F436296

General Info

Members Datasets Scaffolds Average Seq Length
406 225 812 147

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0118468|Ga0495592_0118468_487_921
Length 144
Sequence MKWVTRENANVDRIACPWLIKRFIDPEAEFLFVGREEVLTVAQREGATSYDAPGATYTHREGKCSFDVLVEEFGLTGDPALVRLAEIVHAADVSGDIDTSPEGRGLSAIAHGFALLHGTQDHRKIELETPMYDALYAWCEQRTA

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 4.68
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 25.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0118468 3300046454 Bacteria 1865
2 JGI24751J29686_10023790 3300002459 Bacteria 1270
3 JGI25407J50210_10001269 3300003373 Bacteria 5657
4 Ga0065712_10498104 3300005290 Unclassified 651
5 Ga0070658_10169834 3300005327 Bacteria 1832
6 Ga0070676_10256945 3300005328 Unclassified 1168
7 Ga0070683_100079247 3300005329 Unclassified 3074
8 Ga0070670_100002220 3300005331 Bacteria 15950
9 Ga0068869_100138895 3300005334 Bacteria 1874
10 Ga0070682_100003605 3300005337 Bacteria 8581
11 Ga0068868_100036890 3300005338 Unclassified 3786
12 Ga0070689_100027027 3300005340 Unclassified 4324
13 Ga0070661_100213577 3300005344 Bacteria 1478
14 Ga0070692_10018347 3300005345 Unclassified 3363
15 Ga0070675_100055005 3300005354 Unclassified 3275
16 Ga0070671_100326331 3300005355 Unclassified 1308
17 Ga0070674_100009121 3300005356 Bacteria 5933
18 Ga0070673_100015317 3300005364 Bacteria 5381
19 Ga0070688_100001471 3300005365 Bacteria 11702
20 Ga0070659_100026542 3300005366 Unclassified 4458
21 Ga0070667_100457344 3300005367 Unclassified 1167
22 Ga0070703_10073197 3300005406 Unclassified 1149
23 Ga0070714_100886327 3300005435 Bacteria 866
24 Ga0070701_10000686 3300005438 Bacteria 11985
25 Ga0070701_10307149 3300005438 Bacteria 977
26 Ga0070705_100211052 3300005440 Unclassified 1338
27 Ga0070705_100319152 3300005440 Bacteria 1121
28 Ga0070700_100035587 3300005441 Bacteria 3014
29 Ga0070708_100003324 3300005445 Bacteria 12575
30 Ga0070708_100090528 3300005445 Bacteria 2785
31 Ga0070708_100339085 3300005445 Unclassified 1417
32 Ga0070708_100411782 3300005445 Bacteria 1275
33 Ga0070708_100786090 3300005445 Unclassified 895
34 Ga0070663_100017720 3300005455 Unclassified 4654
35 Ga0070678_101562900 3300005456 Unclassified 619
36 Ga0070681_10615797 3300005458 Unclassified 1000
37 Ga0068867_100067347 3300005459 Bacteria 2669
38 Ga0070685_10111205 3300005466 Unclassified 1687
39 Ga0070706_100003430 3300005467 Bacteria 15621
40 Ga0070706_100118665 3300005467 Bacteria 2465
41 Ga0070706_100399887 3300005467 Bacteria 1279
42 Ga0070706_100404547 3300005467 Unclassified 1271
43 Ga0070706_100558021 3300005467 Unclassified 1065
44 Ga0070706_100563286 3300005467 Bacteria 1060
45 Ga0070706_100815157 3300005467 Bacteria 864
46 Ga0070706_101051712 3300005467 Bacteria 750
47 Ga0070707_100062539 3300005468 Bacteria 3571
48 Ga0070707_100143503 3300005468 Bacteria 2323
49 Ga0070707_100178384 3300005468 Bacteria 2071
50 Ga0070707_100536022 3300005468 Unclassified 1133
51 Ga0070707_100670436 3300005468 Bacteria 1000
52 Ga0070698_100001355 3300005471 Bacteria 27231
53 Ga0070698_100046547 3300005471 Bacteria 4435
54 Ga0070698_100075289 3300005471 Archaea 3380
55 Ga0070698_100103528 3300005471 Bacteria 2817
56 Ga0070698_100133973 3300005471 Bacteria 2432
57 Ga0070698_100598659 3300005471 Unclassified 1043
58 Ga0070698_100668639 3300005471 Bacteria 980
59 Ga0070699_100045209 3300005518 Bacteria 3811
60 Ga0070699_100160571 3300005518 Bacteria 1989
61 Ga0070699_100821172 3300005518 Bacteria 851
62 Ga0070699_101443129 3300005518 Bacteria 631
63 Ga0070679_100034605 3300005530 Bacteria 5006
64 Ga0070684_100062562 3300005535 Unclassified 3260
65 Ga0070697_100505249 3300005536 Unclassified 1057
66 Ga0068853_100152387 3300005539 Bacteria 2081
67 Ga0070672_100056862 3300005543 Bacteria 3069
68 Ga0070686_100137537 3300005544 Bacteria 1697
69 Ga0070686_100272373 3300005544 Bacteria 1245
70 Ga0070695_100122415 3300005545 Bacteria 1781
71 Ga0070696_100247254 3300005546 Bacteria 1347
72 Ga0070696_100396440 3300005546 Unclassified 1079
73 Ga0070693_100056762 3300005547 Bacteria 2261
74 Ga0070704_100043743 3300005549 Unclassified 3106
75 Ga0068855_100345850 3300005563 Bacteria 1639
76 Ga0070664_100154430 3300005564 Bacteria 2028
77 Ga0068857_100046538 3300005577 Bacteria 3850
78 Ga0068857_100189083 3300005577 Bacteria 1875
79 Ga0068856_100270126 3300005614 Bacteria 1716
80 Ga0070702_100016920 3300005615 Unclassified 3753
81 Ga0068852_100002221 3300005616 Bacteria 13311
82 Ga0068864_100011203 3300005618 Bacteria 7411
83 Ga0068861_100226349 3300005719 Bacteria 1584
84 Ga0068870_10002693 3300005840 Bacteria 7446
85 Ga0068870_10014665 3300005840 Unclassified 3705
86 Ga0068858_100018557 3300005842 Bacteria 6513
87 Ga0068860_100052933 3300005843 Unclassified 3860
88 Ga0068862_100303547 3300005844 Bacteria 1469
89 Ga0081455_10026386 3300005937 Bacteria 5344
90 Ga0081455_10161199 3300005937 Bacteria 1719
91 Ga0081455_10547398 3300005937 Unclassified 766
92 Ga0081538_10000063 3300005981 Bacteria 99624
93 Ga0081540_1078113 3300005983 Bacteria 1502
94 Ga0081539_10000840 3300005985 Bacteria 58916
95 Ga0081539_10054040 3300005985 Bacteria 2245
96 Ga0081539_10082502 3300005985 Bacteria 1685
97 Ga0081539_10173492 3300005985 Bacteria 1017
98 Ga0081539_10187903 3300005985 Bacteria 964
99 Ga0070717_10493653 3300006028 Bacteria 1106
100 Ga0070717_10940607 3300006028 Bacteria 787
101 Ga0075365_10501141 3300006038 Bacteria 858
102 Ga0068871_100931623 3300006358 Unclassified 806
103 Ga0075428_100654053 3300006844 Bacteria 1121
104 Ga0075433_10055552 3300006852 Bacteria 3457
105 Ga0075433_10260467 3300006852 Bacteria 1537
106 Ga0075434_100024968 3300006871 Bacteria 5844
107 Ga0075434_102029909 3300006871 Bacteria 580
108 Ga0068865_100016654 3300006881 Unclassified 4709
109 Ga0068865_100091179 3300006881 Bacteria 2211
110 Ga0075435_100020556 3300007076 Bacteria 5062
111 Ga0075435_100320742 3300007076 Bacteria 1326
112 Ga0075435_100610809 3300007076 Bacteria 946
113 Ga0111539_10082800 3300009094 Unclassified 3774
114 Ga0111539_12704583 3300009094 Bacteria 575
115 Ga0105245_10063672 3300009098 Unclassified 3331
116 Ga0105247_10245672 3300009101 Unclassified 1221
117 Ga0114129_10027794 3300009147 Bacteria 8010
118 Ga0114129_10063759 3300009147 Bacteria 5144
119 Ga0114129_10101974 3300009147 Bacteria 3969
120 Ga0114129_10218179 3300009147 Bacteria 2575
121 Ga0114129_11331541 3300009147 Bacteria 889
122 Ga0114129_11836542 3300009147 Unclassified 736
123 Ga0114129_12785979 3300009147 Unclassified 581
124 Ga0105241_10137409 3300009174 Bacteria 1986
125 Ga0105242_10009325 3300009176 Bacteria 7537
126 Ga0105242_10064324 3300009176 Bacteria 3024
127 Ga0105248_10024692 3300009177 Bacteria 6684
128 Ga0105238_10886757 3300009551 Unclassified 910
129 Ga0105249_10034604 3300009553 Unclassified 4579
130 Ga0099796_10022918 3300010159 Bacteria 1943
131 Ga0105239_10038870 3300010375 Bacteria 5213
132 Ga0105246_10064535 3300011119 Bacteria 2558
133 Ga0157374_10041715 3300013296 Unclassified 4231
134 Ga0157378_10498749 3300013297 Unclassified 1216
135 Ga0157378_10652306 3300013297 Bacteria 1068
136 Ga0163162_10094792 3300013306 Bacteria 3071
137 Ga0157375_10004142 3300013308 Bacteria 12582
138 Ga0163163_10047313 3300014325 Unclassified 4228
139 Ga0157380_10014324 3300014326 Bacteria 5800
140 Ga0182008_10076062 3300014497 Unclassified 1652
141 Ga0182008_10899167 3300014497 Bacteria 521
142 Ga0157377_10080745 3300014745 Bacteria 1901
143 Ga0157379_10038451 3300014968 Unclassified 4269
144 Ga0157376_10340173 3300014969 Bacteria 1433
145 Ga0157376_12452923 3300014969 Unclassified 561
146 Ga0163161_10034119 3300017792 Bacteria 3638
147 Ga0207653_10041448 3300025885 Bacteria 1512
148 Ga0207653_10148640 3300025885 Unclassified 861
149 Ga0207710_10127021 3300025900 Unclassified 1222
150 Ga0207688_10005129 3300025901 Bacteria 7115
151 Ga0207643_10005589 3300025908 Bacteria 6719
152 Ga0207643_10030528 3300025908 Unclassified 3000
153 Ga0207684_10000259 3300025910 Bacteria 78593
154 Ga0207684_10010676 3300025910 Bacteria 8067
155 Ga0207684_10554772 3300025910 Unclassified 983
156 Ga0207684_10945300 3300025910 Bacteria 723
157 Ga0207707_10727366 3300025912 Unclassified 832
158 Ga0207646_10002941 3300025922 Bacteria 19744
159 Ga0207646_10172203 3300025922 Bacteria 1955
160 Ga0207646_10269354 3300025922 Bacteria 1539
161 Ga0207646_11234241 3300025922 Bacteria 655
162 Ga0207646_11606840 3300025922 Bacteria 561
163 Ga0207694_10661523 3300025924 Unclassified 880
164 Ga0207650_10003461 3300025925 Bacteria 10845
165 Ga0207659_10040666 3300025926 Unclassified 3252
166 Ga0207687_10146658 3300025927 Bacteria 1796
167 Ga0207644_10601031 3300025931 Unclassified 913
168 Ga0207690_10133403 3300025932 Bacteria 1820
169 Ga0207686_10016639 3300025934 Unclassified 4128
170 Ga0207686_10222784 3300025934 Bacteria 1363
171 Ga0207670_10022325 3300025936 Unclassified 3920
172 Ga0207669_10315926 3300025937 Bacteria 1193
173 Ga0207704_10359482 3300025938 Unclassified 1136
174 Ga0207691_10047915 3300025940 Unclassified 3919
175 Ga0207711_10070523 3300025941 Unclassified 3031
176 Ga0207689_10031152 3300025942 Bacteria 4443
177 Ga0207661_10122212 3300025944 Bacteria 2218
178 Ga0207679_10423930 3300025945 Unclassified 1175
179 Ga0207712_11196763 3300025961 Unclassified 678
180 Ga0207640_10551774 3300025981 Bacteria 968
181 Ga0207658_10728158 3300025986 Unclassified 897
182 Ga0207677_10362802 3300026023 Bacteria 1217
183 Ga0207703_10130637 3300026035 Bacteria 2168
184 Ga0207639_10135342 3300026041 Bacteria 2045
185 Ga0207708_10017762 3300026075 Bacteria 5355
186 Ga0207702_10220453 3300026078 Bacteria 1767
187 Ga0207648_10298374 3300026089 Bacteria 1445
188 Ga0207674_10035025 3300026116 Bacteria 5241
189 Ga0207674_10245392 3300026116 Bacteria 1738
190 Ga0207675_100230874 3300026118 Bacteria 1785
191 Ga0207683_10194416 3300026121 Bacteria 1843
192 Ga0207698_10620322 3300026142 Unclassified 1068
193 Ga0268265_10117333 3300028380 Bacteria 2186
194 Ga0268264_10354875 3300028381 Bacteria 1397
195 Ga0268264_12000059 3300028381 Unclassified 589
196 Ga0307413_10108614 3300031824 Bacteria 1852
197 Ga0307406_10024977 3300031901 Bacteria 3573
198 Ga0307412_10918086 3300031911 Unclassified 768
199 Ga0307409_100066381 3300031995 Bacteria 2845
200 Ga0307416_100125136 3300032002 Bacteria 2301
201 Ga0307416_100255922 3300032002 Bacteria 1707
202 Ga0307416_100778733 3300032002 Bacteria 1051
203 Ga0307415_100000015 3300032126 Bacteria 79927
204 Ga0373959_0040651 3300034820 Unclassified 974
205 Ga0373938_0113599 3300034957 Unclassified 692
206 Ga0373928_0080425 3300035084 Unclassified 821
207 Ga0373952_0073151 3300035092 Bacteria 861
208 Ga0373939_0283228 3300035114 Unclassified 655
209 Ga0373941_0010453 3300035115 Bacteria 2371
210 Ga0373943_0653141 3300035170 Bacteria 622
211 Ga0373943_0813903 3300035170 Unclassified 556
212 Ga0373946_0364745 3300035171 Unclassified 724
213 Ga0373955_0298049 3300035172 Unclassified 972
214 Ga0373947_0001863 3300035725 Bacteria 12852
215 Ga0373947_0573930 3300035725 Bacteria 768
216 Ga0373937_0025897 3300036401 Bacteria 5297
217 Ga0373925_0033785 3300037068 Bacteria 3769
218 Ga0373925_0413729 3300037068 Unclassified 1101
219 Ga0373925_0766543 3300037068 Bacteria 795
220 Ga0395899_0018483 3300037312 Bacteria 5299
221 Ga0395899_0026098 3300037312 Bacteria 4409
222 Ga0395899_0037935 3300037312 Bacteria 3612
223 Ga0395899_0091167 3300037312 Bacteria 2209
224 Ga0395899_0190251 3300037312 Unclassified 1436
225 Ga0395899_0539790 3300037312 Bacteria 751
226 Ga0395900_0007281 3300037418 Bacteria 11456
227 Ga0395900_0007815 3300037418 Bacteria 11023
228 Ga0395900_0017339 3300037418 Bacteria 7351
229 Ga0395900_0033372 3300037418 Bacteria 5297
230 Ga0395900_0109113 3300037418 Bacteria 2843
231 Ga0395900_0109757 3300037418 Bacteria 2834
232 Ga0395900_0123454 3300037418 Bacteria 2656
233 Ga0395900_0160140 3300037418 Bacteria 2296
234 Ga0395900_0168310 3300037418 Bacteria 2232
235 Ga0395900_0171679 3300037418 Bacteria 2207
236 Ga0395900_0299837 3300037418 Bacteria 1594
237 Ga0395900_0381636 3300037418 Bacteria 1377
238 Ga0395900_0863215 3300037418 Unclassified 830
239 Ga0395900_1206790 3300037418 Bacteria 672
240 Ga0395898_0010438 3300037466 Bacteria 9709
241 Ga0395898_0011060 3300037466 Bacteria 9398
242 Ga0395898_0014732 3300037466 Bacteria 8027
243 Ga0395898_0017638 3300037466 Bacteria 7287
244 Ga0395898_0024632 3300037466 Bacteria 6070
245 Ga0395898_0115477 3300037466 Bacteria 2572
246 Ga0395898_0209470 3300037466 Bacteria 1860
247 Ga0395898_0222214 3300037466 Bacteria 1801
248 Ga0395898_0256146 3300037466 Bacteria 1669
249 Ga0395898_0264590 3300037466 Bacteria 1640
250 Ga0395898_0302645 3300037466 Bacteria 1525
251 Ga0395898_0543797 3300037466 Unclassified 1103
252 Ga0395898_1662025 3300037466 Bacteria 562
253 Ga0395905_0017926 3300037471 Bacteria 6726
254 Ga0395905_0018716 3300037471 Bacteria 6570
255 Ga0395905_0025954 3300037471 Bacteria 5523
256 Ga0395905_0031244 3300037471 Bacteria 5014
257 Ga0395905_0049632 3300037471 Bacteria 3933
258 Ga0395905_0077334 3300037471 Bacteria 3118
259 Ga0395905_0083968 3300037471 Bacteria 2983
260 Ga0395905_0099893 3300037471 Bacteria 2725
261 Ga0395905_0150318 3300037471 Bacteria 2191
262 Ga0395905_0160239 3300037471 Bacteria 2115
263 Ga0395905_0272426 3300037471 Bacteria 1579
264 Ga0395905_0476723 3300037471 Bacteria 1147
265 Ga0395905_0484555 3300037471 Bacteria 1136
266 Ga0395905_0521313 3300037471 Bacteria 1089
267 Ga0395905_0697719 3300037471 Bacteria 917
268 Ga0395905_0897623 3300037471 Unclassified 789
269 Ga0395905_1344753 3300037471 Unclassified 618
270 Ga0395901_0012159 3300038443 Bacteria 8731
271 Ga0395901_0013407 3300038443 Bacteria 8330
272 Ga0395901_0021631 3300038443 Bacteria 6589
273 Ga0395901_0022428 3300038443 Bacteria 6471
274 Ga0395901_0026696 3300038443 Bacteria 5930
275 Ga0395901_0048502 3300038443 Bacteria 4410
276 Ga0395901_0053250 3300038443 Bacteria 4205
277 Ga0395901_0094536 3300038443 Bacteria 3131
278 Ga0395901_0099613 3300038443 Bacteria 3047
279 Ga0395901_0115720 3300038443 Bacteria 2817
280 Ga0395901_0120242 3300038443 Bacteria 2760
281 Ga0395901_0131370 3300038443 Bacteria 2631
282 Ga0395901_0161429 3300038443 Bacteria 2354
283 Ga0395901_0195915 3300038443 Bacteria 2118
284 Ga0395901_0270050 3300038443 Bacteria 1769
285 Ga0395901_0357565 3300038443 Bacteria 1506
286 Ga0395901_0374706 3300038443 Bacteria 1466
287 Ga0439456_032050 3300042013 Bacteria 1128
288 Ga0439446_0156700 3300042156 Unclassified 751
289 Ga0439460_0172973 3300042461 Unclassified 728
290 Ga0453683_0064991 3300044673 Bacteria 2281
291 Ga0495603_0099572 3300046455 Unclassified 1697
292 Ga0495629_0003687 3300046459 Bacteria 11581
293 Ga0495629_0254618 3300046459 Unclassified 1207
294 Ga0495629_0528959 3300046459 Bacteria 793
295 Ga0495641_0321161 3300046461 Bacteria 699
296 Ga0495651_0071573 3300046462 Bacteria 2636
297 Ga0495651_0309927 3300046462 Unclassified 1056
298 Ga0495582_0052897 3300046473 Bacteria 2239
299 Ga0495664_0479190 3300046477 Unclassified 744
300 Ga0495584_0048331 3300046491 Bacteria 2145
301 Ga0495608_0068731 3300046511 Bacteria 2316
302 Ga0495608_0241598 3300046511 Bacteria 1128
303 Ga0495608_0581006 3300046511 Unclassified 674
304 Ga0495628_0435246 3300046516 Unclassified 954
305 Ga0495630_0082826 3300046517 Bacteria 2422
306 Ga0495630_0139968 3300046517 Bacteria 1840
307 Ga0495652_0081173 3300046529 Bacteria 2676
308 Ga0495652_0760134 3300046529 Unclassified 648
309 Ga0495609_0169995 3300046538 Bacteria 921
310 Ga0495667_0059311 3300046559 Bacteria 2512
311 Ga0495667_0692695 3300046559 Bacteria 632
312 Ga0495657_0105878 3300046675 Bacteria 1786
313 Ga0495657_0354379 3300046675 Bacteria 868
314 Ga0495657_0836445 3300046675 Bacteria 525
315 Ga0495599_0246061 3300046678 Bacteria 1089
316 Ga0495647_0014391 3300046681 Unclassified 2756
317 Ga0495658_0088761 3300046683 Bacteria 1828
318 Ga0495658_0284452 3300046683 Unclassified 1044
319 Ga0495613_0002212 3300046689 Bacteria 14729
320 Ga0495613_0712252 3300046689 Unclassified 660
321 Ga0495613_1002998 3300046689 Unclassified 536
322 Ga0495624_0013395 3300046690 Bacteria 5592
323 Ga0495624_0125618 3300046690 Bacteria 1575
324 Ga0495624_0458391 3300046690 Unclassified 764
325 Ga0495676_0116927 3300047321 Bacteria 1946
326 Ga0495676_0229687 3300047321 Bacteria 1275
327 Ga0495676_0266035 3300047321 Unclassified 1165
328 Ga0495684_0041619 3300047471 Bacteria 3521
329 Ga0495684_0464056 3300047471 Bacteria 877
330 Ga0495684_0668456 3300047471 Bacteria 692
331 Ga0495602_1042986 3300048088 Bacteria 538
332 Ga0496100_0090567 3300048903 Bacteria 2086
333 Ga0496101_0011162 3300048904 Bacteria 5952
334 Ga0496101_0046484 3300048904 Unclassified 3113
335 Ga0496102_0309881 3300048905 Bacteria 1488
336 Ga0496102_0342352 3300048905 Bacteria 1408
337 Ga0496102_0674208 3300048905 Unclassified 957
338 Ga0496105_0017961 3300048908 Bacteria 5677
339 Ga0496106_0024721 3300048909 Unclassified 4467
340 Ga0496107_0024927 3300048910 Bacteria 4233
341 Ga0496108_0007102 3300048911 Bacteria 9070
342 Ga0496108_0865140 3300048911 Bacteria 777
343 Ga0496109_0007545 3300048912 Bacteria 9219
344 Ga0496109_0175024 3300048912 Unclassified 2014
345 Ga0496109_0680801 3300048912 Bacteria 966
346 Ga0496110_0015048 3300048913 Bacteria 6432
347 Ga0496111_0007499 3300048914 Bacteria 7157
348 Ga0496113_0049611 3300048916 Bacteria 3126
349 Ga0496113_0882223 3300048916 Bacteria 708
350 Ga0496114_0013962 3300048917 Bacteria 6439
351 Ga0501031_0033525 3300049568 Bacteria 3350
352 Ga0501031_0356968 3300049568 Unclassified 946
353 Ga0501036_0093808 3300049572 Bacteria 2536
354 Ga0501037_0086165 3300049573 Bacteria 2274
355 Ga0501038_0055465 3300049574 Bacteria 3404
356 Ga0501039_0040328 3300049575 Bacteria 3604
357 Ga0501040_0120650 3300049576 Bacteria 1839
358 Ga0501040_0797538 3300049576 Unclassified 683
359 Ga0501041_0008750 3300049577 Bacteria 5957
360 Ga0501042_0132538 3300049578 Bacteria 1796
361 Ga0501048_0037890 3300049582 Bacteria 3462
362 Ga0501067_0014174 3300049583 Bacteria 4415
363 Ga0501068_0246697 3300049584 Bacteria 1137
364 Ga0501068_0326271 3300049584 Bacteria 984
365 Ga0501069_0053691 3300049585 Bacteria 2244
366 Ga0501069_0311742 3300049585 Bacteria 923
367 Ga0501070_0347079 3300049586 Bacteria 1205
368 Ga0501071_0038855 3300049587 Bacteria 3402
369 Ga0501072_0051939 3300049588 Bacteria 3227
370 Ga0501072_0390794 3300049588 Bacteria 1104
371 Ga0501072_1032266 3300049588 Unclassified 641
372 Ga0501073_0136492 3300049589 Bacteria 1700
373 Ga0501075_0144587 3300049591 Bacteria 1812
374 Ga0501076_0045874 3300049592 Bacteria 3451
375 Ga0501076_0217879 3300049592 Bacteria 1560
376 Ga0501077_0025669 3300049593 Bacteria 3740
377 Ga0501077_0043464 3300049593 Bacteria 2855
378 Ga0501079_0076470 3300049741 Bacteria 2589
379 Ga0501080_0044885 3300049742 Bacteria 4113
380 Ga0501081_0027051 3300049743 Bacteria 3871
381 Ga0501035_0130186 3300049822 Bacteria 2194
382 Ga0501045_0121712 3300049824 Bacteria 1937
383 nmdc:mga05p37_31711_c1 3300050507 Bacteria 6458
384 nmdc:mga05p37_355720_c1 3300050507 Bacteria 1723
385 nmdc:mga05p37_455902_c1 3300050507 Bacteria 1479
386 nmdc:mga05p37_90699_c1 3300050507 Bacteria 3766
387 nmdc:mga0n895_1033634_c1 3300050512 Unclassified 801
388 nmdc:mga0n895_1450425_c1 3300050512 Unclassified 654
389 nmdc:mga0n895_146571_c1 3300050512 Bacteria 2390
390 nmdc:mga0n895_259320_c1 3300050512 Bacteria 1764
391 nmdc:mga0n895_44123_c1 3300050512 Bacteria 4348
392 nmdc:mga0rr50_402569_c1 3300050513 Bacteria 1156
393 nmdc:mga0a205_151074_c1 3300050515 Bacteria 2222
394 nmdc:mga0a205_216222_c1 3300050515 Bacteria 1803
395 nmdc:mga0a205_55972_c1 3300050515 Bacteria 3808
396 nmdc:mga0a205_764847_c1 3300050515 Bacteria 814
397 Ga0495601_0000655 3300053077 Bacteria 18464
398 Ga0495601_0976213 3300053077 Bacteria 533
399 Ga0495612_0071029 3300053078 Bacteria 1452
400 Ga0495595_0016923 3300053084 Bacteria 3128
401 Ga0495595_0045792 3300053084 Bacteria 2013
402 Ga0501084_0021483 3300054114 Bacteria 5380
403 Ga0501082_0310381 3300060353 Bacteria 1373
404 Ga0530510_0060111 3300061734 Bacteria 2750
405 Ga0530510_0346616 3300061734 Bacteria 1115
406 Ga0530510_0748162 3300061734 Unclassified 745
407 Ga0495592_0118468
408 JGI24751J29686_10023790
409 JGI25407J50210_10001269
410 Ga0065712_10498104
411 Ga0070658_10169834
412 Ga0070676_10256945
413 Ga0070683_100079247
414 Ga0070670_100002220
415 Ga0068869_100138895
416 Ga0070682_100003605
417 Ga0068868_100036890
418 Ga0070689_100027027
419 Ga0070661_100213577
420 Ga0070692_10018347
421 Ga0070675_100055005
422 Ga0070671_100326331
423 Ga0070674_100009121
424 Ga0070673_100015317
425 Ga0070688_100001471
426 Ga0070659_100026542
427 Ga0070667_100457344
428 Ga0070703_10073197
429 Ga0070714_100886327
430 Ga0070701_10000686
431 Ga0070701_10307149
432 Ga0070705_100211052
433 Ga0070705_100319152
434 Ga0070700_100035587
435 Ga0070708_100003324
436 Ga0070708_100090528
437 Ga0070708_100339085
438 Ga0070708_100411782
439 Ga0070708_100786090
440 Ga0070663_100017720
441 Ga0070678_101562900
442 Ga0070681_10615797
443 Ga0068867_100067347
444 Ga0070685_10111205
445 Ga0070706_100003430
446 Ga0070706_100118665
447 Ga0070706_100399887
448 Ga0070706_100404547
449 Ga0070706_100558021
450 Ga0070706_100563286
451 Ga0070706_100815157
452 Ga0070706_101051712
453 Ga0070707_100062539
454 Ga0070707_100143503
455 Ga0070707_100178384
456 Ga0070707_100536022
457 Ga0070707_100670436
458 Ga0070698_100001355
459 Ga0070698_100046547
460 Ga0070698_100075289
461 Ga0070698_100103528
462 Ga0070698_100133973
463 Ga0070698_100598659
464 Ga0070698_100668639
465 Ga0070699_100045209
466 Ga0070699_100160571
467 Ga0070699_100821172
468 Ga0070699_101443129
469 Ga0070679_100034605
470 Ga0070684_100062562
471 Ga0070697_100505249
472 Ga0068853_100152387
473 Ga0070672_100056862
474 Ga0070686_100137537
475 Ga0070686_100272373
476 Ga0070695_100122415
477 Ga0070696_100247254
478 Ga0070696_100396440
479 Ga0070693_100056762
480 Ga0070704_100043743
481 Ga0068855_100345850
482 Ga0070664_100154430
483 Ga0068857_100046538
484 Ga0068857_100189083
485 Ga0068856_100270126
486 Ga0070702_100016920
487 Ga0068852_100002221
488 Ga0068864_100011203
489 Ga0068861_100226349
490 Ga0068870_10002693
491 Ga0068870_10014665
492 Ga0068858_100018557
493 Ga0068860_100052933
494 Ga0068862_100303547
495 Ga0081455_10026386
496 Ga0081455_10161199
497 Ga0081455_10547398
498 Ga0081538_10000063
499 Ga0081540_1078113
500 Ga0081539_10000840
501 Ga0081539_10054040
502 Ga0081539_10082502
503 Ga0081539_10173492
504 Ga0081539_10187903
505 Ga0070717_10493653
506 Ga0070717_10940607
507 Ga0075365_10501141
508 Ga0068871_100931623
509 Ga0075428_100654053
510 Ga0075433_10055552
511 Ga0075433_10260467
512 Ga0075434_100024968
513 Ga0075434_102029909
514 Ga0068865_100016654
515 Ga0068865_100091179
516 Ga0075435_100020556
517 Ga0075435_100320742
518 Ga0075435_100610809
519 Ga0111539_10082800
520 Ga0111539_12704583
521 Ga0105245_10063672
522 Ga0105247_10245672
523 Ga0114129_10027794
524 Ga0114129_10063759
525 Ga0114129_10101974
526 Ga0114129_10218179
527 Ga0114129_11331541
528 Ga0114129_11836542
529 Ga0114129_12785979
530 Ga0105241_10137409
531 Ga0105242_10009325
532 Ga0105242_10064324
533 Ga0105248_10024692
534 Ga0105238_10886757
535 Ga0105249_10034604
536 Ga0099796_10022918
537 Ga0105239_10038870
538 Ga0105246_10064535
539 Ga0157374_10041715
540 Ga0157378_10498749
541 Ga0157378_10652306
542 Ga0163162_10094792
543 Ga0157375_10004142
544 Ga0163163_10047313
545 Ga0157380_10014324
546 Ga0182008_10076062
547 Ga0182008_10899167
548 Ga0157377_10080745
549 Ga0157379_10038451
550 Ga0157376_10340173
551 Ga0157376_12452923
552 Ga0163161_10034119
553 Ga0207653_10041448
554 Ga0207653_10148640
555 Ga0207710_10127021
556 Ga0207688_10005129
557 Ga0207643_10005589
558 Ga0207643_10030528
559 Ga0207684_10000259
560 Ga0207684_10010676
561 Ga0207684_10554772
562 Ga0207684_10945300
563 Ga0207707_10727366
564 Ga0207646_10002941
565 Ga0207646_10172203
566 Ga0207646_10269354
567 Ga0207646_11234241
568 Ga0207646_11606840
569 Ga0207694_10661523
570 Ga0207650_10003461
571 Ga0207659_10040666
572 Ga0207687_10146658
573 Ga0207644_10601031
574 Ga0207690_10133403
575 Ga0207686_10016639
576 Ga0207686_10222784
577 Ga0207670_10022325
578 Ga0207669_10315926
579 Ga0207704_10359482
580 Ga0207691_10047915
581 Ga0207711_10070523
582 Ga0207689_10031152
583 Ga0207661_10122212
584 Ga0207679_10423930
585 Ga0207712_11196763
586 Ga0207640_10551774
587 Ga0207658_10728158
588 Ga0207677_10362802
589 Ga0207703_10130637
590 Ga0207639_10135342
591 Ga0207708_10017762
592 Ga0207702_10220453
593 Ga0207648_10298374
594 Ga0207674_10035025
595 Ga0207674_10245392
596 Ga0207675_100230874
597 Ga0207683_10194416
598 Ga0207698_10620322
599 Ga0268265_10117333
600 Ga0268264_10354875
601 Ga0268264_12000059
602 Ga0307413_10108614
603 Ga0307406_10024977
604 Ga0307412_10918086
605 Ga0307409_100066381
606 Ga0307416_100125136
607 Ga0307416_100255922
608 Ga0307416_100778733
609 Ga0307415_100000015
610 Ga0373959_0040651
611 Ga0373938_0113599
612 Ga0373928_0080425
613 Ga0373952_0073151
614 Ga0373939_0283228
615 Ga0373941_0010453
616 Ga0373943_0653141
617 Ga0373943_0813903
618 Ga0373946_0364745
619 Ga0373955_0298049
620 Ga0373947_0001863
621 Ga0373947_0573930
622 Ga0373937_0025897
623 Ga0373925_0033785
624 Ga0373925_0413729
625 Ga0373925_0766543
626 Ga0395899_0018483
627 Ga0395899_0026098
628 Ga0395899_0037935
629 Ga0395899_0091167
630 Ga0395899_0190251
631 Ga0395899_0539790
632 Ga0395900_0007281
633 Ga0395900_0007815
634 Ga0395900_0017339
635 Ga0395900_0033372
636 Ga0395900_0109113
637 Ga0395900_0109757
638 Ga0395900_0123454
639 Ga0395900_0160140
640 Ga0395900_0168310
641 Ga0395900_0171679
642 Ga0395900_0299837
643 Ga0395900_0381636
644 Ga0395900_0863215
645 Ga0395900_1206790
646 Ga0395898_0010438
647 Ga0395898_0011060
648 Ga0395898_0014732
649 Ga0395898_0017638
650 Ga0395898_0024632
651 Ga0395898_0115477
652 Ga0395898_0209470
653 Ga0395898_0222214
654 Ga0395898_0256146
655 Ga0395898_0264590
656 Ga0395898_0302645
657 Ga0395898_0543797
658 Ga0395898_1662025
659 Ga0395905_0017926
660 Ga0395905_0018716
661 Ga0395905_0025954
662 Ga0395905_0031244
663 Ga0395905_0049632
664 Ga0395905_0077334
665 Ga0395905_0083968
666 Ga0395905_0099893
667 Ga0395905_0150318
668 Ga0395905_0160239
669 Ga0395905_0272426
670 Ga0395905_0476723
671 Ga0395905_0484555
672 Ga0395905_0521313
673 Ga0395905_0697719
674 Ga0395905_0897623
675 Ga0395905_1344753
676 Ga0395901_0012159
677 Ga0395901_0013407
678 Ga0395901_0021631
679 Ga0395901_0022428
680 Ga0395901_0026696
681 Ga0395901_0048502
682 Ga0395901_0053250
683 Ga0395901_0094536
684 Ga0395901_0099613
685 Ga0395901_0115720
686 Ga0395901_0120242
687 Ga0395901_0131370
688 Ga0395901_0161429
689 Ga0395901_0195915
690 Ga0395901_0270050
691 Ga0395901_0357565
692 Ga0395901_0374706
693 Ga0439456_032050
694 Ga0439446_0156700
695 Ga0439460_0172973
696 Ga0453683_0064991
697 Ga0495603_0099572
698 Ga0495629_0003687
699 Ga0495629_0254618
700 Ga0495629_0528959
701 Ga0495641_0321161
702 Ga0495651_0071573
703 Ga0495651_0309927
704 Ga0495582_0052897
705 Ga0495664_0479190
706 Ga0495584_0048331
707 Ga0495608_0068731
708 Ga0495608_0241598
709 Ga0495608_0581006
710 Ga0495628_0435246
711 Ga0495630_0082826
712 Ga0495630_0139968
713 Ga0495652_0081173
714 Ga0495652_0760134
715 Ga0495609_0169995
716 Ga0495667_0059311
717 Ga0495667_0692695
718 Ga0495657_0105878
719 Ga0495657_0354379
720 Ga0495657_0836445
721 Ga0495599_0246061
722 Ga0495647_0014391
723 Ga0495658_0088761
724 Ga0495658_0284452
725 Ga0495613_0002212
726 Ga0495613_0712252
727 Ga0495613_1002998
728 Ga0495624_0013395
729 Ga0495624_0125618
730 Ga0495624_0458391
731 Ga0495676_0116927
732 Ga0495676_0229687
733 Ga0495676_0266035
734 Ga0495684_0041619
735 Ga0495684_0464056
736 Ga0495684_0668456
737 Ga0495602_1042986
738 Ga0496100_0090567
739 Ga0496101_0011162
740 Ga0496101_0046484
741 Ga0496102_0309881
742 Ga0496102_0342352
743 Ga0496102_0674208
744 Ga0496105_0017961
745 Ga0496106_0024721
746 Ga0496107_0024927
747 Ga0496108_0007102
748 Ga0496108_0865140
749 Ga0496109_0007545
750 Ga0496109_0175024
751 Ga0496109_0680801
752 Ga0496110_0015048
753 Ga0496111_0007499
754 Ga0496113_0049611
755 Ga0496113_0882223
756 Ga0496114_0013962
757 Ga0501031_0033525
758 Ga0501031_0356968
759 Ga0501036_0093808
760 Ga0501037_0086165
761 Ga0501038_0055465
762 Ga0501039_0040328
763 Ga0501040_0120650
764 Ga0501040_0797538
765 Ga0501041_0008750
766 Ga0501042_0132538
767 Ga0501048_0037890
768 Ga0501067_0014174
769 Ga0501068_0246697
770 Ga0501068_0326271
771 Ga0501069_0053691
772 Ga0501069_0311742
773 Ga0501070_0347079
774 Ga0501071_0038855
775 Ga0501072_0051939
776 Ga0501072_0390794
777 Ga0501072_1032266
778 Ga0501073_0136492
779 Ga0501075_0144587
780 Ga0501076_0045874
781 Ga0501076_0217879
782 Ga0501077_0025669
783 Ga0501077_0043464
784 Ga0501079_0076470
785 Ga0501080_0044885
786 Ga0501081_0027051
787 Ga0501035_0130186
788 Ga0501045_0121712
789 nmdc:mga05p37_31711_c1
790 nmdc:mga05p37_355720_c1
791 nmdc:mga05p37_455902_c1
792 nmdc:mga05p37_90699_c1
793 nmdc:mga0n895_1033634_c1
794 nmdc:mga0n895_1450425_c1
795 nmdc:mga0n895_146571_c1
796 nmdc:mga0n895_259320_c1
797 nmdc:mga0n895_44123_c1
798 nmdc:mga0rr50_402569_c1
799 nmdc:mga0a205_151074_c1
800 nmdc:mga0a205_216222_c1
801 nmdc:mga0a205_55972_c1
802 nmdc:mga0a205_764847_c1
803 Ga0495601_0000655
804 Ga0495601_0976213
805 Ga0495612_0071029
806 Ga0495595_0016923
807 Ga0495595_0045792
808 Ga0501084_0021483
809 Ga0501082_0310381
810 Ga0530510_0060111
811 Ga0530510_0346616
812 Ga0530510_0748162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09828

ChrB_C

ChrB, C-terminal domain

3

139

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h30-assembly2.cif.gz_B the crystal structure of sbd1-sbd2 tandem of glnpq transporter 0.6776 1 49
5vvi-assembly2.cif.gz_C crystal structure of the ligand binding domain of lysr-type transcriptional regulator, occr from agrobacterium tumefaciens in the complex with octopine 0.6632 2 49
3tmg-assembly4.cif.gz_D crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi 0.6272 1 49
1i6a-assembly1.cif.gz_A crystal structure of the oxidized form of oxyr 0.6121 2 49
3uki-assembly1.cif.gz_B crystal structure of reduced oxyr from porphyromonas gingivalis 0.6074 1 50
ID Description Score Start End Superfamily
2b4lA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Glycine betaine-binding periplasmic protein; domain 2 0.6888 3 47 3.40.190.100
6b8aB00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.649 1 47 3.40.190.290
3czcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6126 1 45 3.40.50.2300
1u5wH00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.5957 1 35 3.90.950.10
4p4nC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.5902 1 44 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A535VZL8-F1-model_v4 Chromate resistance protein 1.001 2 144
AF-A0A535XWY8-F1-model_v4 Chromate resistance protein 0.9979 2 144
AF-A0A537X596-F1-model_v4 Chromate resistance protein 0.9901 1 139
AF-A0A535CBX1-F1-model_v4 Chromate resistance protein 0.9899 2 112
AF-A0A537VIP5-F1-model_v4 Chromate resistance protein 0.9892 3 141

Map