F436419

General Info

Members Datasets Scaffolds Average Seq Length
407 214 407 199

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100191027|Ga0070696_1001910271
Length 234
Sequence MRPVSPRPATAPRPRRTTGHHRQPEADRLSDGRTPDRPLPPDIEALVRRPCPGTHRTTIPLVDGAVETLADLPPARGRLLFVGLNPSPVSVQAGHYHQGRLGRTFWRRLIRAGILPAGTPIGAADDALVAAGHGITDLIKTPSPRDVASDAELRAGVGALWQKVALWRPAAIVFVYKRAAEIAAGRSLTEPWGQLAGVALAGRPCFLMPGPYAPAEAVSAGLNLLRNLQAALPD

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.79
Rhizosphere 88.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100029840 3300005330 Bacteria 3386
2 Ga0070690_100075975 3300005330 Unclassified 2191
3 Ga0070670_100064008 3300005331 Unclassified 3155
4 Ga0070680_100407246 3300005336 Bacteria 1160
5 Ga0070682_100076607 3300005337 Bacteria 2153
6 Ga0068868_100151874 3300005338 Bacteria 1907
7 Ga0070660_100051831 3300005339 Bacteria 3162
8 Ga0070691_10056586 3300005341 Unclassified 1880
9 Ga0070687_100001646 3300005343 Bacteria 7983
10 Ga0070692_10009896 3300005345 Bacteria 4317
11 Ga0070668_100198582 3300005347 Bacteria 1646
12 Ga0070668_100512334 3300005347 Unclassified 1040
13 Ga0070675_100009755 3300005354 Bacteria 7477
14 Ga0070675_100215817 3300005354 Unclassified 1669
15 Ga0070671_100280062 3300005355 Bacteria 1418
16 Ga0070674_100016036 3300005356 Unclassified 4692
17 Ga0070674_101105209 3300005356 Unclassified 700
18 Ga0070673_100264480 3300005364 Bacteria 1503
19 Ga0070688_100046895 3300005365 Bacteria 2678
20 Ga0070688_100047029 3300005365 Unclassified 2675
21 Ga0070659_100028969 3300005366 Unclassified 4277
22 Ga0070659_100228840 3300005366 Unclassified 1536
23 Ga0070667_100120020 3300005367 Bacteria 2286
24 Ga0070701_10073658 3300005438 Unclassified 1832
25 Ga0070705_100028720 3300005440 Unclassified 3050
26 Ga0070705_100085806 3300005440 Bacteria 1947
27 Ga0070705_100334121 3300005440 Bacteria 1099
28 Ga0070700_100012623 3300005441 Unclassified 4722
29 Ga0070700_100146266 3300005441 Bacteria 1611
30 Ga0070700_100732674 3300005441 Unclassified 789
31 Ga0070694_100001796 3300005444 Bacteria 12690
32 Ga0070694_100042629 3300005444 Bacteria 3032
33 Ga0070694_100152708 3300005444 Bacteria 1688
34 Ga0070694_100297874 3300005444 Bacteria 1235
35 Ga0070708_100024959 3300005445 Bacteria 5108
36 Ga0070663_100048761 3300005455 Unclassified 3004
37 Ga0070678_100134495 3300005456 Unclassified 1970
38 Ga0070678_100557232 3300005456 Unclassified 1018
39 Ga0070662_100009798 3300005457 Bacteria 6275
40 Ga0070662_100062242 3300005457 Bacteria 2726
41 Ga0070681_10148222 3300005458 Bacteria 2274
42 Ga0070685_10008960 3300005466 Bacteria 5161
43 Ga0070685_10564758 3300005466 Bacteria 814
44 Ga0070706_100000392 3300005467 Bacteria 52726
45 Ga0070707_100002855 3300005468 Bacteria 16444
46 Ga0070707_100004886 3300005468 Bacteria 12561
47 Ga0070707_100081008 3300005468 Bacteria 3134
48 Ga0070707_100311337 3300005468 Unclassified 1530
49 Ga0070698_100019428 3300005471 Bacteria 7132
50 Ga0070699_100007497 3300005518 Bacteria 9490
51 Ga0070679_100440902 3300005530 Bacteria 1247
52 Ga0070679_100832148 3300005530 Bacteria 866
53 Ga0070697_100045379 3300005536 Bacteria 3561
54 Ga0070697_100170767 3300005536 Bacteria 1840
55 Ga0070697_100461694 3300005536 Unclassified 1107
56 Ga0070697_100477205 3300005536 Unclassified 1089
57 Ga0070697_100608648 3300005536 Bacteria 961
58 Ga0068853_100716547 3300005539 Unclassified 955
59 Ga0070672_100004154 3300005543 Bacteria 9455
60 Ga0070686_100007093 3300005544 Bacteria 6247
61 Ga0070686_100106426 3300005544 Bacteria 1904
62 Ga0070686_100136480 3300005544 Bacteria 1703
63 Ga0070695_100005055 3300005545 Bacteria 7770
64 Ga0070695_100024034 3300005545 Bacteria 3751
65 Ga0070695_100411573 3300005545 Bacteria 1028
66 Ga0070695_100412791 3300005545 Archaea 1026
67 Ga0070696_100016366 3300005546 Bacteria 4992
68 Ga0070696_100030234 3300005546 Bacteria 3707
69 Ga0070696_100107623 3300005546 Bacteria 2005
70 Ga0070696_100141218 3300005546 Unclassified 1760
71 Ga0070696_100191027 3300005546 Unclassified 1524
72 Ga0070693_100029128 3300005547 Unclassified 3009
73 Ga0070693_100168574 3300005547 Bacteria 1400
74 Ga0070693_100303505 3300005547 Bacteria 1077
75 Ga0070704_100003100 3300005549 Bacteria 9471
76 Ga0070704_100144546 3300005549 Bacteria 1862
77 Ga0070704_100485063 3300005549 Bacteria 1070
78 Ga0068855_100200810 3300005563 Bacteria 2244
79 Ga0070664_100042758 3300005564 Bacteria 3824
80 Ga0068854_100640377 3300005578 Bacteria 912
81 Ga0068856_100432507 3300005614 Bacteria 1336
82 Ga0068856_100780680 3300005614 Unclassified 975
83 Ga0070702_100187553 3300005615 Bacteria 1358
84 Ga0068852_100061769 3300005616 Bacteria 3257
85 Ga0068859_100043007 3300005617 Bacteria 4539
86 Ga0068859_100926499 3300005617 Bacteria 955
87 Ga0068859_101434562 3300005617 Bacteria 762
88 Ga0068864_100063154 3300005618 Bacteria 3209
89 Ga0068864_100071598 3300005618 Bacteria 3019
90 Ga0068861_100117310 3300005719 Bacteria 2142
91 Ga0068870_10025943 3300005840 Unclassified 2915
92 Ga0068863_100052642 3300005841 Bacteria 3858
93 Ga0068863_100345189 3300005841 Bacteria 1449
94 Ga0068858_100323617 3300005842 Bacteria 1474
95 Ga0068858_100572839 3300005842 Bacteria 1094
96 Ga0068860_100046232 3300005843 Bacteria 4151
97 Ga0068860_100161559 3300005843 Bacteria 2160
98 Ga0068860_100182361 3300005843 Unclassified 2029
99 Ga0068862_100034958 3300005844 Unclassified 4254
100 Ga0068862_100167019 3300005844 Bacteria 1968
101 Ga0081539_10009700 3300005985 Bacteria 7973
102 Ga0068871_100132545 3300006358 Unclassified 2114
103 Ga0075433_10014759 3300006852 Bacteria 6393
104 Ga0075433_10375518 3300006852 Bacteria 1255
105 Ga0075434_100026719 3300006871 Bacteria 5659
106 Ga0075434_100242312 3300006871 Bacteria 1823
107 Ga0068865_100016780 3300006881 Bacteria 4693
108 Ga0097620_100043007 3300006931 Bacteria 4539
109 Ga0097620_100926625 3300006931 Bacteria 955
110 Ga0097620_101434554 3300006931 Bacteria 762
111 Ga0111539_10023756 3300009094 Bacteria 7532
112 Ga0111539_10184804 3300009094 Bacteria 2434
113 Ga0111539_10298977 3300009094 Bacteria 1873
114 Ga0111539_11142482 3300009094 Unclassified 905
115 Ga0105245_10008977 3300009098 Bacteria 8719
116 Ga0105245_10050122 3300009098 Bacteria 3741
117 Ga0105245_10555653 3300009098 Unclassified 1170
118 Ga0105245_10880347 3300009098 Unclassified 936
119 Ga0105245_11019332 3300009098 Bacteria 872
120 Ga0114129_10207554 3300009147 Unclassified 2650
121 Ga0114129_10221869 3300009147 Bacteria 2549
122 Ga0105243_10049945 3300009148 Unclassified 3303
123 Ga0105243_10132241 3300009148 Bacteria 2118
124 Ga0105243_10141621 3300009148 Bacteria 2052
125 Ga0105243_10316002 3300009148 Bacteria 1421
126 Ga0105243_10961350 3300009148 Archaea 854
127 Ga0105242_10097879 3300009176 Bacteria 2481
128 Ga0105248_10347694 3300009177 Bacteria 1669
129 Ga0105248_10716976 3300009177 Bacteria 1129
130 Ga0105237_10342284 3300009545 Bacteria 1500
131 Ga0105238_10154545 3300009551 Unclassified 2269
132 Ga0105249_10013933 3300009553 Bacteria 7108
133 Ga0105249_10226554 3300009553 Unclassified 1842
134 Ga0105249_10613100 3300009553 Bacteria 1144
135 Ga0105249_10699163 3300009553 Bacteria 1074
136 Ga0099796_10086419 3300010159 Bacteria 1159
137 Ga0105239_10179802 3300010375 Bacteria 2367
138 Ga0105239_10388927 3300010375 Bacteria 1577
139 Ga0105239_10409398 3300010375 Unclassified 1535
140 Ga0157378_10003853 3300013297 Bacteria 13267
141 Ga0163162_10049315 3300013306 Unclassified 4220
142 Ga0163162_10451012 3300013306 Unclassified 1418
143 Ga0157372_10774009 3300013307 Bacteria 1116
144 Ga0157375_10063639 3300013308 Bacteria 3671
145 Ga0157375_10681461 3300013308 Unclassified 1182
146 Ga0163163_10185340 3300014325 Unclassified 2129
147 Ga0163163_10226401 3300014325 Bacteria 1919
148 Ga0163163_10227519 3300014325 Bacteria 1914
149 Ga0157380_10018786 3300014326 Bacteria 5140
150 Ga0157380_10218512 3300014326 Bacteria 1703
151 Ga0182008_10205519 3300014497 Bacteria 1003
152 Ga0157377_10036266 3300014745 Unclassified 2712
153 Ga0157377_10231200 3300014745 Unclassified 1189
154 Ga0157379_10016227 3300014968 Bacteria 6553
155 Ga0157379_10104771 3300014968 Unclassified 2538
156 Ga0157379_10170152 3300014968 Bacteria 1967
157 Ga0157376_10345806 3300014969 Bacteria 1422
158 Ga0157376_11091521 3300014969 Bacteria 823
159 Ga0207688_10011563 3300025901 Unclassified 4803
160 Ga0207688_10022187 3300025901 Bacteria 3473
161 Ga0207645_10061729 3300025907 Unclassified 2394
162 Ga0207643_10003186 3300025908 Bacteria 8836
163 Ga0207684_10000852 3300025910 Bacteria 35040
164 Ga0207684_10004740 3300025910 Bacteria 12752
165 Ga0207684_10125521 3300025910 Bacteria 2202
166 Ga0207654_10152605 3300025911 Bacteria 1484
167 Ga0207707_10050655 3300025912 Bacteria 3617
168 Ga0207663_10510792 3300025916 Unclassified 935
169 Ga0207660_10521728 3300025917 Bacteria 965
170 Ga0207662_10006805 3300025918 Bacteria 6188
171 Ga0207662_10049722 3300025918 Bacteria 2488
172 Ga0207662_10523828 3300025918 Unclassified 818
173 Ga0207657_10072148 3300025919 Bacteria 2922
174 Ga0207649_10294193 3300025920 Bacteria 1185
175 Ga0207652_10387287 3300025921 Bacteria 1261
176 Ga0207652_10639877 3300025921 Unclassified 951
177 Ga0207646_10008240 3300025922 Bacteria 10467
178 Ga0207646_10011280 3300025922 Bacteria 8678
179 Ga0207646_10186377 3300025922 Bacteria 1874
180 Ga0207646_10247552 3300025922 Bacteria 1610
181 Ga0207646_11011516 3300025922 Unclassified 734
182 Ga0207681_10464799 3300025923 Bacteria 1031
183 Ga0207694_10246459 3300025924 Bacteria 1461
184 Ga0207650_10119877 3300025925 Bacteria 2047
185 Ga0207659_10061193 3300025926 Unclassified 2712
186 Ga0207659_10175294 3300025926 Bacteria 1694
187 Ga0207659_10563166 3300025926 Unclassified 969
188 Ga0207687_10007474 3300025927 Bacteria 7192
189 Ga0207690_10004793 3300025932 Bacteria 7980
190 Ga0207706_10011682 3300025933 Bacteria 8007
191 Ga0207706_10054995 3300025933 Bacteria 3512
192 Ga0207706_10229650 3300025933 Archaea 1624
193 Ga0207686_10144667 3300025934 Bacteria 1647
194 Ga0207709_10106741 3300025935 Bacteria 1863
195 Ga0207670_10043397 3300025936 Unclassified 2969
196 Ga0207669_10040203 3300025937 Bacteria 2711
197 Ga0207704_10067879 3300025938 Unclassified 2246
198 Ga0207665_10364668 3300025939 Bacteria 1093
199 Ga0207691_10018229 3300025940 Bacteria 6650
200 Ga0207711_10036994 3300025941 Bacteria 4143
201 Ga0207661_10155666 3300025944 Unclassified 1979
202 Ga0207667_10282701 3300025949 Bacteria 1695
203 Ga0207712_10372902 3300025961 Unclassified 1192
204 Ga0207677_10767622 3300026023 Bacteria 860
205 Ga0207703_10419085 3300026035 Bacteria 1245
206 Ga0207678_10006210 3300026067 Bacteria 10616
207 Ga0207708_10004891 3300026075 Bacteria 9882
208 Ga0207708_10060270 3300026075 Bacteria 2897
209 Ga0207708_10167719 3300026075 Bacteria 1737
210 Ga0207708_10269360 3300026075 Bacteria 1377
211 Ga0207702_10083416 3300026078 Bacteria 2781
212 Ga0207702_10094232 3300026078 Bacteria 2628
213 Ga0207702_10648900 3300026078 Unclassified 1038
214 Ga0207641_10077430 3300026088 Unclassified 2878
215 Ga0207648_10003311 3300026089 Bacteria 16915
216 Ga0207676_10036479 3300026095 Bacteria 3741
217 Ga0207674_10165703 3300026116 Unclassified 2164
218 Ga0207674_10183882 3300026116 Unclassified 2040
219 Ga0207675_100061926 3300026118 Bacteria 3493
220 Ga0207675_100441202 3300026118 Bacteria 1289
221 Ga0207675_100724912 3300026118 Bacteria 1004
222 Ga0207675_100812500 3300026118 Bacteria 949
223 Ga0207683_10129394 3300026121 Unclassified 2270
224 Ga0207683_10381525 3300026121 Bacteria 1295
225 Ga0207698_10158718 3300026142 Unclassified 1975
226 Ga0207428_10326342 3300027907 Unclassified 1133
227 Ga0268265_10094981 3300028380 Bacteria 2393
228 Ga0268265_10144267 3300028380 Bacteria 1998
229 Ga0268264_10161409 3300028381 Bacteria 2019
230 Ga0268264_10253654 3300028381 Bacteria 1635
231 Ga0268264_10532395 3300028381 Bacteria 1150
232 Ga0268264_10684263 3300028381 Unclassified 1018
233 Ga0265319_1000328 3300028563 Bacteria 34982
234 Ga0265334_10013999 3300028573 Bacteria 3349
235 Ga0265318_10002576 3300028577 Bacteria 9607
236 Ga0265318_10019033 3300028577 Bacteria 2791
237 Ga0265322_10022995 3300028654 Bacteria 1783
238 Ga0265336_10003845 3300028666 Bacteria 5782
239 Ga0265324_10001382 3300029957 Bacteria 14044
240 Ga0265332_10008206 3300031238 Bacteria 4696
241 Ga0265328_10148792 3300031239 Bacteria 880
242 Ga0265320_10001216 3300031240 Bacteria 18914
243 Ga0265325_10019428 3300031241 Bacteria 3756
244 Ga0265329_10005992 3300031242 Bacteria 4862
245 Ga0265340_10028824 3300031247 Bacteria 2790
246 Ga0265331_10062332 3300031250 Bacteria 1759
247 Ga0265316_10012578 3300031344 Bacteria 7580
248 Ga0265316_10408378 3300031344 Bacteria 977
249 Ga0307408_100107833 3300031548 Bacteria 2134
250 Ga0307408_100371732 3300031548 Unclassified 1219
251 Ga0265313_10021065 3300031595 Bacteria 3576
252 Ga0265314_10001377 3300031711 Bacteria 27303
253 Ga0307405_10144284 3300031731 Unclassified 1665
254 Ga0307413_10434209 3300031824 Archaea 1038
255 Ga0307406_10211608 3300031901 Bacteria 1435
256 Ga0307412_10087146 3300031911 Bacteria 2175
257 Ga0307409_100089607 3300031995 Bacteria 2515
258 Ga0307416_100003174 3300032002 Bacteria 9635
259 Ga0307415_100027934 3300032126 Bacteria 3582
260 Ga0373952_0033735 3300035092 Bacteria 1150
261 Ga0373943_0148665 3300035170 Bacteria 1268
262 Ga0373931_0019661 3300035691 Unclassified 3373
263 Ga0373937_0901325 3300036401 Unclassified 833
264 Ga0395901_0220678 3300038443 Bacteria 1982
265 Ga0439459_0011285 3300042438 Bacteria 1573
266 Ga0451576_0973829 3300045051 Unclassified 889
267 Ga0495641_0307602 3300046461 Unclassified 715
268 Ga0495584_0168635 3300046491 Bacteria 1113
269 Ga0495656_0239077 3300046615 Bacteria 914
270 Ga0495634_0134190 3300046642 Bacteria 1576
271 Ga0495658_0279836 3300046683 Unclassified 1053
272 Ga0495658_0484168 3300046683 Bacteria 791
273 Ga0495624_0265802 3300046690 Unclassified 1036
274 Ga0495624_0328339 3300046690 Bacteria 921
275 Ga0496100_0544844 3300048903 Bacteria 897
276 Ga0496100_0599068 3300048903 Bacteria 856
277 Ga0496101_0409032 3300048904 Bacteria 1069
278 Ga0496102_0090867 3300048905 Bacteria 2826
279 Ga0496102_0097523 3300048905 Bacteria 2727
280 Ga0496102_0300276 3300048905 Bacteria 1513
281 Ga0496102_0422855 3300048905 Bacteria 1251
282 Ga0496102_0452772 3300048905 Unclassified 1204
283 Ga0496102_0658076 3300048905 Bacteria 971
284 Ga0496103_0001712 3300048906 Bacteria 14351
285 Ga0496103_0096170 3300048906 Unclassified 1872
286 Ga0496103_0263170 3300048906 Bacteria 1110
287 Ga0496103_0317679 3300048906 Bacteria 1002
288 Ga0496104_0028099 3300048907 Bacteria 5211
289 Ga0496104_0207443 3300048907 Unclassified 1871
290 Ga0496105_0039959 3300048908 Bacteria 3867
291 Ga0496105_0047427 3300048908 Bacteria 3545
292 Ga0496106_0141872 3300048909 Bacteria 1890
293 Ga0496106_0202446 3300048909 Bacteria 1580
294 Ga0496106_0505566 3300048909 Archaea 971
295 Ga0496107_0100065 3300048910 Bacteria 2125
296 Ga0496107_0131683 3300048910 Bacteria 1846
297 Ga0496107_0433749 3300048910 Bacteria 977
298 Ga0496108_0007566 3300048911 Bacteria 8801
299 Ga0496108_0033489 3300048911 Bacteria 4268
300 Ga0496108_0094448 3300048911 Unclassified 2545
301 Ga0496108_0601433 3300048911 Bacteria 958
302 Ga0496109_0013747 3300048912 Bacteria 7033
303 Ga0496109_0028196 3300048912 Bacteria 5020
304 Ga0496109_0029721 3300048912 Bacteria 4896
305 Ga0496109_0078117 3300048912 Bacteria 3047
306 Ga0496109_0172570 3300048912 Bacteria 2029
307 Ga0496109_0729118 3300048912 Bacteria 929
308 Ga0496110_0067858 3300048913 Unclassified 3156
309 Ga0496110_0076448 3300048913 Bacteria 2977
310 Ga0496110_0131878 3300048913 Bacteria 2257
311 Ga0496111_0019567 3300048914 Bacteria 4706
312 Ga0496111_0035160 3300048914 Bacteria 3579
313 Ga0496111_0117159 3300048914 Bacteria 1965
314 Ga0496111_0289208 3300048914 Bacteria 1215
315 Ga0496112_0034363 3300048915 Bacteria 4934
316 Ga0496112_0351873 3300048915 Unclassified 1415
317 Ga0496112_0591388 3300048915 Bacteria 1042
318 Ga0496113_0036897 3300048916 Bacteria 3583
319 Ga0496113_0046040 3300048916 Unclassified 3238
320 Ga0496113_0120505 3300048916 Bacteria 2050
321 Ga0496114_0098169 3300048917 Bacteria 2497
322 Ga0496114_0490369 3300048917 Bacteria 1087
323 Ga0501031_0080219 3300049568 Unclassified 2127
324 Ga0501031_0261940 3300049568 Bacteria 1123
325 Ga0501036_0079175 3300049572 Bacteria 2780
326 Ga0501036_0316066 3300049572 Unclassified 1305
327 Ga0501038_0484322 3300049574 Bacteria 948
328 Ga0501039_0060780 3300049575 Bacteria 2926
329 Ga0501039_0084123 3300049575 Bacteria 2478
330 Ga0501039_0243841 3300049575 Bacteria 1413
331 Ga0501040_0061696 3300049576 Unclassified 2579
332 Ga0501040_0076260 3300049576 Bacteria 2318
333 Ga0501040_0080775 3300049576 Bacteria 2253
334 Ga0501040_0280224 3300049576 Bacteria 1191
335 Ga0501041_0137766 3300049577 Bacteria 1521
336 Ga0501042_0134190 3300049578 Bacteria 1785
337 Ga0501042_0407174 3300049578 Unclassified 986
338 Ga0501043_0461647 3300049579 Unclassified 953
339 Ga0501046_0173211 3300049580 Unclassified 1618
340 Ga0501048_0020547 3300049582 Bacteria 4840
341 Ga0501048_0097128 3300049582 Bacteria 2078
342 Ga0501048_0098785 3300049582 Unclassified 2059
343 Ga0501048_0337165 3300049582 Bacteria 1075
344 Ga0501067_0030083 3300049583 Bacteria 3011
345 Ga0501068_0121610 3300049584 Bacteria 1628
346 Ga0501068_0397319 3300049584 Bacteria 889
347 Ga0501068_0735220 3300049584 Unclassified 646
348 Ga0501071_0089390 3300049587 Bacteria 2260
349 Ga0501071_0107316 3300049587 Bacteria 2062
350 Ga0501071_0252145 3300049587 Unclassified 1332
351 Ga0501071_0608798 3300049587 Bacteria 840
352 Ga0501072_0004560 3300049588 Bacteria 10537
353 Ga0501072_0117858 3300049588 Bacteria 2115
354 Ga0501074_0051690 3300049590 Bacteria 2966
355 Ga0501074_0081161 3300049590 Bacteria 2326
356 Ga0501074_0124925 3300049590 Unclassified 1840
357 Ga0501074_0515718 3300049590 Unclassified 847
358 Ga0501075_0022207 3300049591 Bacteria 4633
359 Ga0501075_0079994 3300049591 Bacteria 2474
360 Ga0501075_0121840 3300049591 Bacteria 1985
361 Ga0501075_0154441 3300049591 Bacteria 1750
362 Ga0501076_0034390 3300049592 Bacteria 3961
363 Ga0501076_0069076 3300049592 Bacteria 2823
364 Ga0501076_0122380 3300049592 Unclassified 2107
365 Ga0501076_0430913 3300049592 Unclassified 1085
366 Ga0501076_0464040 3300049592 Unclassified 1043
367 Ga0501076_0606005 3300049592 Bacteria 903
368 Ga0501076_0610104 3300049592 Bacteria 900
369 Ga0501077_0054210 3300049593 Bacteria 2547
370 Ga0501077_0080131 3300049593 Unclassified 2069
371 Ga0501079_0049974 3300049741 Bacteria 3228
372 Ga0501079_0067398 3300049741 Unclassified 2762
373 Ga0501079_0135891 3300049741 Bacteria 1914
374 Ga0501080_0199368 3300049742 Bacteria 1838
375 Ga0501080_0223340 3300049742 Bacteria 1723
376 Ga0501080_0290632 3300049742 Bacteria 1484
377 Ga0501080_0414813 3300049742 Bacteria 1210
378 Ga0501081_0100223 3300049743 Unclassified 2047
379 Ga0501083_0028064 3300049744 Bacteria 3881
380 Ga0501083_0215911 3300049744 Bacteria 1250
381 Ga0501083_0394010 3300049744 Bacteria 901
382 Ga0501035_0186960 3300049822 Bacteria 1783
383 Ga0501035_0899671 3300049822 Bacteria 701
384 Ga0501045_0407774 3300049824 Bacteria 1011
385 nmdc:mga05p37_66992_c1 3300050507 Bacteria 4417
386 nmdc:mga08y16_227512_c1 3300050511 Bacteria 1930
387 nmdc:mga08y16_77301_c1 3300050511 Unclassified 3470
388 nmdc:mga0n895_819260_c1 3300050512 Unclassified 920
389 nmdc:mga0n895_90232_c1 3300050512 Bacteria 3066
390 nmdc:mga0rr50_305024_c1 3300050513 Bacteria 1332
391 nmdc:mga0rr50_382249_c1 3300050513 Unclassified 1187
392 nmdc:mga0a205_134941_c1 3300050515 Unclassified 2368
393 nmdc:mga0a205_59755_c1 3300050515 Bacteria 3682
394 Ga0495601_0063195 3300053077 Bacteria 2353
395 Ga0495612_0000038 3300053078 Bacteria 63146
396 Ga0501084_0022790 3300054114 Bacteria 5227
397 Ga0501084_0064801 3300054114 Bacteria 3057
398 Ga0501084_0103919 3300054114 Unclassified 2386
399 Ga0501084_0108935 3300054114 Bacteria 2327
400 Ga0501084_0168943 3300054114 Bacteria 1846
401 Ga0501084_0185726 3300054114 Bacteria 1755
402 Ga0590075_010722 3300059424 Bacteria 2210
403 Ga0501082_0043689 3300060353 Bacteria 3865
404 Ga0501082_0132880 3300060353 Bacteria 2159
405 Ga0501082_0197887 3300060353 Unclassified 1748
406 Ga0501082_0223694 3300060353 Unclassified 1638
407 Ga0530510_0047457 3300061734 Bacteria 3103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0608798 Ga0501071_0608798_318_809 160
2 3300049578 Ga0501042_0134190 Ga0501042_0134190_1209_1754 168
3 3300049574 Ga0501038_0484322 Ga0501038_0484322_55_591 175
4 3300046683 Ga0495658_0484168 Ga0495658_0484168_11_547 178
5 3300013308 Ga0157375_10681461 Ga0157375_106814612 181
6 3300005536 Ga0070697_100608648 Ga0070697_1006086481 186
7 3300049572 Ga0501036_0079175 Ga0501036_0079175_863_1465 186
8 3300049575 Ga0501039_0060780 Ga0501039_0060780_1204_1806 186
9 3300049577 Ga0501041_0137766 Ga0501041_0137766_420_1022 186
10 3300049582 Ga0501048_0097128 Ga0501048_0097128_70_672 186
11 3300049588 Ga0501072_0117858 Ga0501072_0117858_266_868 186
12 3300049591 Ga0501075_0022207 Ga0501075_0022207_3156_3758 186
13 3300049592 Ga0501076_0034390 Ga0501076_0034390_2628_3230 186
14 3300049593 Ga0501077_0054210 Ga0501077_0054210_393_995 186
15 3300049741 Ga0501079_0135891 Ga0501079_0135891_1002_1604 186
16 3300049742 Ga0501080_0414813 Ga0501080_0414813_144_746 186
17 3300049744 Ga0501083_0394010 Ga0501083_0394010_157_759 186
18 3300049822 Ga0501035_0186960 Ga0501035_0186960_404_1006 186
19 3300054114 Ga0501084_0108935 Ga0501084_0108935_1590_2192 186
20 3300060353 Ga0501082_0132880 Ga0501082_0132880_799_1401 186
21 3300005444 Ga0070694_100042629 Ga0070694_1000426293 187
22 3300005530 Ga0070679_100440902 Ga0070679_1004409022 187
23 3300005546 Ga0070696_100030234 Ga0070696_1000302343 187
24 3300025912 Ga0207707_10050655 Ga0207707_100506554 187
25 3300025917 Ga0207660_10521728 Ga0207660_105217282 187
26 3300042438 Ga0439459_0011285 Ga0439459_0011285_492_1106 187
27 3300049576 Ga0501040_0076260 Ga0501040_0076260_970_1572 187
28 3300049579 Ga0501043_0461647 Ga0501043_0461647_211_813 187
29 3300049582 Ga0501048_0020547 Ga0501048_0020547_1701_2303 187
30 3300049587 Ga0501071_0089390 Ga0501071_0089390_1134_1736 187
31 3300049588 Ga0501072_0004560 Ga0501072_0004560_7719_8321 187
32 3300049592 Ga0501076_0606005 Ga0501076_0606005_168_770 187
33 3300049741 Ga0501079_0049974 Ga0501079_0049974_1743_2345 187
34 3300049744 Ga0501083_0215911 Ga0501083_0215911_538_1140 187
35 3300049822 Ga0501035_0899671 Ga0501035_0899671_41_643 187
36 3300060353 Ga0501082_0043689 Ga0501082_0043689_1028_1630 187
37 3300061734 Ga0530510_0047457 Ga0530510_0047457_142_744 187
38 3300005468 Ga0070707_100081008 Ga0070707_1000810081 188
39 3300005539 Ga0068853_100716547 Ga0068853_1007165472 188
40 3300005545 Ga0070695_100024034 Ga0070695_1000240343 188
41 3300005546 Ga0070696_100016366 Ga0070696_1000163665 188
42 3300006852 Ga0075433_10014759 Ga0075433_100147593 188
43 3300009148 Ga0105243_10316002 Ga0105243_103160021 188
44 3300025921 Ga0207652_10639877 Ga0207652_106398772 188
45 3300035170 Ga0373943_0148665 Ga0373943_0148665_520_1110 188
46 3300048905 Ga0496102_0452772 Ga0496102_0452772_436_1050 188
47 3300050515 nmdc:mga0a205_59755_c1 nmdc:mga0a205_59755_c1_261_875 188
48 3300005445 Ga0070708_100024959 Ga0070708_1000249593 190
49 3300005468 Ga0070707_100004886 Ga0070707_1000048865 190
50 3300005518 Ga0070699_100007497 Ga0070699_1000074974 190
51 3300025910 Ga0207684_10125521 Ga0207684_101255213 190
52 3300025922 Ga0207646_10011280 Ga0207646_100112803 190
53 3300031344 Ga0265316_10408378 Ga0265316_104083781 194
54 3300028563 Ga0265319_1000328 Ga0265319_10003283 195
55 3300028573 Ga0265334_10013999 Ga0265334_100139993 195
56 3300028577 Ga0265318_10002576 Ga0265318_100025762 195
57 3300028577 Ga0265318_10019033 Ga0265318_100190333 195
58 3300028654 Ga0265322_10022995 Ga0265322_100229952 195
59 3300028666 Ga0265336_10003845 Ga0265336_100038454 195
60 3300029957 Ga0265324_10001382 Ga0265324_100013829 195
61 3300031238 Ga0265332_10008206 Ga0265332_100082063 195
62 3300031239 Ga0265328_10148792 Ga0265328_101487921 195
63 3300031240 Ga0265320_10001216 Ga0265320_1000121615 195
64 3300031241 Ga0265325_10019428 Ga0265325_100194283 195
65 3300031242 Ga0265329_10005992 Ga0265329_100059924 195
66 3300031247 Ga0265340_10028824 Ga0265340_100288242 195
67 3300031250 Ga0265331_10062332 Ga0265331_100623322 195
68 3300031344 Ga0265316_10012578 Ga0265316_100125783 195
69 3300031595 Ga0265313_10021065 Ga0265313_100210653 195
70 3300031711 Ga0265314_10001377 Ga0265314_1000137718 195
71 3300049743 Ga0501081_0100223 Ga0501081_0100223_486_1082 195
72 3300049744 Ga0501083_0028064 Ga0501083_0028064_2783_3379 195
73 3300005441 Ga0070700_100732674 Ga0070700_1007326742 196
74 3300009098 Ga0105245_10880347 Ga0105245_108803471 196
75 3300014497 Ga0182008_10205519 Ga0182008_102055192 196
76 3300025916 Ga0207663_10510792 Ga0207663_105107922 196
77 3300026078 Ga0207702_10648900 Ga0207702_106489003 196
78 3300046461 Ga0495641_0307602 Ga0495641_0307602_15_605 196
79 3300046683 Ga0495658_0279836 Ga0495658_0279836_336_926 196
80 3300046690 Ga0495624_0265802 Ga0495624_0265802_128_718 196
81 3300046690 Ga0495624_0328339 Ga0495624_0328339_193_792 196
82 3300048906 Ga0496103_0317679 Ga0496103_0317679_27_617 196
83 3300048907 Ga0496104_0207443 Ga0496104_0207443_220_810 196
84 3300048908 Ga0496105_0047427 Ga0496105_0047427_1915_2505 196
85 3300048910 Ga0496107_0433749 Ga0496107_0433749_81_671 196
86 3300048911 Ga0496108_0007566 Ga0496108_0007566_7009_7599 196
87 3300048912 Ga0496109_0028196 Ga0496109_0028196_547_1137 196
88 3300048912 Ga0496109_0078117 Ga0496109_0078117_860_1450 196
89 3300048912 Ga0496109_0729118 Ga0496109_0729118_251_841 196
90 3300048913 Ga0496110_0131878 Ga0496110_0131878_1061_1651 196
91 3300048914 Ga0496111_0117159 Ga0496111_0117159_899_1489 196
92 3300048914 Ga0496111_0289208 Ga0496111_0289208_223_813 196
93 3300048915 Ga0496112_0351873 Ga0496112_0351873_332_922 196
94 3300048916 Ga0496113_0036897 Ga0496113_0036897_1809_2399 196
95 3300053077 Ga0495601_0063195 Ga0495601_0063195_100_690 196
96 3300005330 Ga0070690_100075975 Ga0070690_1000759753 197
97 3300005331 Ga0070670_100064008 Ga0070670_1000640083 197
98 3300005337 Ga0070682_100076607 Ga0070682_1000766073 197
99 3300005339 Ga0070660_100051831 Ga0070660_1000518313 197
100 3300005341 Ga0070691_10056586 Ga0070691_100565862 197
101 3300005343 Ga0070687_100001646 Ga0070687_1000016463 197
102 3300005345 Ga0070692_10009896 Ga0070692_100098964 197
103 3300005347 Ga0070668_100198582 Ga0070668_1001985822 197
104 3300005347 Ga0070668_100512334 Ga0070668_1005123342 197
105 3300005354 Ga0070675_100009755 Ga0070675_1000097556 197
106 3300005354 Ga0070675_100215817 Ga0070675_1002158172 197
107 3300005355 Ga0070671_100280062 Ga0070671_1002800622 197
108 3300005356 Ga0070674_100016036 Ga0070674_1000160364 197
109 3300005356 Ga0070674_101105209 Ga0070674_1011052091 197
110 3300005364 Ga0070673_100264480 Ga0070673_1002644802 197
111 3300005365 Ga0070688_100046895 Ga0070688_1000468952 197
112 3300005365 Ga0070688_100047029 Ga0070688_1000470293 197
113 3300005366 Ga0070659_100028969 Ga0070659_1000289693 197
114 3300005366 Ga0070659_100228840 Ga0070659_1002288402 197
115 3300005438 Ga0070701_10073658 Ga0070701_100736582 197
116 3300005440 Ga0070705_100028720 Ga0070705_1000287203 197
117 3300005440 Ga0070705_100334121 Ga0070705_1003341211 197
118 3300005441 Ga0070700_100012623 Ga0070700_1000126233 197
119 3300005441 Ga0070700_100146266 Ga0070700_1001462662 197
120 3300005444 Ga0070694_100152708 Ga0070694_1001527082 197
121 3300005444 Ga0070694_100297874 Ga0070694_1002978742 197
122 3300005455 Ga0070663_100048761 Ga0070663_1000487613 197
123 3300005456 Ga0070678_100134495 Ga0070678_1001344953 197
124 3300005456 Ga0070678_100557232 Ga0070678_1005572322 197
125 3300005457 Ga0070662_100009798 Ga0070662_1000097983 197
126 3300005457 Ga0070662_100062242 Ga0070662_1000622424 197
127 3300005466 Ga0070685_10008960 Ga0070685_100089603 197
128 3300005466 Ga0070685_10564758 Ga0070685_105647582 197
129 3300005468 Ga0070707_100311337 Ga0070707_1003113372 197
130 3300005471 Ga0070698_100019428 Ga0070698_1000194283 197
131 3300005536 Ga0070697_100045379 Ga0070697_1000453793 197
132 3300005543 Ga0070672_100004154 Ga0070672_1000041544 197
133 3300005544 Ga0070686_100007093 Ga0070686_1000070932 197
134 3300005545 Ga0070695_100411573 Ga0070695_1004115731 197
135 3300005545 Ga0070695_100412791 Ga0070695_1004127911 197
136 3300005546 Ga0070696_100107623 Ga0070696_1001076232 197
137 3300005546 Ga0070696_100141218 Ga0070696_1001412183 197
138 3300005547 Ga0070693_100029128 Ga0070693_1000291282 197
139 3300005564 Ga0070664_100042758 Ga0070664_1000427582 197
140 3300005578 Ga0068854_100640377 Ga0068854_1006403772 197
141 3300005614 Ga0068856_100432507 Ga0068856_1004325072 197
142 3300005616 Ga0068852_100061769 Ga0068852_1000617692 197
143 3300005617 Ga0068859_100043007 Ga0068859_1000430074 197
144 3300005617 Ga0068859_100926499 Ga0068859_1009264992 197
145 3300005617 Ga0068859_101434562 Ga0068859_1014345622 197
146 3300005618 Ga0068864_100071598 Ga0068864_1000715983 197
147 3300005719 Ga0068861_100117310 Ga0068861_1001173103 197
148 3300005840 Ga0068870_10025943 Ga0068870_100259433 197
149 3300005841 Ga0068863_100052642 Ga0068863_1000526422 197
150 3300005843 Ga0068860_100182361 Ga0068860_1001823612 197
151 3300005844 Ga0068862_100034958 Ga0068862_1000349583 197
152 3300006358 Ga0068871_100132545 Ga0068871_1001325453 197
153 3300006852 Ga0075433_10375518 Ga0075433_103755183 197
154 3300006871 Ga0075434_100026719 Ga0075434_1000267195 197
155 3300006871 Ga0075434_100242312 Ga0075434_1002423122 197
156 3300006881 Ga0068865_100016780 Ga0068865_1000167805 197
157 3300006931 Ga0097620_100043007 Ga0097620_1000430073 197
158 3300006931 Ga0097620_100926625 Ga0097620_1009266252 197
159 3300006931 Ga0097620_101434554 Ga0097620_1014345541 197
160 3300009094 Ga0111539_10023756 Ga0111539_100237562 197
161 3300009094 Ga0111539_10184804 Ga0111539_101848042 197
162 3300009094 Ga0111539_10298977 Ga0111539_102989772 197
163 3300009094 Ga0111539_11142482 Ga0111539_111424822 197
164 3300009098 Ga0105245_10008977 Ga0105245_100089778 197
165 3300009098 Ga0105245_10050122 Ga0105245_100501222 197
166 3300009098 Ga0105245_10555653 Ga0105245_105556532 197
167 3300009098 Ga0105245_11019332 Ga0105245_110193322 197
168 3300009147 Ga0114129_10207554 Ga0114129_102075542 197
169 3300009147 Ga0114129_10221869 Ga0114129_102218693 197
170 3300009148 Ga0105243_10049945 Ga0105243_100499453 197
171 3300009148 Ga0105243_10141621 Ga0105243_101416213 197
172 3300009148 Ga0105243_10961350 Ga0105243_109613501 197
173 3300009176 Ga0105242_10097879 Ga0105242_100978792 197
174 3300009177 Ga0105248_10347694 Ga0105248_103476943 197
175 3300009545 Ga0105237_10342284 Ga0105237_103422842 197
176 3300009551 Ga0105238_10154545 Ga0105238_101545453 197
177 3300009553 Ga0105249_10226554 Ga0105249_102265542 197
178 3300009553 Ga0105249_10613100 Ga0105249_106131002 197
179 3300010375 Ga0105239_10388927 Ga0105239_103889273 197
180 3300010375 Ga0105239_10409398 Ga0105239_104093982 197
181 3300013297 Ga0157378_10003853 Ga0157378_100038539 197
182 3300013306 Ga0163162_10049315 Ga0163162_100493153 197
183 3300013308 Ga0157375_10063639 Ga0157375_100636394 197
184 3300014325 Ga0163163_10185340 Ga0163163_101853402 197
185 3300014325 Ga0163163_10227519 Ga0163163_102275193 197
186 3300014326 Ga0157380_10018786 Ga0157380_100187863 197
187 3300014326 Ga0157380_10218512 Ga0157380_102185122 197
188 3300014745 Ga0157377_10036266 Ga0157377_100362663 197
189 3300014968 Ga0157379_10104771 Ga0157379_101047713 197
190 3300014968 Ga0157379_10170152 Ga0157379_101701521 197
191 3300014969 Ga0157376_11091521 Ga0157376_110915211 197
192 3300025901 Ga0207688_10011563 Ga0207688_100115633 197
193 3300025901 Ga0207688_10022187 Ga0207688_100221873 197
194 3300025907 Ga0207645_10061729 Ga0207645_100617293 197
195 3300025908 Ga0207643_10003186 Ga0207643_100031864 197
196 3300025918 Ga0207662_10006805 Ga0207662_100068054 197
197 3300025919 Ga0207657_10072148 Ga0207657_100721483 197
198 3300025920 Ga0207649_10294193 Ga0207649_102941932 197
199 3300025921 Ga0207652_10387287 Ga0207652_103872871 197
200 3300025922 Ga0207646_10247552 Ga0207646_102475523 197
201 3300025923 Ga0207681_10464799 Ga0207681_104647992 197
202 3300025924 Ga0207694_10246459 Ga0207694_102464593 197
203 3300025925 Ga0207650_10119877 Ga0207650_101198772 197
204 3300025926 Ga0207659_10061193 Ga0207659_100611933 197
205 3300025926 Ga0207659_10563166 Ga0207659_105631662 197
206 3300025927 Ga0207687_10007474 Ga0207687_100074747 197
207 3300025932 Ga0207690_10004793 Ga0207690_100047935 197
208 3300025933 Ga0207706_10011682 Ga0207706_100116826 197
209 3300025933 Ga0207706_10054995 Ga0207706_100549954 197
210 3300025933 Ga0207706_10229650 Ga0207706_102296502 197
211 3300025934 Ga0207686_10144667 Ga0207686_101446672 197
212 3300025936 Ga0207670_10043397 Ga0207670_100433972 197
213 3300025937 Ga0207669_10040203 Ga0207669_100402033 197
214 3300025938 Ga0207704_10067879 Ga0207704_100678793 197
215 3300025940 Ga0207691_10018229 Ga0207691_100182296 197
216 3300025941 Ga0207711_10036994 Ga0207711_100369943 197
217 3300025944 Ga0207661_10155666 Ga0207661_101556662 197
218 3300025961 Ga0207712_10372902 Ga0207712_103729022 197
219 3300026023 Ga0207677_10767622 Ga0207677_107676221 197
220 3300026067 Ga0207678_10006210 Ga0207678_100062107 197
221 3300026075 Ga0207708_10004891 Ga0207708_100048918 197
222 3300026075 Ga0207708_10060270 Ga0207708_100602703 197
223 3300026075 Ga0207708_10167719 Ga0207708_101677193 197
224 3300026075 Ga0207708_10269360 Ga0207708_102693602 197
225 3300026078 Ga0207702_10083416 Ga0207702_100834162 197
226 3300026088 Ga0207641_10077430 Ga0207641_100774303 197
227 3300026089 Ga0207648_10003311 Ga0207648_100033114 197
228 3300026116 Ga0207674_10165703 Ga0207674_101657032 197
229 3300026116 Ga0207674_10183882 Ga0207674_101838822 197
230 3300026118 Ga0207675_100061926 Ga0207675_1000619263 197
231 3300026118 Ga0207675_100724912 Ga0207675_1007249122 197
232 3300026118 Ga0207675_100812500 Ga0207675_1008125002 197
233 3300026121 Ga0207683_10129394 Ga0207683_101293942 197
234 3300026121 Ga0207683_10381525 Ga0207683_103815252 197
235 3300026142 Ga0207698_10158718 Ga0207698_101587182 197
236 3300027907 Ga0207428_10326342 Ga0207428_103263422 197
237 3300028380 Ga0268265_10144267 Ga0268265_101442672 197
238 3300028381 Ga0268264_10161409 Ga0268264_101614092 197
239 3300031548 Ga0307408_100371732 Ga0307408_1003717322 197
240 3300031731 Ga0307405_10144284 Ga0307405_101442843 197
241 3300031995 Ga0307409_100089607 Ga0307409_1000896073 197
242 3300032002 Ga0307416_100003174 Ga0307416_1000031743 197
243 3300032126 Ga0307415_100027934 Ga0307415_1000279343 197
244 3300035092 Ga0373952_0033735 Ga0373952_0033735_183_785 197
245 3300035691 Ga0373931_0019661 Ga0373931_0019661_1933_2535 197
246 3300036401 Ga0373937_0901325 Ga0373937_0901325_79_681 197
247 3300046491 Ga0495584_0168635 Ga0495584_0168635_466_1068 197
248 3300046615 Ga0495656_0239077 Ga0495656_0239077_282_884 197
249 3300046642 Ga0495634_0134190 Ga0495634_0134190_54_656 197
250 3300048903 Ga0496100_0599068 Ga0496100_0599068_61_663 197
251 3300048904 Ga0496101_0409032 Ga0496101_0409032_103_699 197
252 3300048905 Ga0496102_0090867 Ga0496102_0090867_10_633 197
253 3300048905 Ga0496102_0300276 Ga0496102_0300276_828_1430 197
254 3300048905 Ga0496102_0658076 Ga0496102_0658076_171_773 197
255 3300048906 Ga0496103_0096170 Ga0496103_0096170_254_856 197
256 3300048909 Ga0496106_0141872 Ga0496106_0141872_679_1281 197
257 3300048909 Ga0496106_0505566 Ga0496106_0505566_89_712 197
258 3300048910 Ga0496107_0131683 Ga0496107_0131683_990_1592 197
259 3300048911 Ga0496108_0094448 Ga0496108_0094448_380_982 197
260 3300048911 Ga0496108_0601433 Ga0496108_0601433_311_907 197
261 3300048912 Ga0496109_0013747 Ga0496109_0013747_2354_2956 197
262 3300048912 Ga0496109_0172570 Ga0496109_0172570_334_936 197
263 3300048913 Ga0496110_0067858 Ga0496110_0067858_995_1597 197
264 3300048914 Ga0496111_0019567 Ga0496111_0019567_1000_1602 197
265 3300048915 Ga0496112_0591388 Ga0496112_0591388_259_861 197
266 3300048916 Ga0496113_0046040 Ga0496113_0046040_874_1476 197
267 3300048917 Ga0496114_0098169 Ga0496114_0098169_778_1380 197
268 3300048917 Ga0496114_0490369 Ga0496114_0490369_396_998 197
269 3300049568 Ga0501031_0080219 Ga0501031_0080219_984_1586 197
270 3300049568 Ga0501031_0261940 Ga0501031_0261940_273_875 197
271 3300049572 Ga0501036_0316066 Ga0501036_0316066_318_920 197
272 3300049575 Ga0501039_0084123 Ga0501039_0084123_1019_1621 197
273 3300049575 Ga0501039_0243841 Ga0501039_0243841_598_1200 197
274 3300049576 Ga0501040_0061696 Ga0501040_0061696_793_1395 197
275 3300049576 Ga0501040_0080775 Ga0501040_0080775_936_1538 197
276 3300049576 Ga0501040_0280224 Ga0501040_0280224_562_1164 197
277 3300049578 Ga0501042_0407174 Ga0501042_0407174_51_653 197
278 3300049580 Ga0501046_0173211 Ga0501046_0173211_449_1051 197
279 3300049582 Ga0501048_0098785 Ga0501048_0098785_891_1493 197
280 3300049582 Ga0501048_0337165 Ga0501048_0337165_326_928 197
281 3300049583 Ga0501067_0030083 Ga0501067_0030083_1024_1626 197
282 3300049584 Ga0501068_0121610 Ga0501068_0121610_785_1387 197
283 3300049584 Ga0501068_0397319 Ga0501068_0397319_251_853 197
284 3300049584 Ga0501068_0735220 Ga0501068_0735220_33_635 197
285 3300049587 Ga0501071_0107316 Ga0501071_0107316_675_1277 197
286 3300049587 Ga0501071_0252145 Ga0501071_0252145_325_927 197
287 3300049590 Ga0501074_0051690 Ga0501074_0051690_2253_2855 197
288 3300049590 Ga0501074_0081161 Ga0501074_0081161_570_1172 197
289 3300049590 Ga0501074_0124925 Ga0501074_0124925_113_715 197
290 3300049590 Ga0501074_0515718 Ga0501074_0515718_49_651 197
291 3300049591 Ga0501075_0079994 Ga0501075_0079994_733_1335 197
292 3300049591 Ga0501075_0121840 Ga0501075_0121840_1124_1726 197
293 3300049591 Ga0501075_0154441 Ga0501075_0154441_343_945 197
294 3300049592 Ga0501076_0069076 Ga0501076_0069076_1075_1677 197
295 3300049592 Ga0501076_0122380 Ga0501076_0122380_802_1404 197
296 3300049592 Ga0501076_0430913 Ga0501076_0430913_283_885 197
297 3300049592 Ga0501076_0464040 Ga0501076_0464040_39_641 197
298 3300049592 Ga0501076_0610104 Ga0501076_0610104_126_728 197
299 3300049593 Ga0501077_0080131 Ga0501077_0080131_917_1519 197
300 3300049741 Ga0501079_0067398 Ga0501079_0067398_747_1349 197
301 3300049742 Ga0501080_0199368 Ga0501080_0199368_604_1206 197
302 3300049742 Ga0501080_0223340 Ga0501080_0223340_98_700 197
303 3300049742 Ga0501080_0290632 Ga0501080_0290632_725_1327 197
304 3300049824 Ga0501045_0407774 Ga0501045_0407774_57_659 197
305 3300050507 nmdc:mga05p37_66992_c1 nmdc:mga05p37_66992_c1_1267_1869 197
306 3300050511 nmdc:mga08y16_227512_c1 nmdc:mga08y16_227512_c1_1172_1774 197
307 3300050511 nmdc:mga08y16_77301_c1 nmdc:mga08y16_77301_c1_2423_3025 197
308 3300050512 nmdc:mga0n895_819260_c1 nmdc:mga0n895_819260_c1_215_817 197
309 3300050512 nmdc:mga0n895_90232_c1 nmdc:mga0n895_90232_c1_2115_2738 197
310 3300050513 nmdc:mga0rr50_305024_c1 nmdc:mga0rr50_305024_c1_468_1070 197
311 3300050513 nmdc:mga0rr50_382249_c1 nmdc:mga0rr50_382249_c1_27_629 197
312 3300050515 nmdc:mga0a205_134941_c1 nmdc:mga0a205_134941_c1_895_1518 197
313 3300054114 Ga0501084_0022790 Ga0501084_0022790_2241_2843 197
314 3300054114 Ga0501084_0064801 Ga0501084_0064801_1201_1803 197
315 3300054114 Ga0501084_0103919 Ga0501084_0103919_744_1346 197
316 3300054114 Ga0501084_0168943 Ga0501084_0168943_278_880 197
317 3300054114 Ga0501084_0185726 Ga0501084_0185726_848_1450 197
318 3300060353 Ga0501082_0197887 Ga0501082_0197887_495_1097 197
319 3300060353 Ga0501082_0223694 Ga0501082_0223694_14_616 197
320 3300031548 Ga0307408_100107833 Ga0307408_1001078333 198
321 3300031824 Ga0307413_10434209 Ga0307413_104342092 198
322 3300031901 Ga0307406_10211608 Ga0307406_102116082 198
323 3300031911 Ga0307412_10087146 Ga0307412_100871462 198
324 3300005338 Ga0068868_100151874 Ga0068868_1001518742 199
325 3300005367 Ga0070667_100120020 Ga0070667_1001200202 199
326 3300005440 Ga0070705_100085806 Ga0070705_1000858064 199
327 3300005544 Ga0070686_100136480 Ga0070686_1001364801 199
328 3300005547 Ga0070693_100168574 Ga0070693_1001685742 199
329 3300005842 Ga0068858_100323617 Ga0068858_1003236172 199
330 3300009177 Ga0105248_10716976 Ga0105248_107169761 199
331 3300014969 Ga0157376_10345806 Ga0157376_103458062 199
332 3300025918 Ga0207662_10049722 Ga0207662_100497222 199
333 3300025926 Ga0207659_10175294 Ga0207659_101752942 199
334 3300026118 Ga0207675_100441202 Ga0207675_1004412023 199
335 3300028381 Ga0268264_10253654 Ga0268264_102536542 199
336 3300048905 Ga0496102_0097523 Ga0496102_0097523_888_1487 199
337 3300005336 Ga0070680_100407246 Ga0070680_1004072462 200
338 3300005444 Ga0070694_100001796 Ga0070694_1000017963 200
339 3300005458 Ga0070681_10148222 Ga0070681_101482222 200
340 3300005467 Ga0070706_100000392 Ga0070706_10000039224 200
341 3300005468 Ga0070707_100002855 Ga0070707_1000028555 200
342 3300005530 Ga0070679_100832148 Ga0070679_1008321482 200
343 3300005536 Ga0070697_100170767 Ga0070697_1001707672 200
344 3300005536 Ga0070697_100461694 Ga0070697_1004616941 200
345 3300005545 Ga0070695_100005055 Ga0070695_1000050553 200
346 3300005547 Ga0070693_100303505 Ga0070693_1003035052 200
347 3300005549 Ga0070704_100003100 Ga0070704_10000310010 200
348 3300005549 Ga0070704_100144546 Ga0070704_1001445462 200
349 3300005549 Ga0070704_100485063 Ga0070704_1004850631 200
350 3300005563 Ga0068855_100200810 Ga0068855_1002008102 200
351 3300005615 Ga0070702_100187553 Ga0070702_1001875532 200
352 3300005842 Ga0068858_100572839 Ga0068858_1005728392 200
353 3300005843 Ga0068860_100046232 Ga0068860_1000462322 200
354 3300005843 Ga0068860_100161559 Ga0068860_1001615592 200
355 3300005844 Ga0068862_100167019 Ga0068862_1001670192 200
356 3300009148 Ga0105243_10132241 Ga0105243_101322412 200
357 3300009553 Ga0105249_10013933 Ga0105249_100139337 200
358 3300009553 Ga0105249_10699163 Ga0105249_106991632 200
359 3300010159 Ga0099796_10086419 Ga0099796_100864191 200
360 3300010375 Ga0105239_10179802 Ga0105239_101798022 200
361 3300013306 Ga0163162_10451012 Ga0163162_104510121 200
362 3300013307 Ga0157372_10774009 Ga0157372_107740092 200
363 3300014968 Ga0157379_10016227 Ga0157379_100162273 200
364 3300025910 Ga0207684_10000852 Ga0207684_1000085221 200
365 3300025910 Ga0207684_10004740 Ga0207684_100047402 200
366 3300025911 Ga0207654_10152605 Ga0207654_101526052 200
367 3300025918 Ga0207662_10523828 Ga0207662_105238282 200
368 3300025922 Ga0207646_10008240 Ga0207646_1000824013 200
369 3300025922 Ga0207646_10186377 Ga0207646_101863771 200
370 3300025922 Ga0207646_11011516 Ga0207646_110115162 200
371 3300025935 Ga0207709_10106741 Ga0207709_101067412 200
372 3300025939 Ga0207665_10364668 Ga0207665_103646682 200
373 3300025949 Ga0207667_10282701 Ga0207667_102827012 200
374 3300026035 Ga0207703_10419085 Ga0207703_104190852 200
375 3300028380 Ga0268265_10094981 Ga0268265_100949813 200
376 3300028381 Ga0268264_10532395 Ga0268264_105323952 200
377 3300028381 Ga0268264_10684263 Ga0268264_106842632 200
378 3300045051 Ga0451576_0973829 Ga0451576_0973829_85_687 200
379 3300048905 Ga0496102_0422855 Ga0496102_0422855_35_649 200
380 3300048906 Ga0496103_0001712 Ga0496103_0001712_1420_2034 200
381 3300048906 Ga0496103_0263170 Ga0496103_0263170_256_870 200
382 3300048909 Ga0496106_0202446 Ga0496106_0202446_595_1197 200
383 3300048910 Ga0496107_0100065 Ga0496107_0100065_732_1346 200
384 3300053078 Ga0495612_0000038 Ga0495612_0000038_61035_61637 200
385 3300005330 Ga0070690_100029840 Ga0070690_1000298402 201
386 3300005536 Ga0070697_100477205 Ga0070697_1004772052 201
387 3300005544 Ga0070686_100106426 Ga0070686_1001064263 201
388 3300005546 Ga0070696_100191027 Ga0070696_1001910271 201
389 3300005614 Ga0068856_100780680 Ga0068856_1007806802 201
390 3300005618 Ga0068864_100063154 Ga0068864_1000631545 201
391 3300005841 Ga0068863_100345189 Ga0068863_1003451892 201
392 3300005985 Ga0081539_10009700 Ga0081539_100097002 201
393 3300014325 Ga0163163_10226401 Ga0163163_102264012 201
394 3300014745 Ga0157377_10231200 Ga0157377_102312002 201
395 3300026078 Ga0207702_10094232 Ga0207702_100942324 201
396 3300026095 Ga0207676_10036479 Ga0207676_100364795 201
397 3300038443 Ga0395901_0220678 Ga0395901_0220678_129_737 201
398 3300048903 Ga0496100_0544844 Ga0496100_0544844_136_741 201
399 3300048907 Ga0496104_0028099 Ga0496104_0028099_1470_2075 201
400 3300048908 Ga0496105_0039959 Ga0496105_0039959_996_1601 201
401 3300048911 Ga0496108_0033489 Ga0496108_0033489_400_1005 201
402 3300048912 Ga0496109_0029721 Ga0496109_0029721_1695_2300 201
403 3300048913 Ga0496110_0076448 Ga0496110_0076448_1899_2504 201
404 3300048914 Ga0496111_0035160 Ga0496111_0035160_2405_3010 201
405 3300048915 Ga0496112_0034363 Ga0496112_0034363_528_1133 201
406 3300048916 Ga0496113_0120505 Ga0496113_0120505_875_1480 201
407 3300059424 Ga0590075_010722 Ga0590075_010722_112_729 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

70

218

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.8485 38 199
1wyw-assembly1.cif.gz_A crystal structure of sumo1-conjugated thymine dna glycosylase 0.8413 35 199
3uo7-assembly1.cif.gz_A crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine 0.8312 38 199
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.8204 38 199
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.8173 40 197
ID Description Score Start End Superfamily
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8439 35 197 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8424 35 199 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8188 35 197 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8173 40 197 3.40.470.10
2d07A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.817 35 199 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A536GD99-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9911 15 201 GO:0004844
GO:0006285
GO:0008263
AF-A0A7W0U913-F1-model_v4 UPF0175 family protein 0.9493 35 195 GO:0004844
GO:0006285
GO:0008263
AF-A0A536GD99-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.941 15 201 GO:0004844
GO:0006285
GO:0008263
AF-A0A7Y0CVB7-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.926 35 197 GO:0004844
GO:0006285
GO:0008263
AF-A0A355BFN1-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9022 35 199 GO:0004844
GO:0006285
GO:0008263

Feature Viewer

pLDDT pTM Quality
91.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map