ga0070690_100007979 3300005330 Bacteria 6076
16 Ga0070690_100067563 3300005330 Bacteria 2316
17 Ga0070690_100163826 3300005330 Bacteria 1526
18 Ga0070670_100360292 3300005331 Bacteria 1279
19 Ga0070677_10001941 3300005333 Bacteria 6558
20 Ga0068869_100007550 3300005334 Bacteria 6960
21 Ga0068869_100028964 3300005334 Bacteria 3875
22 Ga0070666_10001475 3300005335 Bacteria 14276
23 Ga0070666_10038357 3300005335 Bacteria 3187
24 Ga0070680_100070568 3300005336 Bacteria 2869
25 Ga0068868_100085035 3300005338 Bacteria 2541
26 Ga0068868_100134080 3300005338 Bacteria 2029
27 Ga0070689_100268229 3300005340 Unclassified 1412
28 Ga0070689_100271325 3300005340 Bacteria 1404
29 Ga0070691_10067523 3300005341 Unclassified 1730
30 Ga0070687_100003542 3300005343 Bacteria 6079
31 Ga0070661_100032912 3300005344 Bacteria 3754
32 Ga0070692_10123446 3300005345 Unclassified 1447
33 Ga0070668_100311085 3300005347 Bacteria 1324
34 Ga0070669_100026011 3300005353 Bacteria 4209
35 Ga0070669_100093354 3300005353 Bacteria 2260
36 Ga0070669_100233719 3300005353 Bacteria 1458
37 Ga0070675_100007840 3300005354 Bacteria 8275
38 Ga0070675_100059666 3300005354 Bacteria 3148
39 Ga0070675_100070493 3300005354 Bacteria 2897
40 Ga0070675_100105990 3300005354 Bacteria 2372
41 Ga0070675_100191266 3300005354 Bacteria 1773
42 Ga0070671_100022132 3300005355 Bacteria 5193
43 Ga0070673_100007497 3300005364 Bacteria 7204
44 Ga0070673_100008711 3300005364 Bacteria 6767
45 Ga0070673_100011429 3300005364 Bacteria 6056
46 Ga0070667_100000383 3300005367 Bacteria 48188
47 Ga0070667_100202761 3300005367 Bacteria 1760
48 Ga0070714_100048616 3300005435 Bacteria 3608
49 Ga0070714_100354376 3300005435 Unclassified 1379
50 Ga0070701_10014460 3300005438 Bacteria 3620
51 Ga0070705_100000288 3300005440 Bacteria 30044
52 Ga0070700_100001687 3300005441 Bacteria 11080
53 Ga0070700_100076804 3300005441 Bacteria 2146
54 Ga0070694_100001669 3300005444 Bacteria 13048
55 Ga0070694_100022657 3300005444 Bacteria 4028
56 Ga0070694_100253508 3300005444 Bacteria 1332
57 Ga0070708_100007723 3300005445 Bacteria 8616
58 Ga0070708_100013378 3300005445 Bacteria 6716
59 Ga0070678_100007093 3300005456 Bacteria 6626
60 Ga0070678_100083314 3300005456 Bacteria 2431
61 Ga0070678_100269018 3300005456 Unclassified 1436
62 Ga0070662_100005489 3300005457 Bacteria 8107
63 Ga0070681_10006500 3300005458 Bacteria 11376
64 Ga0068867_100015273 3300005459 Bacteria 5443
65 Ga0068867_100029139 3300005459 Bacteria 3977
66 Ga0070685_10003010 3300005466 Bacteria 8594
67 Ga0070706_100002200 3300005467 Bacteria 19848
68 Ga0070706_100011296 3300005467 Bacteria 8297
69 Ga0070706_100239917 3300005467 Unclassified 1692
70 Ga0070707_100017511 3300005468 Bacteria 6738
71 Ga0070707_100029730 3300005468 Bacteria 5200
72 Ga0070707_100240345 3300005468 Bacteria 1763
73 Ga0070698_100000635 3300005471 Bacteria 37856
74 Ga0070698_100021130 3300005471 Bacteria 6819
75 Ga0070679_100023973 3300005530 Bacteria 5978
76 Ga0070684_100000125 3300005535 Bacteria 50833
77 Ga0070697_100000925 3300005536 Bacteria 22078
78 Ga0070672_100000609 3300005543 Bacteria 21040
79 Ga0070672_100010306 3300005543 Bacteria 6478
80 Ga0070686_100072254 3300005544 Bacteria 2261
81 Ga0070686_100252142 3300005544 Bacteria 1289
82 Ga0070695_100003344 3300005545 Bacteria 9369
83 Ga0070696_100001518 3300005546 Bacteria 15229
84 Ga0070696_100024998 3300005546 Bacteria 4059
85 Ga0070693_100084185 3300005547 Bacteria 1903
86 Ga0070665_100050416 3300005548 Bacteria 4177
87 Ga0070704_100000802 3300005549 Bacteria 15581
88 Ga0070704_100012166 3300005549 Bacteria 5310
89 Ga0070704_100126342 3300005549 Bacteria 1974
90 Ga0070704_100265520 3300005549 Unclassified 1416
91 Ga0068855_100214082 3300005563 Bacteria 2164
92 Ga0070664_100009155 3300005564 Bacteria 8040
93 Ga0068857_100002247 3300005577 Bacteria 15713
94 Ga0068856_100013892 3300005614 Bacteria 7788
95 Ga0070702_100011696 3300005615 Bacteria 4373
96 Ga0068852_100069898 3300005616 Bacteria 3079
97 Ga0068852_100137252 3300005616 Bacteria 2259
98 Ga0068852_100517074 3300005616 Bacteria 1191
99 Ga0068859_100008626 3300005617 Bacteria 10300
100 Ga0068859_100026181 3300005617 Bacteria 5850
101 Ga0068859_100132451 3300005617 Unclassified 2565
102 Ga0068859_100199815 3300005617 Unclassified 2084
103 Ga0068864_100071351 3300005618 Bacteria 3024
104 Ga0068864_100172352 3300005618 Unclassified 1974
105 Ga0068861_100081589 3300005719 Bacteria 2532
106 Ga0068861_100180092 3300005719 Bacteria 1758
107 Ga0068861_100318974 3300005719 Unclassified 1353
108 Ga0068870_10006109 3300005840 Bacteria 5293
109 Ga0068870_10035498 3300005840 Bacteria 2559
110 Ga0068870_10133719 3300005840 Bacteria 1443
111 Ga0068863_100015500 3300005841 Bacteria 7326
112 Ga0068858_100031746 3300005842 Bacteria 4908
113 Ga0068858_100045861 3300005842 Bacteria 4052
114 Ga0068858_100064390 3300005842 Bacteria 3393
115 Ga0068858_100441562 3300005842 Unclassified 1253
116 Ga0068860_100004726 3300005843 Bacteria 13885
117 Ga0068860_100053510 3300005843 Bacteria 3838
118 Ga0068860_100068275 3300005843 Bacteria 3377
119 Ga0068860_100077694 3300005843 Bacteria 3157
120 Ga0068860_100118501 3300005843 Bacteria 2534
121 Ga0068862_100152850 3300005844 Bacteria 2055
122 Ga0075365_10026343 3300006038 Bacteria 3690
123 Ga0075365_10102952 3300006038 Bacteria 1956
124 Ga0075363_100068795 3300006048 Bacteria 1920
125 Ga0075364_10021016 3300006051 Bacteria 4111
126 Ga0070716_100114866 3300006173 Bacteria 1675
127 Ga0075367_10007502 3300006178 Bacteria 5590
128 Ga0075367_10167056 3300006178 Bacteria 1370
129 Ga0097621_100004416 3300006237 Bacteria 9788
130 Ga0097621_100016899 3300006237 Bacteria 5530
131 Ga0068871_100006917 3300006358 Bacteria 8080
132 Ga0068871_100027133 3300006358 Bacteria 4476
133 Ga0068871_100233197 3300006358 Bacteria 1598
134 Ga0075428_100016154 3300006844 Bacteria 8253
135 Ga0075428_100018389 3300006844 Bacteria 7726
136 Ga0075428_100475301 3300006844 Bacteria 1338
137 Ga0075430_100014486 3300006846 Bacteria 6716
138 Ga0075430_100020148 3300006846 Bacteria 5675
139 Ga0075430_100023429 3300006846 Bacteria 5255
140 Ga0075430_100035436 3300006846 Bacteria 4233
141 Ga0075430_100082437 3300006846 Bacteria 2695
142 Ga0075430_100215791 3300006846 Bacteria 1592
143 Ga0075431_100007412 3300006847 Bacteria 10923
144 Ga0075431_100023686 3300006847 Bacteria 6285
145 Ga0075431_100107156 3300006847 Bacteria 2883
146 Ga0075431_100191118 3300006847 Unclassified 2097
147 Ga0075433_10006049 3300006852 Bacteria 9532
148 Ga0075433_10028300 3300006852 Bacteria 4763
149 Ga0075433_10046065 3300006852 Bacteria 3791
150 Ga0075433_10122506 3300006852 Bacteria 2309
151 Ga0075429_100024138 3300006880 Bacteria 5273
152 Ga0075429_100033047 3300006880 Unclassified 4495
153 Ga0075429_100088393 3300006880 Bacteria 2701
154 Ga0075429_100202532 3300006880 Bacteria 1739
155 Ga0075429_100220835 3300006880 Bacteria 1660
156 Ga0068865_100121938 3300006881 Unclassified 1940
157 Ga0097620_100008626 3300006931 Bacteria 10300
158 Ga0097620_100026181 3300006931 Bacteria 5850
159 Ga0097620_100132442 3300006931 Unclassified 2565
160 Ga0097620_100199809 3300006931 Unclassified 2084
161 Ga0075435_100033094 3300007076 Bacteria 4086
162 Ga0099794_10044929 3300007265 Bacteria 2112
163 Ga0111539_10000712 3300009094 Bacteria 43173
164 Ga0111539_10003084 3300009094 Bacteria 22086
165 Ga0111539_10005282 3300009094 Bacteria 16724
166 Ga0111539_10078083 3300009094 Bacteria 3896
167 Ga0111539_10086722 3300009094 Bacteria 3678
168 Ga0111539_10234993 3300009094 Unclassified 2134
169 Ga0111539_10238426 3300009094 Bacteria 2117
170 Ga0111539_10284917 3300009094 Bacteria 1923
171 Ga0111539_10613550 3300009094 Bacteria 1267
172 Ga0105245_10110961 3300009098 Bacteria 2550
173 Ga0114129_10008510 3300009147 Bacteria 14623
174 Ga0114129_10034405 3300009147 Bacteria 7157
175 Ga0114129_10045868 3300009147 Bacteria 6143
176 Ga0114129_10049166 3300009147 Bacteria 5927
177 Ga0114129_10182009 3300009147 Bacteria 2859
178 Ga0105243_10024251 3300009148 Bacteria 4626
179 Ga0105243_10137911 3300009148 Bacteria 2078
180 Ga0105241_10156283 3300009174 Unclassified 1870
181 Ga0105242_10034886 3300009176 Bacteria 4033
182 Ga0105242_10118655 3300009176 Bacteria 2266
183 Ga0105248_10001906 3300009177 Bacteria 23137
184 Ga0105248_10097742 3300009177 Bacteria 3308
185 Ga0105248_10222987 3300009177 Bacteria 2122
186 Ga0105239_10387546 3300010375 Unclassified 1580
187 Ga0105246_10016281 3300011119 Bacteria 4707
188 Ga0157378_10002596 3300013297 Bacteria 16085
189 Ga0163162_10030754 3300013306 Bacteria 5321
190 Ga0163162_10090070 3300013306 Bacteria 3149
191 Ga0163162_10264239 3300013306 Bacteria 1852
192 Ga0157375_10002833 3300013308 Bacteria 15013
193 Ga0157375_10034533 3300013308 Bacteria 4819
194 Ga0157375_10458998 3300013308 Bacteria 1439
195 Ga0157375_10463902 3300013308 Bacteria 1432
196 Ga0157375_10583990 3300013308 Unclassified 1277
197 Ga0163163_10441985 3300014325 Bacteria 1360
198 Ga0157380_10008698 3300014326 Bacteria 7257
199 Ga0157380_10543463 3300014326 Unclassified 1138
200 Ga0157377_10002734 3300014745 Bacteria 7847
201 Ga0157377_10022100 3300014745 Bacteria 3355
202 Ga0157377_10062407 3300014745 Bacteria 2132
203 Ga0157379_10000338 3300014968 Bacteria 37613
204 Ga0157379_10005070 3300014968 Bacteria 11291
205 Ga0157379_10006902 3300014968 Bacteria 9819
206 Ga0157376_10000540 3300014969 Bacteria 24303
207 Ga0163161_10146735 3300017792 Bacteria 1790
208 Ga0213873_10001807 3300021358 Unclassified 3612
209 Ga0213876_10021505 3300021384 Unclassified 3410
210 Ga0207653_10062509 3300025885 Bacteria 1259
211 Ga0207682_10046140 3300025893 Bacteria 1790
212 Ga0207688_10000078 3300025901 Bacteria 37290
213 Ga0207645_10001092 3300025907 Bacteria 22384
214 Ga0207643_10003058 3300025908 Bacteria 8996
215 Ga0207643_10006513 3300025908 Bacteria 6254
216 Ga0207643_10033934 3300025908 Bacteria 2857
217 Ga0207643_10037292 3300025908 Bacteria 2727
218 Ga0207643_10081415 3300025908 Bacteria 1876
219 Ga0207705_10075863 3300025909 Bacteria 2443
220 Ga0207684_10006121 3300025910 Bacteria 11004
221 Ga0207684_10032240 3300025910 Bacteria 4456
222 Ga0207684_10037032 3300025910 Bacteria 4141
223 Ga0207654_10090445 3300025911 Unclassified 1864
224 Ga0207707_10007499 3300025912 Bacteria 9506
225 Ga0207662_10007437 3300025918 Bacteria 5966
226 Ga0207652_10026344 3300025921 Bacteria 4841
227 Ga0207646_10002632 3300025922 Bacteria 21090
228 Ga0207646_10008433 3300025922 Bacteria 10334
229 Ga0207646_10206523 3300025922 Bacteria 1774
230 Ga0207646_10255749 3300025922 Bacteria 1583
231 Ga0207646_10318454 3300025922 Unclassified 1405
232 Ga0207681_10073876 3300025923 Bacteria 2387
233 Ga0207681_10114247 3300025923 Unclassified 1969
234 Ga0207659_10007486 3300025926 Bacteria 6717
235 Ga0207659_10015017 3300025926 Bacteria 5007
236 Ga0207659_10034711 3300025926 Bacteria 3481
237 Ga0207659_10337542 3300025926 Bacteria 1247
238 Ga0207644_10025427 3300025931 Bacteria 4072
239 Ga0207690_10189870 3300025932 Bacteria 1553
240 Ga0207706_10005517 3300025933 Bacteria 11795
241 Ga0207669_10117441 3300025937 Bacteria 1798
242 Ga0207704_10300923 3300025938 Unclassified 1229
243 Ga0207691_10006666 3300025940 Bacteria 11139
244 Ga0207691_10008116 3300025940 Bacteria 10079
245 Ga0207691_10026241 3300025940 Bacteria 5468
246 Ga0207691_10051562 3300025940 Bacteria 3761
247 Ga0207691_10098140 3300025940 Bacteria 2617
248 Ga0207711_10000818 3300025941 Bacteria 30428
249 Ga0207689_10010997 3300025942 Bacteria 7781
250 Ga0207689_10025217 3300025942 Bacteria 4984
251 Ga0207689_10070137 3300025942 Bacteria 2879
252 Ga0207689_10296925 3300025942 Bacteria 1339
253 Ga0207661_10000116 3300025944 Bacteria 50866
254 Ga0207679_10008110 3300025945 Bacteria 6680
255 Ga0207679_10198105 3300025945 Bacteria 1676
256 Ga0207667_10219349 3300025949 Bacteria 1949
257 Ga0207651_10041055 3300025960 Bacteria 3067
258 Ga0207712_10020761 3300025961 Bacteria 4306
259 Ga0207668_10238424 3300025972 Unclassified 1470
260 Ga0207668_10470075 3300025972 Bacteria 1077
261 Ga0207658_10004005 3300025986 Bacteria 10310
262 Ga0207658_10345139 3300025986 Bacteria 1295
263 Ga0207677_10030076 3300026023 Bacteria 3461
264 Ga0207703_10042430 3300026035 Bacteria 3649
265 Ga0207703_10053482 3300026035 Bacteria 3282
266 Ga0207639_10086544 3300026041 Bacteria 2495
267 Ga0207678_10019429 3300026067 Bacteria 5968
268 Ga0207678_10033302 3300026067 Bacteria 4490
269 Ga0207678_10072461 3300026067 Bacteria 2952
270 Ga0207678_10448399 3300026067 Bacteria 1121
271 Ga0207708_10009008 3300026075 Bacteria 7387
272 Ga0207708_10010254 3300026075 Bacteria 6957
273 Ga0207708_10078930 3300026075 Bacteria 2528
274 Ga0207708_10156984 3300026075 Bacteria 1795
275 Ga0207641_10017420 3300026088 Bacteria 5880
276 Ga0207641_10207166 3300026088 Unclassified 1811
277 Ga0207648_10006896 3300026089 Bacteria 11253
278 Ga0207648_10006924 3300026089 Bacteria 11230
279 Ga0207648_10054321 3300026089 Bacteria 3499
280 Ga0207648_10120058 3300026089 Bacteria 2311
281 Ga0207648_10147714 3300026089 Bacteria 2074
282 Ga0207676_10074006 3300026095 Bacteria 2743
283 Ga0207676_10223644 3300026095 Unclassified 1678
284 Ga0207674_10006652 3300026116 Bacteria 13579
285 Ga0207674_10063199 3300026116 Bacteria 3737
286 Ga0207675_100023842 3300026118 Bacteria 5691
287 Ga0207675_100027174 3300026118 Bacteria 5330
288 Ga0207675_100030569 3300026118 Bacteria 5018
289 Ga0207683_10044089 3300026121 Bacteria 3899
290 Ga0207683_10045831 3300026121 Bacteria 3824
291 Ga0207683_10092865 3300026121 Bacteria 2689
292 Ga0207698_10200923 3300026142 Bacteria 1785
293 Ga0209179_1009925 3300027512 Bacteria 1647
294 Ga0210002_1019536 3300027617 Unclassified 1088
295 Ga0209813_10004854 3300027866 Bacteria 3232
296 Ga0207428_10000060 3300027907 Bacteria 156452
297 Ga0207428_10019994 3300027907 Bacteria 5702
298 Ga0207428_10087958 3300027907 Bacteria 2416
299 Ga0268266_10205431 3300028379 Unclassified 1804
300 Ga0268265_10092665 3300028380 Bacteria 2419
301 Ga0268265_10317502 3300028380 Unclassified 1409
302 Ga0268265_10419783 3300028380 Unclassified 1242
303 Ga0268265_10859744 3300028380 Unclassified 888
304 Ga0268264_10017352 3300028381 Bacteria 5897
305 Ga0265762_1007271 3300030760 Bacteria 1974
306 Ga0265325_10004545 3300031241 Bacteria 8744
307 Ga0265316_10175194 3300031344 Bacteria 1599
308 Ga0373952_0009798 3300035092 Unclassified 1842
309 Ga0373932_0000307 3300035112 Bacteria 14822
310 Ga0373943_0041351 3300035170 Bacteria 2229
311 Ga0373962_0046383 3300035242 Unclassified 1240
312 Ga0373935_0041604 3300035692 Bacteria 2887
313 Ga0373925_0004554 3300037068 Bacteria 10472
314 Ga0436364_0052497 3300037853 Bacteria 13049
315 Ga0436365_0225702 3300039437 Bacteria 8123
316 Ga0436360_0989140 3300039438 Bacteria 1171
317 Ga0436363_0664041 3300039450 Bacteria 4989
318 Ga0436362_0786004 3300039453 Bacteria 4013
319 Ga0450916_001253 3300042530 Bacteria 2506
320 Ga0451577_0093149 3300042876 Bacteria 2691
321 Ga0466972_0042263 3300044658 Bacteria 2217
322 Ga0466959_0170859 3300045049 Bacteria 1525
323 Ga0495580_0069808 3300046472 Bacteria 2455
324 Ga0495584_0078862 3300046491 Unclassified 1657
325 Ga0495628_0248515 3300046516 Bacteria 1329
326 Ga0495586_0060425 3300046535 Bacteria 2061
327 Ga0495645_0004049 3300046543 Bacteria 10011
328 Ga0495656_0017122 3300046615 Bacteria 2761
329 Ga0495659_0014140 3300046664 Bacteria 2609
330 Ga0495647_0003414 3300046681 Bacteria 5086
331 Ga0495604_0050502 3300047317 Bacteria 3229
332 Ga0496102_0039921 3300048905 Bacteria 4243
333 Ga0496106_0000694 3300048909 Bacteria 24173
334 Ga0496107_0001688 3300048910 Bacteria 13828
335 Ga0496108_0032764 3300048911 Bacteria 4316
336 Ga0496109_0054881 3300048912 Bacteria 3634
337 Ga0496110_0037743 3300048913 Bacteria 4200
338 Ga0496112_0440948 3300048915 Unclassified 1240
339 Ga0496113_0299702 3300048916 Unclassified 1287
340 Ga0496114_0250056 3300048917 Unclassified 1560
341 Ga0501033_0198859 3300049570 Bacteria 1432
342 Ga0501036_0243818 3300049572 Bacteria 1507
343 Ga0501039_0199614 3300049575 Bacteria 1573
344 Ga0501041_0002708 3300049577 Bacteria 10108
345 Ga0501041_0070516 3300049577 Bacteria 2145
346 Ga0501041_0299635 3300049577 Bacteria 1013
347 Ga0501042_0287713 3300049578 Bacteria 1187
348 Ga0501043_0284914 3300049579 Bacteria 1266
349 Ga0501046_0179366 3300049580 Bacteria 1585
350 Ga0501068_0143489 3300049584 Unclassified 1498
351 Ga0501071_0319301 3300049587 Bacteria 1179
352 Ga0501072_0145065 3300049588 Bacteria 1893
353 Ga0501072_0174646 3300049588 Bacteria 1714
354 Ga0501075_0032062 3300049591 Bacteria 3903
355 Ga0501075_0044830 3300049591 Bacteria 3318
356 Ga0501076_0083431 3300049592 Bacteria 2566
357 Ga0501077_0054506 3300049593 Unclassified 2539
358 Ga0501077_0180234 3300049593 Bacteria 1343
359 Ga0501081_0096151 3300049743 Bacteria 2089
360 Ga0501045_0020868 3300049824 Bacteria 4683
361 Ga0501226_003263 3300049853 Bacteria 1931
362 nmdc:mga03683_20680_c1 3300050489 Bacteria 2529
363 nmdc:mga00v17_11104_c1 3300050491 Bacteria 4941
364 nmdc:mga00v17_23111_c1 3300050491 Bacteria 3594
365 nmdc:mga0yw44_81664_c1 3300050492 Bacteria 2027
366 nmdc:mga0yw44_89557_c1 3300050492 Bacteria 1942
367 nmdc:mga0k408_1706_c1 3300050493 Bacteria 11831
368 nmdc:mga06z11_7067_c1 3300050494 Unclassified 4605
369 nmdc:mga04h51_7083_c1 3300050495 Bacteria 2942
370 nmdc:mga05p37_1107_c1 3300050507 Bacteria 28841
371 nmdc:mga05p37_119941_c1 3300050507 Bacteria 3231
372 nmdc:mga05p37_138217_c1 3300050507 Bacteria 2986
373 nmdc:mga05p37_159769_c1 3300050507 Bacteria 2753
374 nmdc:mga05p37_22849_c1 3300050507 Bacteria 7584
375 nmdc:mga05p37_73587_c1 3300050507 Bacteria 4205
376 nmdc:mga09592_10035_c1 3300050508 Bacteria 7699
377 nmdc:mga09592_163710_c1 3300050508 Bacteria 1922
378 nmdc:mga09592_39345_c1 3300050508 Bacteria 3972
379 nmdc:mga09592_66910_c1 3300050508 Bacteria 3046
380 nmdc:mga09592_69784_c1 3300050508 Bacteria 2981
381 nmdc:mga0qj67_156320_c1 3300050509 Bacteria 1851
382 nmdc:mga0qj67_6091_c1 3300050509 Bacteria 8836
383 nmdc:mga0qj67_7069_c1 3300050509 Bacteria 8281
384 nmdc:mga06r32_23263_c1 3300050510 Bacteria 5731
385 nmdc:mga06r32_87804_c1 3300050510 Bacteria 3035
386 nmdc:mga08y16_110449_c1 3300050511 Bacteria 2863
387 nmdc:mga08y16_128589_c1 3300050511 Bacteria 2635
388 nmdc:mga08y16_200799_c1 3300050511 Bacteria 2066
389 nmdc:mga08y16_203_c1 3300050511 Bacteria 53409
390 nmdc:mga08y16_289001_c1 3300050511 Unclassified 1690
391 nmdc:mga08y16_4308_c1 3300050511 Bacteria 14860
392 nmdc:mga08y16_536276_c1 3300050511 Unclassified 1186
393 nmdc:mga0n895_411896_c1 3300050512 Unclassified 1367
394 nmdc:mga0n895_464666_c1 3300050512 Bacteria 1277
395 nmdc:mga0rr50_130970_c1 3300050513 Unclassified 2008
396 nmdc:mga0rr50_18911_c1 3300050513 Bacteria 4639
397 nmdc:mga0a205_126383_c1 3300050515 Bacteria 2457
398 nmdc:mga0a205_131290_c1 3300050515 Bacteria 2405
399 nmdc:mga0a205_2312_c1 3300050515 Bacteria 16823
400 nmdc:mga0a205_36705_c1 3300050515 Bacteria 4710
401 nmdc:mga0sz30_174450_c1 3300050516 Unclassified 953
402 Ga0501082_0035125 3300060353 Bacteria 4321
403 Ga0501082_0113636 3300060353 Bacteria 2345
404 Ga0501082_0131869 3300060353 Bacteria 2168
405 Ga0501082_0637282 3300060353 Bacteria 933
406 Ga0530510_0000140 3300061734 Bacteria 42574
407 Ga0530510_0091664 3300061734 Bacteria 2218
408 Ga0207677_10052384
409 CNAas_1000091
410 JGI24746J21847_1004464
411 Ga0065712_10000644
412 Ga0065712_10149439
413 Ga0065715_10009971
414 Ga0065715_10039053
415 Ga0065715_10159699
416 Ga0065707_10084466
417 Ga0065707_10097547
418 Ga0065707_10227900
419 Ga0065707_10237230
420 Ga0070658_10014582
421 Ga0070683_100000122
422 Ga0070690_100007979
423 Ga0070690_100067563
424 Ga0070690_100163826
425 Ga0070670_100360292
426 Ga0070677_10001941
427 Ga0068869_100007550
428 Ga0068869_100028964
429 Ga0070666_10001475
430 Ga0070666_10038357
431 Ga0070680_100070568
432 Ga0068868_100085035
433 Ga0068868_100134080
434 Ga0070689_100268229
435 Ga0070689_100271325
436 Ga0070691_10067523
437 Ga0070687_100003542
438 Ga0070661_100032912
439 Ga0070692_10123446
440 Ga0070668_100311085
441 Ga0070669_100026011
442 Ga0070669_100093354
443 Ga0070669_100233719
444 Ga0070675_100007840
445 Ga0070675_100059666
446 Ga0070675_100070493
447 Ga0070675_100105990
448 Ga0070675_100191266
449 Ga0070671_100022132
450 Ga0070673_100007497
451 Ga0070673_100008711
452 Ga0070673_100011429
453 Ga0070667_100000383
454 Ga0070667_100202761
455 Ga0070714_100048616
456 Ga0070714_100354376
457 Ga0070701_10014460
458 Ga0070705_100000288
459 Ga0070700_100001687
460 Ga0070700_100076804
461 Ga0070694_100001669
462 Ga0070694_100022657
463 Ga0070694_100253508
464 Ga0070708_100007723
465 Ga0070708_100013378
466 Ga0070678_100007093
467 Ga0070678_100083314
468 Ga0070678_100269018
469 Ga0070662_100005489
470 Ga0070681_10006500
471 Ga0068867_100015273
472 Ga0068867_100029139
473 Ga0070685_10003010
474 Ga0070706_100002200
475 Ga0070706_100011296
476 Ga0070706_100239917
477 Ga0070707_100017511
478 Ga0070707_100029730
479 Ga0070707_100240345
480 Ga0070698_100000635
481 Ga0070698_100021130
482 Ga0070679_100023973
483 Ga0070684_100000125
484 Ga0070697_100000925
485 Ga0070672_100000609
486 Ga0070672_100010306
487 Ga0070686_100072254
488 Ga0070686_100252142
489 Ga0070695_100003344
490 Ga0070696_100001518
491 Ga0070696_100024998
492 Ga0070693_100084185
493 Ga0070665_100050416
494 Ga0070704_100000802
495 Ga0070704_100012166
496 Ga0070704_100126342
497 Ga0070704_100265520
498 Ga0068855_100214082
499 Ga0070664_100009155
500 Ga0068857_100002247
501 Ga0068856_100013892
502 Ga0070702_100011696
503 Ga0068852_100069898
504 Ga0068852_100137252
505 Ga0068852_100517074
506 Ga0068859_100008626
507 Ga0068859_100026181
508 Ga0068859_100132451
509 Ga0068859_100199815
510 Ga0068864_100071351
511 Ga0068864_100172352
512 Ga0068861_100081589
513 Ga0068861_100180092
514 Ga0068861_100318974
515 Ga0068870_10006109
516 Ga0068870_10035498
517 Ga0068870_10133719
518 Ga0068863_100015500
519 Ga0068858_100031746
520 Ga0068858_100045861
521 Ga0068858_100064390
522 Ga0068858_100441562
523 Ga0068860_100004726
524 Ga0068860_100053510
525 Ga0068860_100068275
526 Ga0068860_100077694
527 Ga0068860_100118501
528 Ga0068862_100152850
529 Ga0075365_10026343
530 Ga0075365_10102952
531 Ga0075363_100068795
532 Ga0075364_10021016
533 Ga0070716_100114866
534 Ga0075367_10007502
535 Ga0075367_10167056
536 Ga0097621_100004416
537 Ga0097621_100016899
538 Ga0068871_100006917
539 Ga0068871_100027133
540 Ga0068871_100233197
541 Ga0075428_100016154
542 Ga0075428_100018389
543 Ga0075428_100475301
544 Ga0075430_100014486
545 Ga0075430_100020148
546 Ga0075430_100023429
547 Ga0075430_100035436
548 Ga0075430_100082437
549 Ga0075430_100215791
550 Ga0075431_100007412
551 Ga0075431_100023686
552 Ga0075431_100107156
553 Ga0075431_100191118
554 Ga0075433_10006049
555 Ga0075433_10028300
556 Ga0075433_10046065
557 Ga0075433_10122506
558 Ga0075429_100024138
559 Ga0075429_100033047
560 Ga0075429_100088393
561 Ga0075429_100202532
562 Ga0075429_100220835
563 Ga0068865_100121938
564 Ga0097620_100008626
565 Ga0097620_100026181
566 Ga0097620_100132442
567 Ga0097620_100199809
568 Ga0075435_100033094
569 Ga0099794_10044929
570 Ga0111539_10000712
571 Ga0111539_10003084
572 Ga0111539_10005282
573 Ga0111539_10078083
574 Ga0111539_10086722
575 Ga0111539_10234993
576 Ga0111539_10238426
577 Ga0111539_10284917
578 Ga0111539_10613550
579 Ga0105245_10110961
580 Ga0114129_10008510
581 Ga0114129_10034405
582 Ga0114129_10045868
583 Ga0114129_10049166
584 Ga0114129_10182009
585 Ga0105243_10024251
586 Ga0105243_10137911
587 Ga0105241_10156283
588 Ga0105242_10034886
589 Ga0105242_10118655
590 Ga0105248_10001906
591 Ga0105248_10097742
592 Ga0105248_10222987
593 Ga0105239_10387546
594 Ga0105246_10016281
595 Ga0157378_10002596
596 Ga0163162_10030754
597 Ga0163162_10090070
598 Ga0163162_10264239
599 Ga0157375_10002833
600 Ga0157375_10034533
601 Ga0157375_10458998
602 Ga0157375_10463902
603 Ga0157375_10583990
604 Ga0163163_10441985
605 Ga0157380_10008698
606 Ga0157380_10543463
607 Ga0157377_10002734
608 Ga0157377_10022100
609 Ga0157377_10062407
610 Ga0157379_10000338
611 Ga0157379_10005070
612 Ga0157379_10006902
613 Ga0157376_10000540
614 Ga0163161_10146735
615 Ga0213873_10001807
616 Ga0213876_10021505
617 Ga0207653_10062509
618 Ga0207682_10046140
619 Ga0207688_10000078
620 Ga0207645_10001092
621 Ga0207643_10003058
622 Ga0207643_10006513
623 Ga0207643_10033934
624 Ga0207643_10037292
625 Ga0207643_10081415
626 Ga0207705_10075863
627 Ga0207684_10006121
628 Ga0207684_10032240
629 Ga0207684_10037032
630 Ga0207654_10090445
631 Ga0207707_10007499
632 Ga0207662_10007437
633 Ga0207652_10026344
634 Ga0207646_10002632
635 Ga0207646_10008433
636 Ga0207646_10206523
637 Ga0207646_10255749
638 Ga0207646_10318454
639 Ga0207681_10073876
640 Ga0207681_10114247
641 Ga0207659_10007486
642 Ga0207659_10015017
643 Ga0207659_10034711
644 Ga0207659_10337542
645 Ga0207644_10025427
646 Ga0207690_10189870
647 Ga0207706_10005517
648 Ga0207669_10117441
649 Ga0207704_10300923
650 Ga0207691_10006666
651 Ga0207691_10008116
652 Ga0207691_10026241
653 Ga0207691_10051562
654 Ga0207691_10098140
655 Ga0207711_10000818
656 Ga0207689_10010997
657 Ga0207689_10025217
658 Ga0207689_10070137
659 Ga0207689_10296925
660 Ga0207661_10000116
661 Ga0207679_10008110
662 Ga0207679_10198105
663 Ga0207667_10219349
664 Ga0207651_10041055
665 Ga0207712_10020761
666 Ga0207668_10238424
667 Ga0207668_10470075
668 Ga0207658_10004005
669 Ga0207658_10345139
670 Ga0207677_10030076
671 Ga0207703_10042430
672 Ga0207703_10053482
673 Ga0207639_10086544
674 Ga0207678_10019429
675 Ga0207678_10033302
676 Ga0207678_10072461
677 Ga0207678_10448399
678 Ga0207708_10009008
679 Ga0207708_10010254
680 Ga0207708_10078930
681 Ga0207708_10156984
682 Ga0207641_10017420
683 Ga0207641_10207166
684 Ga0207648_10006896
685 Ga0207648_10006924
686 Ga0207648_10054321
687 Ga0207648_10120058
688 Ga0207648_10147714
689 Ga0207676_10074006
690 Ga0207676_10223644
691 Ga0207674_10006652
692 Ga0207674_10063199
693 Ga0207675_100023842
694 Ga0207675_100027174
695 Ga0207675_100030569
696 Ga0207683_10044089
697 Ga0207683_10045831
698 Ga0207683_10092865
699 Ga0207698_10200923
700 Ga0209179_1009925
701 Ga0210002_1019536
702 Ga0209813_10004854
703 Ga0207428_10000060
704 Ga0207428_10019994
705 Ga0207428_10087958
706 Ga0268266_10205431
707 Ga0268265_10092665
708 Ga0268265_10317502
709 Ga0268265_10419783
710 Ga0268265_10859744
711 Ga0268264_10017352
712 Ga0265762_1007271
713 Ga0265325_10004545
714 Ga0265316_10175194
715 Ga0373952_0009798
716 Ga0373932_0000307
717 Ga0373943_0041351
718 Ga0373962_0046383
719 Ga0373935_0041604
720 Ga0373925_0004554
721 Ga0436364_0052497
722 Ga0436365_0225702
723 Ga0436360_0989140
724 Ga0436363_0664041
725 Ga0436362_0786004
726 Ga0450916_001253
727 Ga0451577_0093149
728 Ga0466972_0042263
729 Ga0466959_0170859
730 Ga0495580_0069808
731 Ga0495584_0078862
732 Ga0495628_0248515
733 Ga0495586_0060425
734 Ga0495645_0004049
735 Ga0495656_0017122
736 Ga0495659_0014140
737 Ga0495647_0003414
738 Ga0495604_0050502
739 Ga0496102_0039921
740 Ga0496106_0000694
741 Ga0496107_0001688
742 Ga0496108_0032764
743 Ga0496109_0054881
744 Ga0496110_0037743
745 Ga0496112_0440948
746 Ga0496113_0299702
747 Ga0496114_0250056
748 Ga0501033_0198859
749 Ga0501036_0243818
750 Ga0501039_0199614
751 Ga0501041_0002708
752 Ga0501041_0070516
753 Ga0501041_0299635
754 Ga0501042_0287713
755 Ga0501043_0284914
756 Ga0501046_0179366
757 Ga0501068_0143489
758 Ga0501071_0319301
759 Ga0501072_0145065
760 Ga0501072_0174646
761 Ga0501075_0032062
762 Ga0501075_0044830
763 Ga0501076_0083431
764 Ga0501077_0054506
765 Ga0501077_0180234
766 Ga0501081_0096151
767 Ga0501045_0020868
768 Ga0501226_003263
769 nmdc:mga03683_20680_c1
770 nmdc:mga00v17_11104_c1
771 nmdc:mga00v17_23111_c1
772 nmdc:mga0yw44_81664_c1
773 nmdc:mga0yw44_89557_c1
774 nmdc:mga0k408_1706_c1
775 nmdc:mga06z11_7067_c1
776 nmdc:mga04h51_7083_c1
777 nmdc:mga05p37_1107_c1
778 nmdc:mga05p37_119941_c1
779 nmdc:mga05p37_138217_c1
780 nmdc:mga05p37_159769_c1
781 nmdc:mga05p37_22849_c1
782 nmdc:mga05p37_73587_c1
783 nmdc:mga09592_10035_c1
784 nmdc:mga09592_163710_c1
785 nmdc:mga09592_39345_c1
786 nmdc:mga09592_66910_c1
787 nmdc:mga09592_69784_c1
788 nmdc:mga0qj67_156320_c1
789 nmdc:mga0qj67_6091_c1
790 nmdc:mga0qj67_7069_c1
791 nmdc:mga06r32_23263_c1
792 nmdc:mga06r32_87804_c1
793 nmdc:mga08y16_110449_c1
794 nmdc:mga08y16_128589_c1
795 nmdc:mga08y16_200799_c1
796 nmdc:mga08y16_203_c1
797 nmdc:mga08y16_289001_c1
798 nmdc:mga08y16_4308_c1
799 nmdc:mga08y16_536276_c1
800 nmdc:mga0n895_411896_c1
801 nmdc:mga0n895_464666_c1
802 nmdc:mga0rr50_130970_c1
803 nmdc:mga0rr50_18911_c1
804 nmdc:mga0a205_126383_c1
805 nmdc:mga0a205_131290_c1
806 nmdc:mga0a205_2312_c1
807 nmdc:mga0a205_36705_c1
808 nmdc:mga0sz30_174450_c1
809 Ga0501082_0035125
810 Ga0501082_0113636
811 Ga0501082_0131869
812 Ga0501082_0637282
813 Ga0530510_0000140
814 Ga0530510_0091664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

82

339

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.944 35 332
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9332 41 334
2iry-assembly1.cif.gz_A crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. 0.9291 51 324
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9229 35 332
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.8985 51 336
ID Description Score Start End Superfamily
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9564 65 335 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.95 67 333 3.90.920.10
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.934 167 297 3.30.70.3300
af_P9WNV3_16_301_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9057 60 337 3.90.920.10
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9007 65 335 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A534TSH9-F1-model_v4 Tetratricopeptide repeat protein 0.9922 36 336 GO:0003677
GO:0005524
GO:0006355
GO:0046872
AF-A0A2V6TQD1-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9912 80 337 GO:0005524
GO:0046872
AF-A0A2V6ZBR0-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9907 36 337 GO:0005524
GO:0046872
AF-A0A2V7CZR3-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9903 36 337 GO:0005524
GO:0046872
AF-A0A7W1QL58-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9902 166 337 GO:0005524
GO:0046872

Map