F436267

General Info

Members Datasets Scaffolds Average Seq Length
406 208 405 154

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0278768|Ga0373947_0278768_374_874
Length 166
Sequence MWTKLYLQVFWSMTSPPDRQQKRQTLRRHGTLNPQPESVTHPLFQNSDFFDPDDLLQVKYEMLRQVHVDGESISEAARDFGFSRPSFYQAQSALQHDGVFGLFPHKRGPQGGHKLTSEVMDFILQQRSEDPALTPEQLAQVVQKQFRLQVHPRSIQRRLLAEKKRR

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
109 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
110 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
139 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.49
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 4.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10193322 3300005335 Bacteria 1430
2 Ga0070682_100933585 3300005337 Unclassified 715
3 Ga0070689_100132166 3300005340 Bacteria 2002
4 Ga0070669_100152082 3300005353 Bacteria 1792
5 Ga0070673_100222861 3300005364 Bacteria 1633
6 Ga0070673_100928741 3300005364 Bacteria 808
7 Ga0070688_100135897 3300005365 Bacteria 1664
8 Ga0070688_100164901 3300005365 Bacteria 1525
9 Ga0070667_100572788 3300005367 Bacteria 1039
10 Ga0070667_100732320 3300005367 Unclassified 916
11 Ga0070709_10134287 3300005434 Bacteria 1693
12 Ga0070709_10298055 3300005434 Unclassified 1177
13 Ga0070709_10495203 3300005434 Bacteria 927
14 Ga0070713_100035468 3300005436 Bacteria 4015
15 Ga0070713_100043689 3300005436 Plasmid 3665
16 Ga0070713_100378363 3300005436 Bacteria 1319
17 Ga0070711_100031512 3300005439 Bacteria 3520
18 Ga0070711_100722788 3300005439 Bacteria 840
19 Ga0070708_100013351 3300005445 Bacteria 6722
20 Ga0070708_100048043 3300005445 Bacteria 3771
21 Ga0070708_100124378 3300005445 Unclassified 2382
22 Ga0070678_100187259 3300005456 Bacteria 1699
23 Ga0068867_100146472 3300005459 Bacteria 1851
24 Ga0070685_10390002 3300005466 Bacteria 962
25 Ga0070706_100058187 3300005467 Bacteria 3567
26 Ga0070706_100071660 3300005467 Bacteria 3205
27 Ga0070706_100152439 3300005467 Viruses 2158
28 Ga0070706_100168264 3300005467 Bacteria 2046
29 Ga0070706_100182293 3300005467 Bacteria 1961
30 Ga0070706_100447252 3300005467 Unclassified 1202
31 Ga0070706_100840911 3300005467 Unclassified 849
32 Ga0070706_101507254 3300005467 Unclassified 614
33 Ga0070707_100069300 3300005468 Bacteria 3396
34 Ga0070707_100085425 3300005468 Bacteria 3050
35 Ga0070707_100135694 3300005468 Bacteria 2394
36 Ga0070707_100448596 3300005468 Unclassified 1251
37 Ga0070698_100036925 3300005471 Bacteria 5041
38 Ga0070698_100053786 3300005471 Bacteria 4090
39 Ga0070698_100075554 3300005471 Bacteria 3373
40 Ga0070698_100081566 3300005471 Bacteria 3228
41 Ga0070698_100221353 3300005471 Bacteria 1826
42 Ga0070698_100476316 3300005471 Bacteria 1185
43 Ga0070699_100042158 3300005518 Bacteria 3949
44 Ga0070699_100058915 3300005518 Bacteria 3327
45 Ga0070699_102103008 3300005518 Bacteria 516
46 Ga0070697_100044573 3300005536 Bacteria 3593
47 Ga0070697_100085969 3300005536 Bacteria 2595
48 Ga0070697_101656025 3300005536 Bacteria 572
49 Ga0070686_100556586 3300005544 Bacteria 898
50 Ga0070665_100065199 3300005548 Bacteria 3654
51 Ga0070665_100433602 3300005548 Bacteria 1323
52 Ga0068856_100951993 3300005614 Unclassified 877
53 Ga0068864_100280513 3300005618 Unclassified 1555
54 Ga0068861_100650066 3300005719 Bacteria 974
55 Ga0068863_100534045 3300005841 Unclassified 1157
56 Ga0068858_100053179 3300005842 Bacteria 3747
57 Ga0068858_100660273 3300005842 Bacteria 1016
58 Ga0068860_100532999 3300005843 Bacteria 1175
59 Ga0068862_101282004 3300005844 Bacteria 733
60 Ga0070717_10032049 3300006028 Bacteria 4232
61 Ga0070717_10036683 3300006028 Bacteria 3977
62 Ga0070717_10044971 3300006028 Bacteria 3608
63 Ga0070717_10131563 3300006028 Bacteria 2152
64 Ga0070717_10199754 3300006028 Bacteria 1751
65 Ga0070717_10313932 3300006028 Bacteria 1395
66 Ga0070717_11314485 3300006028 Unclassified 657
67 Ga0070715_10068111 3300006163 Unclassified 1582
68 Ga0070712_100313305 3300006175 Bacteria 1274
69 Ga0097621_100047953 3300006237 Bacteria 3463
70 Ga0097621_100100854 3300006237 Bacteria 2429
71 Ga0068871_100115419 3300006358 Bacteria 2263
72 Ga0068871_100202532 3300006358 Bacteria 1714
73 Ga0075428_100075672 3300006844 Bacteria 3676
74 Ga0075430_100006302 3300006846 Bacteria 10007
75 Ga0075431_100076700 3300006847 Bacteria 3449
76 Ga0075431_100253075 3300006847 Bacteria 1789
77 Ga0075433_10050222 3300006852 Bacteria 3630
78 Ga0075433_10052828 3300006852 Plasmid 3541
79 Ga0075434_100027638 3300006871 Bacteria 5571
80 Ga0075434_100070496 3300006871 Bacteria 3486
81 Ga0075434_100085686 3300006871 Bacteria 3150
82 Ga0075429_100042000 3300006880 Bacteria 3980
83 Ga0075435_100029196 3300007076 Bacteria 4328
84 Ga0075435_100071506 3300007076 Bacteria 2833
85 Ga0075435_100351055 3300007076 Unclassified 1264
86 Ga0099794_10073797 3300007265 Bacteria 1675
87 Ga0105240_10027175 3300009093 Bacteria 7497
88 Ga0105240_10190122 3300009093 Bacteria 2415
89 Ga0111539_10058725 3300009094 Bacteria 4563
90 Ga0111539_10129742 3300009094 Bacteria 2952
91 Ga0111539_10663826 3300009094 Bacteria 1214
92 Ga0114129_10121303 3300009147 Bacteria 3597
93 Ga0114129_10155309 3300009147 Bacteria 3130
94 Ga0114129_10447414 3300009147 Unclassified 1695
95 Ga0105241_10449388 3300009174 Bacteria 1140
96 Ga0105242_10954067 3300009176 Bacteria 862
97 Ga0105248_10132341 3300009177 Bacteria 2814
98 Ga0105248_10282929 3300009177 Bacteria 1867
99 Ga0105239_10077444 3300010375 Bacteria 3659
100 Ga0105246_10343496 3300011119 Bacteria 1221
101 Ga0157374_10115694 3300013296 Bacteria 2583
102 Ga0163162_11179961 3300013306 Bacteria 868
103 Ga0157372_10110665 3300013307 Unclassified 3146
104 Ga0157375_10209867 3300013308 Bacteria 2105
105 Ga0157375_10405956 3300013308 Bacteria 1529
106 Ga0163163_10256696 3300014325 Bacteria 1799
107 Ga0163163_10438519 3300014325 Bacteria 1366
108 Ga0157380_10230069 3300014326 Bacteria 1665
109 Ga0157376_10289105 3300014969 Bacteria 1547
110 Ga0157376_11544660 3300014969 Bacteria 697
111 Ga0182006_1164825 3300015261 Unclassified 745
112 Ga0163161_10844737 3300017792 Bacteria 772
113 Ga0213873_10076202 3300021358 Unclassified 932
114 Ga0213873_10240821 3300021358 Unclassified 571
115 Ga0213874_10245819 3300021377 Unclassified 658
116 Ga0213876_10049193 3300021384 Bacteria 2227
117 Ga0213875_10038761 3300021388 Bacteria 2245
118 Ga0213875_10054102 3300021388 Bacteria 1880
119 Ga0207697_10215822 3300025315 Bacteria 846
120 Ga0207680_10478762 3300025903 Bacteria 885
121 Ga0207699_10102431 3300025906 Bacteria 1819
122 Ga0207699_10363515 3300025906 Bacteria 1024
123 Ga0207684_10009992 3300025910 Bacteria 8366
124 Ga0207684_10047968 3300025910 Bacteria 3622
125 Ga0207684_10098697 3300025910 Bacteria 2494
126 Ga0207684_10156651 3300025910 Bacteria 1960
127 Ga0207684_10271734 3300025910 Bacteria 1462
128 Ga0207684_10392253 3300025910 Bacteria 1193
129 Ga0207684_10450578 3300025910 Unclassified 1105
130 Ga0207707_10880507 3300025912 Unclassified 741
131 Ga0207695_10149789 3300025913 Bacteria 2273
132 Ga0207693_10025780 3300025915 Bacteria 4658
133 Ga0207693_10112388 3300025915 Bacteria 2136
134 Ga0207663_10023784 3300025916 Bacteria 3522
135 Ga0207663_11249161 3300025916 Unclassified 598
136 Ga0207646_10056090 3300025922 Bacteria 3522
137 Ga0207646_10059247 3300025922 Bacteria 3420
138 Ga0207646_10065005 3300025922 Bacteria 3256
139 Ga0207646_10702081 3300025922 Unclassified 904
140 Ga0207700_10041580 3300025928 Plasmid 3364
141 Ga0207700_10156710 3300025928 Bacteria 1887
142 Ga0207700_10244065 3300025928 Unclassified 1532
143 Ga0207700_11848622 3300025928 Unclassified 530
144 Ga0207670_10384705 3300025936 Bacteria 1118
145 Ga0207704_10598255 3300025938 Unclassified 902
146 Ga0207665_10325224 3300025939 Unclassified 1155
147 Ga0207711_10196872 3300025941 Unclassified 1838
148 Ga0207651_10282073 3300025960 Bacteria 1373
149 Ga0207658_10977176 3300025986 Bacteria 772
150 Ga0207703_10036883 3300026035 Bacteria 3893
151 Ga0207702_11360751 3300026078 Unclassified 704
152 Ga0207641_10567612 3300026088 Unclassified 1108
153 Ga0207641_12399043 3300026088 Unclassified 526
154 Ga0207648_10180100 3300026089 Bacteria 1870
155 Ga0207676_10393604 3300026095 Bacteria 1293
156 Ga0207683_10130392 3300026121 Bacteria 2261
157 Ga0207428_10265939 3300027907 Bacteria 1276
158 Ga0207428_10372460 3300027907 Bacteria 1048
159 Ga0268266_10030198 3300028379 Bacteria 4606
160 Ga0268266_10044346 3300028379 Bacteria 3802
161 Ga0268264_10873461 3300028381 Bacteria 901
162 Ga0265760_10004246 3300031090 Plasmid 4119
163 Ga0265330_10128673 3300031235 Bacteria 1078
164 Ga0265332_10016423 3300031238 Plasmid 3266
165 Ga0265328_10052793 3300031239 Bacteria 1491
166 Ga0265320_10114088 3300031240 Bacteria 1236
167 Ga0265325_10015763 3300031241 Bacteria 4241
168 Ga0265325_10104254 3300031241 Bacteria 1385
169 Ga0265329_10010231 3300031242 Bacteria 3456
170 Ga0265340_10114929 3300031247 Bacteria 1241
171 Ga0265339_10024842 3300031249 Bacteria 3447
172 Ga0265339_10496121 3300031249 Unclassified 564
173 Ga0265331_10011487 3300031250 Bacteria 4846
174 Ga0265331_10129315 3300031250 Unclassified 1153
175 Ga0265327_10025459 3300031251 Plasmid 3449
176 Ga0265316_10025085 3300031344 Bacteria 4980
177 Ga0265316_10126275 3300031344 Bacteria 1928
178 Ga0265316_10153208 3300031344 Bacteria 1726
179 Ga0316575_10012161 3300031665 Bacteria 3196
180 Ga0316575_10057268 3300031665 Unclassified 1553
181 Ga0316575_10116491 3300031665 Bacteria 1091
182 Ga0316575_10200293 3300031665 Bacteria 831
183 Ga0316579_10010359 3300031691 Bacteria 3940
184 Ga0316579_10051396 3300031691 Bacteria 1928
185 Ga0316579_10079178 3300031691 Unclassified 1563
186 Ga0316579_10107272 3300031691 Bacteria 1339
187 Ga0265314_10022464 3300031711 Unclassified 4831
188 Ga0265342_10016986 3300031712 Bacteria 4742
189 Ga0316576_10151835 3300031727 Unclassified 1745
190 Ga0316576_10168346 3300031727 Bacteria 1653
191 Ga0316576_10189775 3300031727 Bacteria 1549
192 Ga0316576_10275086 3300031727 Bacteria 1262
193 Ga0316578_10020798 3300031728 Plasmid 3632
194 Ga0316578_10021880 3300031728 Bacteria 3554
195 Ga0316578_10137705 3300031728 Bacteria 1470
196 Ga0316578_10163464 3300031728 Bacteria 1341
197 Ga0316577_10021064 3300031733 Bacteria 3615
198 Ga0316577_10027274 3300031733 Plasmid 3184
199 Ga0316577_10127694 3300031733 Unclassified 1430
200 Ga0316577_10262337 3300031733 Bacteria 977
201 Ga0316577_10268074 3300031733 Bacteria 966
202 Ga0316577_10488972 3300031733 Unclassified 699
203 Ga0316583_10013699 3300032133 Plasmid 2926
204 Ga0316583_10029296 3300032133 Bacteria 1963
205 Ga0316583_10054587 3300032133 Bacteria 1405
206 Ga0316585_10004951 3300032137 Bacteria 3743
207 Ga0316585_10018446 3300032137 Bacteria 2118
208 Ga0316585_10021487 3300032137 Unclassified 1982
209 Ga0316580_10005621 3300032139 Bacteria 3669
210 Ga0316580_10023261 3300032139 Bacteria 1913
211 Ga0316580_10035368 3300032139 Unclassified 1545
212 Ga0373926_0004048 3300035083 Bacteria 4783
213 Ga0373940_0013774 3300035088 Unclassified 1964
214 Ga0373944_0018991 3300035089 Bacteria 1968
215 Ga0373944_0033468 3300035089 Unclassified 1557
216 Ga0373923_0005629 3300035111 Bacteria 4267
217 Ga0373923_0189967 3300035111 Bacteria 946
218 Ga0373932_0013977 3300035112 Bacteria 2009
219 Ga0373936_0012952 3300035113 Bacteria 3180
220 Ga0373939_0205229 3300035114 Unclassified 747
221 Ga0373945_0004115 3300035116 Bacteria 4612
222 Ga0373945_0062927 3300035116 Bacteria 1388
223 Ga0373957_0180494 3300035120 Bacteria 875
224 Ga0373943_0005342 3300035170 Bacteria 5777
225 Ga0373943_0007754 3300035170 Bacteria 4820
226 Ga0373943_0187410 3300035170 Bacteria 1140
227 Ga0373943_0544049 3300035170 Unclassified 681
228 Ga0373946_0007359 3300035171 Bacteria 4022
229 Ga0373946_0008447 3300035171 Plasmid 3777
230 Ga0373946_0254828 3300035171 Bacteria 857
231 Ga0373955_0098804 3300035172 Bacteria 1673
232 Ga0316574_0023619 3300035398 Bacteria 3672
233 Ga0316574_0063465 3300035398 Bacteria 2323
234 Ga0316574_0079377 3300035398 Bacteria 2081
235 Ga0316574_0171982 3300035398 Unclassified 1394
236 Ga0316574_0206415 3300035398 Unclassified 1261
237 Ga0373924_0078241 3300035410 Unclassified 1403
238 Ga0373931_0260212 3300035691 Unclassified 1058
239 Ga0373935_0010469 3300035692 Bacteria 5563
240 Ga0373935_0021920 3300035692 Plasmid 3912
241 Ga0373927_0000710 3300035695 Bacteria 25514
242 Ga0373927_0027199 3300035695 Plasmid 3735
243 Ga0373927_0110578 3300035695 Bacteria 1790
244 Ga0373933_0160568 3300035724 Bacteria 1427
245 Ga0373947_0001253 3300035725 Bacteria 15613
246 Ga0373947_0021519 3300035725 Plasmid 3732
247 Ga0373947_0278768 3300035725 Bacteria 1111
248 Ga0373947_0324695 3300035725 Bacteria 1030
249 Ga0373947_0464307 3300035725 Bacteria 858
250 Ga0373937_0059606 3300036401 Plasmid 3508
251 Ga0373937_0175493 3300036401 Bacteria 2011
252 Ga0316582_0025422 3300036647 Bacteria 3555
253 Ga0316582_0031114 3300036647 Bacteria 3259
254 Ga0316582_0096378 3300036647 Unclassified 1953
255 Ga0316582_0167929 3300036647 Bacteria 1488
256 Ga0316584_0031968 3300036712 Plasmid 3892
257 Ga0316584_0038241 3300036712 Bacteria 3568
258 Ga0316584_0159152 3300036712 Bacteria 1678
259 Ga0316584_0323760 3300036712 Bacteria 1111
260 Ga0316584_0765888 3300036712 Unclassified 657
261 Ga0373925_0025929 3300037068 Plasmid 4286
262 Ga0373925_0026714 3300037068 Bacteria 4225
263 Ga0373925_0154724 3300037068 Bacteria 1803
264 Ga0373925_0288056 3300037068 Bacteria 1324
265 Ga0373925_0875316 3300037068 Bacteria 740
266 Ga0395900_1340991 3300037418 Bacteria 629
267 Ga0395905_0456939 3300037471 Bacteria 1175
268 Ga0395905_1547269 3300037471 Bacteria 568
269 Ga0316581_0010468 3300037588 Bacteria 2572
270 Ga0436364_0097930 3300037853 Bacteria 2147
271 Ga0436364_0210717 3300037853 Bacteria 3585
272 Ga0436364_0638058 3300037853 Bacteria 2659
273 Ga0400488_01967 3300038741 Bacteria 2166
274 Ga0400483_077164 3300039062 Unclassified 1388
275 Ga0400483_200900 3300039062 Unclassified 2139
276 Ga0436365_0081362 3300039437 Bacteria 3058
277 Ga0436365_0510313 3300039437 Plasmid 2534
278 Ga0436365_0556554 3300039437 Unclassified 850
279 Ga0436363_0012398 3300039450 Bacteria 5049
280 Ga0436363_0354999 3300039450 Unclassified 4382
281 Ga0436363_0739452 3300039450 Unclassified 957
282 Ga0436362_0072546 3300039453 Unclassified 660
283 Ga0436362_0803576 3300039453 Plasmid 3174
284 Ga0436362_1032644 3300039453 Bacteria 1289
285 Ga0439459_0006689 3300042438 Bacteria 1928
286 Ga0439460_0016257 3300042461 Bacteria 1979
287 Ga0451577_0376114 3300042876 Bacteria 1289
288 Ga0451577_1002647 3300042876 Bacteria 750
289 Ga0453683_0132287 3300044673 Bacteria 1572
290 Ga0451576_0040751 3300045051 Bacteria 4913
291 Ga0466958_0417009 3300045836 Bacteria 868
292 Ga0466967_0224176 3300045976 Bacteria 1787
293 Ga0466967_1453128 3300045976 Unclassified 683
294 Ga0495592_0211705 3300046454 Bacteria 1301
295 Ga0495653_0251601 3300046463 Bacteria 1172
296 Ga0495653_0929983 3300046463 Unclassified 517
297 Ga0495580_0028560 3300046472 Plasmid 4054
298 Ga0495580_0059276 3300046472 Bacteria 2690
299 Ga0495580_0302434 3300046472 Bacteria 1089
300 Ga0495580_0549372 3300046472 Bacteria 767
301 Ga0495582_0050375 3300046473 Unclassified 2295
302 Ga0495582_0097285 3300046473 Bacteria 1646
303 Ga0495582_0332190 3300046473 Bacteria 875
304 Ga0495639_0011341 3300046475 Bacteria 3842
305 Ga0495639_0223962 3300046475 Unclassified 925
306 Ga0495639_0545947 3300046475 Unclassified 594
307 Ga0495662_0011800 3300046476 Bacteria 4268
308 Ga0495662_0428244 3300046476 Unclassified 649
309 Ga0495664_0034186 3300046477 Bacteria 2990
310 Ga0495664_0366039 3300046477 Unclassified 867
311 Ga0495664_0459363 3300046477 Unclassified 762
312 Ga0495594_0197210 3300046499 Bacteria 1147
313 Ga0495594_0333761 3300046499 Bacteria 863
314 Ga0495594_0567281 3300046499 Unclassified 644
315 Ga0495596_0076020 3300046500 Bacteria 1304
316 Ga0495583_0036529 3300046506 Bacteria 2336
317 Ga0495628_0028045 3300046516 Unclassified 4579
318 Ga0495630_0020831 3300046517 Plasmid 4839
319 Ga0495630_0023369 3300046517 Bacteria 4570
320 Ga0495630_0243383 3300046517 Bacteria 1374
321 Ga0495630_0259630 3300046517 Unclassified 1327
322 Ga0495630_0386103 3300046517 Bacteria 1073
323 Ga0495666_0011815 3300046526 Bacteria 4353
324 Ga0495666_0027983 3300046526 Plasmid 2774
325 Ga0495654_0238952 3300046530 Archaea 761
326 Ga0495665_0016008 3300046531 Plasmid 4041
327 Ga0495665_0017055 3300046531 Bacteria 3907
328 Ga0495665_0040343 3300046531 Bacteria 2486
329 Ga0495640_0031698 3300046533 Bacteria 3770
330 Ga0495640_0201484 3300046533 Unclassified 1261
331 Ga0495640_0771348 3300046533 Unclassified 574
332 Ga0495586_0018232 3300046535 Bacteria 3736
333 Ga0495586_0101705 3300046535 Bacteria 1595
334 Ga0495586_0126382 3300046535 Unclassified 1430
335 Ga0495587_0144022 3300046536 Bacteria 1359
336 Ga0495645_0183907 3300046543 Bacteria 1429
337 Ga0495667_0594416 3300046559 Unclassified 690
338 Ga0495634_0025687 3300046642 Bacteria 4115
339 Ga0495635_0045379 3300046663 Plasmid 3033
340 Ga0495635_0052638 3300046663 Bacteria 2804
341 Ga0495635_0270486 3300046663 Bacteria 1143
342 Ga0495659_0024082 3300046664 Bacteria 2073
343 Ga0495657_0543644 3300046675 Bacteria 675
344 Ga0495599_0061125 3300046678 Bacteria 2354
345 Ga0495623_0597861 3300046679 Unclassified 573
346 Ga0495646_0482487 3300046680 Unclassified 638
347 Ga0495658_0256943 3300046683 Bacteria 1099
348 Ga0495613_0117499 3300046689 Bacteria 1912
349 Ga0495624_0020255 3300046690 Plasmid 4430
350 Ga0495624_0026257 3300046690 Bacteria 3818
351 Ga0495624_0059645 3300046690 Bacteria 2394
352 Ga0495649_0199370 3300046694 Bacteria 1040
353 Ga0495589_0007056 3300046794 Bacteria 5890
354 Ga0495581_0227709 3300047315 Bacteria 1090
355 Ga0495581_0377537 3300047315 Bacteria 827
356 Ga0495636_0052454 3300047318 Bacteria 1711
357 Ga0495674_0035779 3300047319 Plasmid 4476
358 Ga0495674_0044119 3300047319 Bacteria 3965
359 Ga0495676_0036616 3300047321 Bacteria 4095
360 Ga0495676_0040370 3300047321 Plasmid 3852
361 Ga0495676_0627834 3300047321 Unclassified 698
362 Ga0495676_0795402 3300047321 Unclassified 609
363 Ga0495675_0024945 3300047444 Bacteria 3814
364 Ga0495684_0084820 3300047471 Bacteria 2402
365 Ga0495684_0392476 3300047471 Bacteria 976
366 Ga0495684_0465738 3300047471 Unclassified 875
367 Ga0495593_0013165 3300047673 Plasmid 4723
368 Ga0495602_0204091 3300048088 Bacteria 1506
369 Ga0495614_0010717 3300048089 Plasmid 4039
370 Ga0496106_1074357 3300048909 Bacteria 631
371 Ga0496108_0600540 3300048911 Unclassified 959
372 Ga0501038_0298627 3300049574 Bacteria 1264
373 Ga0501040_0438113 3300049576 Bacteria 940
374 Ga0501046_0568073 3300049580 Unclassified 807
375 Ga0501079_0844626 3300049741 Unclassified 721
376 Ga0501080_1250902 3300049742 Bacteria 637
377 Ga0501080_1503815 3300049742 Unclassified 572
378 nmdc:mga07m45_279532_c1 3300050496 Bacteria 971
379 nmdc:mga05p37_109169_c1 3300050507 Bacteria 3404
380 nmdc:mga05p37_51756_c1 3300050507 Bacteria 5050
381 nmdc:mga05p37_691804_c1 3300050507 Bacteria 1134
382 nmdc:mga09592_27924_c1 3300050508 Bacteria 4685
383 nmdc:mga0qj67_1029537_c1 3300050509 Unclassified 645
384 nmdc:mga0qj67_14089_c1 3300050509 Bacteria 6038
385 nmdc:mga0qj67_64631_c1 3300050509 Bacteria 2911
386 nmdc:mga06r32_1100401_c1 3300050510 Bacteria 744
387 nmdc:mga06r32_246206_c1 3300050510 Bacteria 1775
388 nmdc:mga06r32_499999_c1 3300050510 Bacteria 1193
389 nmdc:mga06r32_68926_c1 3300050510 Bacteria 3418
390 nmdc:mga06r32_705347_c1 3300050510 Bacteria 974
391 nmdc:mga08y16_183175_c1 3300050511 Bacteria 2174
392 nmdc:mga08y16_552854_c1 3300050511 Bacteria 1165
393 nmdc:mga0n895_244121_c1 3300050512 Bacteria 1823
394 nmdc:mga0n895_61829_c1 3300050512 Plasmid 3699
395 nmdc:mga0n895_64805_c1 3300050512 Bacteria 3615
396 nmdc:mga0n895_827296_c1 3300050512 Unclassified 915
397 nmdc:mga0rr50_125850_c1 3300050513 Bacteria 2046
398 nmdc:mga0rr50_20172_c1 3300050513 Bacteria 4517
399 nmdc:mga08x19_328810_c1 3300050514 Unclassified 1065
400 nmdc:mga0a205_416631_c1 3300050515 Bacteria 1206
401 nmdc:mga0a205_54687_c2 3300050515 Plasmid 3493
402 nmdc:mga0a205_56893_c1 3300050515 Bacteria 3776
403 nmdc:mga0a205_775001_c1 3300050515 Unclassified 807
404 Ga0495612_0118828 3300053078 Bacteria 1136
405 Ga0495612_0384875 3300053078 Unclassified 636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100053786 Ga0070698_1000537865 123
2 3300025912 Ga0207707_10880507 Ga0207707_108805072 123
3 3300046463 Ga0495653_0929983 Ga0495653_0929983_111_491 126
4 3300046533 Ga0495640_0771348 Ga0495640_0771348_32_412 126
5 3300046679 Ga0495623_0597861 Ga0495623_0597861_179_559 126
6 3300009093 Ga0105240_10190122 Ga0105240_101901223 127
7 3300025913 Ga0207695_10149789 Ga0207695_101497893 127
8 3300005471 Ga0070698_100081566 Ga0070698_1000815664 129
9 3300050509 nmdc:mga0qj67_1029537_c1 nmdc:mga0qj67_1029537_c1_40_429 129
10 3300050515 nmdc:mga0a205_775001_c1 nmdc:mga0a205_775001_c1_318_728 136
11 3300026088 Ga0207641_10567612 Ga0207641_105676123 143
12 3300035088 Ga0373940_0013774 Ga0373940_0013774_74_541 143
13 3300035112 Ga0373932_0013977 Ga0373932_0013977_359_826 143
14 3300035114 Ga0373939_0205229 Ga0373939_0205229_66_533 143
15 3300035691 Ga0373931_0260212 Ga0373931_0260212_88_555 143
16 3300005445 Ga0070708_100124378 Ga0070708_1001243781 144
17 3300005471 Ga0070698_100221353 Ga0070698_1002213531 144
18 3300025910 Ga0207684_10009992 Ga0207684_100099927 144
19 3300005436 Ga0070713_100378363 Ga0070713_1003783632 146
20 3300005467 Ga0070706_100182293 Ga0070706_1001822933 146
21 3300005467 Ga0070706_100840911 Ga0070706_1008409111 146
22 3300005468 Ga0070707_100448596 Ga0070707_1004485963 146
23 3300006028 Ga0070717_10036683 Ga0070717_100366833 146
24 3300006028 Ga0070717_10313932 Ga0070717_103139322 146
25 3300025928 Ga0207700_10156710 Ga0207700_101567102 146
26 3300025939 Ga0207665_10325224 Ga0207665_103252242 146
27 3300026078 Ga0207702_11360751 Ga0207702_113607512 146
28 3300036401 Ga0373937_0059606 Ga0373937_0059606_496_942 146
29 3300037068 Ga0373925_0154724 Ga0373925_0154724_493_939 146
30 iso_pu_bacteria 2643221603 2644029648 146
31 3300021384 Ga0213876_10049193 Ga0213876_100491932 148
32 3300021388 Ga0213875_10038761 Ga0213875_100387611 148
33 3300037853 Ga0436364_0210717 Ga0436364_0210717_627_1103 148
34 3300039437 Ga0436365_0081362 Ga0436365_0081362_2527_3003 148
35 3300005367 Ga0070667_100732320 Ga0070667_1007323202 149
36 3300005434 Ga0070709_10134287 Ga0070709_101342873 149
37 3300005434 Ga0070709_10298055 Ga0070709_102980551 149
38 3300005436 Ga0070713_100035468 Ga0070713_1000354681 149
39 3300005439 Ga0070711_100031512 Ga0070711_1000315123 149
40 3300005445 Ga0070708_100048043 Ga0070708_1000480433 149
41 3300005467 Ga0070706_100058187 Ga0070706_1000581872 149
42 3300005468 Ga0070707_100069300 Ga0070707_1000693002 149
43 3300005471 Ga0070698_100036925 Ga0070698_1000369252 149
44 3300005518 Ga0070699_100042158 Ga0070699_1000421583 149
45 3300005518 Ga0070699_102103008 Ga0070699_1021030081 149
46 3300005536 Ga0070697_101656025 Ga0070697_1016560251 149
47 3300005548 Ga0070665_100065199 Ga0070665_1000651993 149
48 3300005614 Ga0068856_100951993 Ga0068856_1009519931 149
49 3300005841 Ga0068863_100534045 Ga0068863_1005340453 149
50 3300005842 Ga0068858_100053179 Ga0068858_1000531794 149
51 3300006028 Ga0070717_10032049 Ga0070717_100320492 149
52 3300006028 Ga0070717_10199754 Ga0070717_101997542 149
53 3300006028 Ga0070717_11314485 Ga0070717_113144852 149
54 3300006237 Ga0097621_100047953 Ga0097621_1000479532 149
55 3300006358 Ga0068871_100202532 Ga0068871_1002025323 149
56 3300007076 Ga0075435_100351055 Ga0075435_1003510552 149
57 3300007265 Ga0099794_10073797 Ga0099794_100737973 149
58 3300009093 Ga0105240_10027175 Ga0105240_100271758 149
59 3300009094 Ga0111539_10663826 Ga0111539_106638262 149
60 3300010375 Ga0105239_10077444 Ga0105239_100774443 149
61 3300013307 Ga0157372_10110665 Ga0157372_101106653 149
62 3300014969 Ga0157376_10289105 Ga0157376_102891052 149
63 3300015261 Ga0182006_1164825 Ga0182006_11648251 149
64 3300021358 Ga0213873_10240821 Ga0213873_102408211 149
65 3300021388 Ga0213875_10054102 Ga0213875_100541022 149
66 3300025906 Ga0207699_10102431 Ga0207699_101024312 149
67 3300025906 Ga0207699_10363515 Ga0207699_103635152 149
68 3300025910 Ga0207684_10098697 Ga0207684_100986973 149
69 3300025910 Ga0207684_10156651 Ga0207684_101566511 149
70 3300025916 Ga0207663_10023784 Ga0207663_100237844 149
71 3300025922 Ga0207646_10059247 Ga0207646_100592473 149
72 3300025928 Ga0207700_10244065 Ga0207700_102440651 149
73 3300025928 Ga0207700_11848622 Ga0207700_118486221 149
74 3300025938 Ga0207704_10598255 Ga0207704_105982551 149
75 3300026035 Ga0207703_10036883 Ga0207703_100368832 149
76 3300026088 Ga0207641_12399043 Ga0207641_123990431 149
77 3300027907 Ga0207428_10372460 Ga0207428_103724602 149
78 3300028379 Ga0268266_10030198 Ga0268266_100301983 149
79 3300031241 Ga0265325_10015763 Ga0265325_100157634 149
80 3300031344 Ga0265316_10153208 Ga0265316_101532081 149
81 3300035170 Ga0373943_0187410 Ga0373943_0187410_476_955 149
82 3300035725 Ga0373947_0278768 Ga0373947_0278768_374_874 149
83 3300035725 Ga0373947_0324695 Ga0373947_0324695_200_679 149
84 3300037068 Ga0373925_0875316 Ga0373925_0875316_135_614 149
85 3300037853 Ga0436364_0097930 Ga0436364_0097930_491_979 149
86 3300039437 Ga0436365_0556554 Ga0436365_0556554_204_668 149
87 3300039450 Ga0436363_0739452 Ga0436363_0739452_231_695 149
88 3300039453 Ga0436362_0072546 Ga0436362_0072546_163_627 149
89 3300042876 Ga0451577_0376114 Ga0451577_0376114_289_759 149
90 3300044673 Ga0453683_0132287 Ga0453683_0132287_934_1404 149
91 3300045051 Ga0451576_0040751 Ga0451576_0040751_3193_3663 149
92 3300046499 Ga0495594_0567281 Ga0495594_0567281_113_577 149
93 3300047321 Ga0495676_0795402 Ga0495676_0795402_101_565 149
94 3300050511 nmdc:mga08y16_552854_c1 nmdc:mga08y16_552854_c1_557_1012 149
95 3300006847 Ga0075431_100076700 Ga0075431_1000767003 150
96 3300006852 Ga0075433_10050222 Ga0075433_100502223 150
97 3300006871 Ga0075434_100027638 Ga0075434_1000276384 150
98 3300006871 Ga0075434_100070496 Ga0075434_1000704963 150
99 3300006880 Ga0075429_100042000 Ga0075429_1000420003 150
100 3300007076 Ga0075435_100029196 Ga0075435_1000291962 150
101 3300007076 Ga0075435_100071506 Ga0075435_1000715063 150
102 3300009094 Ga0111539_10129742 Ga0111539_101297423 150
103 3300009147 Ga0114129_10121303 Ga0114129_101213033 150
104 3300009147 Ga0114129_10155309 Ga0114129_101553093 150
105 3300032139 Ga0316580_10005621 Ga0316580_100056212 150
106 3300050507 nmdc:mga05p37_109169_c1 nmdc:mga05p37_109169_c1_523_984 150
107 3300050507 nmdc:mga05p37_51756_c1 nmdc:mga05p37_51756_c1_1239_1700 150
108 3300050508 nmdc:mga09592_27924_c1 nmdc:mga09592_27924_c1_3382_3843 150
109 3300050510 nmdc:mga06r32_68926_c1 nmdc:mga06r32_68926_c1_2412_2873 150
110 3300050512 nmdc:mga0n895_244121_c1 nmdc:mga0n895_244121_c1_969_1430 150
111 3300050512 nmdc:mga0n895_64805_c1 nmdc:mga0n895_64805_c1_627_1088 150
112 3300050513 nmdc:mga0rr50_125850_c1 nmdc:mga0rr50_125850_c1_627_1088 150
113 3300050513 nmdc:mga0rr50_20172_c1 nmdc:mga0rr50_20172_c1_1205_1666 150
114 3300050514 nmdc:mga08x19_328810_c1 nmdc:mga08x19_328810_c1_476_937 150
115 3300050515 nmdc:mga0a205_416631_c1 nmdc:mga0a205_416631_c1_170_631 150
116 3300050515 nmdc:mga0a205_56893_c1 nmdc:mga0a205_56893_c1_831_1292 150
117 3300005353 Ga0070669_100152082 Ga0070669_1001520822 151
118 3300005364 Ga0070673_100928741 Ga0070673_1009287411 151
119 3300005365 Ga0070688_100164901 Ga0070688_1001649013 151
120 3300005456 Ga0070678_100187259 Ga0070678_1001872593 151
121 3300005459 Ga0068867_100146472 Ga0068867_1001464723 151
122 3300005466 Ga0070685_10390002 Ga0070685_103900021 151
123 3300005467 Ga0070706_100071660 Ga0070706_1000716603 151
124 3300005468 Ga0070707_100085425 Ga0070707_1000854253 151
125 3300005471 Ga0070698_100075554 Ga0070698_1000755543 151
126 3300005518 Ga0070699_100058915 Ga0070699_1000589153 151
127 3300005536 Ga0070697_100044573 Ga0070697_1000445733 151
128 3300005544 Ga0070686_100556586 Ga0070686_1005565861 151
129 3300005719 Ga0068861_100650066 Ga0068861_1006500661 151
130 3300005844 Ga0068862_101282004 Ga0068862_1012820041 151
131 3300006028 Ga0070717_10044971 Ga0070717_100449713 151
132 3300009094 Ga0111539_10058725 Ga0111539_100587254 151
133 3300009174 Ga0105241_10449388 Ga0105241_104493881 151
134 3300013306 Ga0163162_11179961 Ga0163162_111799611 151
135 3300013308 Ga0157375_10405956 Ga0157375_104059562 151
136 3300014326 Ga0157380_10230069 Ga0157380_102300692 151
137 3300017792 Ga0163161_10844737 Ga0163161_108447371 151
138 3300025315 Ga0207697_10215822 Ga0207697_102158221 151
139 3300025910 Ga0207684_10047968 Ga0207684_100479683 151
140 3300025922 Ga0207646_10056090 Ga0207646_100560903 151
141 3300025936 Ga0207670_10384705 Ga0207670_103847052 151
142 3300026089 Ga0207648_10180100 Ga0207648_101801002 151
143 3300026095 Ga0207676_10393604 Ga0207676_103936042 151
144 3300026121 Ga0207683_10130392 Ga0207683_101303922 151
145 3300027907 Ga0207428_10265939 Ga0207428_102659392 151
146 3300037418 Ga0395900_1340991 Ga0395900_1340991_39_509 151
147 3300037471 Ga0395905_0456939 Ga0395905_0456939_526_1002 151
148 3300037471 Ga0395905_1547269 Ga0395905_1547269_84_554 151
149 3300042438 Ga0439459_0006689 Ga0439459_0006689_482_946 151
150 3300045976 Ga0466967_1453128 Ga0466967_1453128_185_655 151
151 3300046475 Ga0495639_0545947 Ga0495639_0545947_44_508 151
152 3300046477 Ga0495664_0366039 Ga0495664_0366039_272_742 151
153 3300046664 Ga0495659_0024082 Ga0495659_0024082_1421_1885 151
154 3300047318 Ga0495636_0052454 Ga0495636_0052454_637_1101 151
155 3300050496 nmdc:mga07m45_279532_c1 nmdc:mga07m45_279532_c1_443_907 151
156 3300050510 nmdc:mga06r32_499999_c1 nmdc:mga06r32_499999_c1_138_602 151
157 3300050511 nmdc:mga08y16_183175_c1 nmdc:mga08y16_183175_c1_1172_1636 151
158 3300005335 Ga0070666_10193322 Ga0070666_101933222 152
159 3300005337 Ga0070682_100933585 Ga0070682_1009335852 152
160 3300005340 Ga0070689_100132166 Ga0070689_1001321663 152
161 3300005364 Ga0070673_100222861 Ga0070673_1002228613 152
162 3300005365 Ga0070688_100135897 Ga0070688_1001358972 152
163 3300005367 Ga0070667_100572788 Ga0070667_1005727883 152
164 3300005434 Ga0070709_10495203 Ga0070709_104952033 152
165 3300005436 Ga0070713_100043689 Ga0070713_1000436893 152
166 3300005439 Ga0070711_100722788 Ga0070711_1007227881 152
167 3300005445 Ga0070708_100013351 Ga0070708_1000133514 152
168 3300005467 Ga0070706_100152439 Ga0070706_1001524393 152
169 3300005467 Ga0070706_100168264 Ga0070706_1001682643 152
170 3300005467 Ga0070706_100447252 Ga0070706_1004472522 152
171 3300005467 Ga0070706_101507254 Ga0070706_1015072541 152
172 3300005468 Ga0070707_100135694 Ga0070707_1001356943 152
173 3300005471 Ga0070698_100476316 Ga0070698_1004763161 152
174 3300005536 Ga0070697_100085969 Ga0070697_1000859692 152
175 3300005548 Ga0070665_100433602 Ga0070665_1004336023 152
176 3300005618 Ga0068864_100280513 Ga0068864_1002805132 152
177 3300005842 Ga0068858_100660273 Ga0068858_1006602732 152
178 3300005843 Ga0068860_100532999 Ga0068860_1005329992 152
179 3300006028 Ga0070717_10131563 Ga0070717_101315632 152
180 3300006163 Ga0070715_10068111 Ga0070715_100681111 152
181 3300006175 Ga0070712_100313305 Ga0070712_1003133052 152
182 3300006237 Ga0097621_100100854 Ga0097621_1001008542 152
183 3300006358 Ga0068871_100115419 Ga0068871_1001154191 152
184 3300006844 Ga0075428_100075672 Ga0075428_1000756722 152
185 3300006846 Ga0075430_100006302 Ga0075430_1000063022 152
186 3300006847 Ga0075431_100253075 Ga0075431_1002530752 152
187 3300006852 Ga0075433_10052828 Ga0075433_100528283 152
188 3300006871 Ga0075434_100085686 Ga0075434_1000856861 152
189 3300009147 Ga0114129_10447414 Ga0114129_104474142 152
190 3300009176 Ga0105242_10954067 Ga0105242_109540671 152
191 3300009177 Ga0105248_10132341 Ga0105248_101323411 152
192 3300009177 Ga0105248_10282929 Ga0105248_102829292 152
193 3300011119 Ga0105246_10343496 Ga0105246_103434962 152
194 3300013296 Ga0157374_10115694 Ga0157374_101156944 152
195 3300013308 Ga0157375_10209867 Ga0157375_102098674 152
196 3300014325 Ga0163163_10256696 Ga0163163_102566961 152
197 3300014325 Ga0163163_10438519 Ga0163163_104385192 152
198 3300014969 Ga0157376_11544660 Ga0157376_115446601 152
199 3300021358 Ga0213873_10076202 Ga0213873_100762023 152
200 3300021377 Ga0213874_10245819 Ga0213874_102458191 152
201 3300025903 Ga0207680_10478762 Ga0207680_104787622 152
202 3300025910 Ga0207684_10271734 Ga0207684_102717342 152
203 3300025910 Ga0207684_10392253 Ga0207684_103922531 152
204 3300025910 Ga0207684_10450578 Ga0207684_104505782 152
205 3300025915 Ga0207693_10025780 Ga0207693_100257804 152
206 3300025915 Ga0207693_10112388 Ga0207693_101123883 152
207 3300025916 Ga0207663_11249161 Ga0207663_112491611 152
208 3300025922 Ga0207646_10065005 Ga0207646_100650053 152
209 3300025922 Ga0207646_10702081 Ga0207646_107020811 152
210 3300025928 Ga0207700_10041580 Ga0207700_100415802 152
211 3300025941 Ga0207711_10196872 Ga0207711_101968721 152
212 3300025960 Ga0207651_10282073 Ga0207651_102820733 152
213 3300025986 Ga0207658_10977176 Ga0207658_109771761 152
214 3300028379 Ga0268266_10044346 Ga0268266_100443464 152
215 3300028381 Ga0268264_10873461 Ga0268264_108734612 152
216 3300031090 Ga0265760_10004246 Ga0265760_100042464 152
217 3300031235 Ga0265330_10128673 Ga0265330_101286732 152
218 3300031238 Ga0265332_10016423 Ga0265332_100164231 152
219 3300031239 Ga0265328_10052793 Ga0265328_100527931 152
220 3300031240 Ga0265320_10114088 Ga0265320_101140882 152
221 3300031241 Ga0265325_10104254 Ga0265325_101042543 152
222 3300031242 Ga0265329_10010231 Ga0265329_100102314 152
223 3300031247 Ga0265340_10114929 Ga0265340_101149293 152
224 3300031249 Ga0265339_10024842 Ga0265339_100248422 152
225 3300031249 Ga0265339_10496121 Ga0265339_104961211 152
226 3300031250 Ga0265331_10011487 Ga0265331_100114874 152
227 3300031250 Ga0265331_10129315 Ga0265331_101293152 152
228 3300031251 Ga0265327_10025459 Ga0265327_100254592 152
229 3300031344 Ga0265316_10025085 Ga0265316_100250852 152
230 3300031344 Ga0265316_10126275 Ga0265316_101262752 152
231 3300031665 Ga0316575_10012161 Ga0316575_100121611 152
232 3300031665 Ga0316575_10057268 Ga0316575_100572682 152
233 3300031665 Ga0316575_10116491 Ga0316575_101164911 152
234 3300031665 Ga0316575_10200293 Ga0316575_102002932 152
235 3300031691 Ga0316579_10010359 Ga0316579_100103593 152
236 3300031691 Ga0316579_10051396 Ga0316579_100513963 152
237 3300031691 Ga0316579_10079178 Ga0316579_100791783 152
238 3300031691 Ga0316579_10107272 Ga0316579_101072721 152
239 3300031711 Ga0265314_10022464 Ga0265314_100224644 152
240 3300031712 Ga0265342_10016986 Ga0265342_100169862 152
241 3300031727 Ga0316576_10151835 Ga0316576_101518351 152
242 3300031727 Ga0316576_10168346 Ga0316576_101683462 152
243 3300031727 Ga0316576_10189775 Ga0316576_101897753 152
244 3300031727 Ga0316576_10275086 Ga0316576_102750862 152
245 3300031728 Ga0316578_10020798 Ga0316578_100207982 152
246 3300031728 Ga0316578_10021880 Ga0316578_100218802 152
247 3300031728 Ga0316578_10137705 Ga0316578_101377051 152
248 3300031728 Ga0316578_10163464 Ga0316578_101634642 152
249 3300031733 Ga0316577_10021064 Ga0316577_100210643 152
250 3300031733 Ga0316577_10027274 Ga0316577_100272743 152
251 3300031733 Ga0316577_10127694 Ga0316577_101276942 152
252 3300031733 Ga0316577_10262337 Ga0316577_102623373 152
253 3300031733 Ga0316577_10268074 Ga0316577_102680741 152
254 3300031733 Ga0316577_10488972 Ga0316577_104889721 152
255 3300032133 Ga0316583_10013699 Ga0316583_100136991 152
256 3300032133 Ga0316583_10029296 Ga0316583_100292963 152
257 3300032133 Ga0316583_10054587 Ga0316583_100545873 152
258 3300032137 Ga0316585_10004951 Ga0316585_100049514 152
259 3300032137 Ga0316585_10018446 Ga0316585_100184462 152
260 3300032137 Ga0316585_10021487 Ga0316585_100214873 152
261 3300032139 Ga0316580_10023261 Ga0316580_100232612 152
262 3300032139 Ga0316580_10035368 Ga0316580_100353682 152
263 3300035083 Ga0373926_0004048 Ga0373926_0004048_884_1351 152
264 3300035089 Ga0373944_0018991 Ga0373944_0018991_1385_1852 152
265 3300035089 Ga0373944_0033468 Ga0373944_0033468_65_532 152
266 3300035111 Ga0373923_0005629 Ga0373923_0005629_1370_1837 152
267 3300035111 Ga0373923_0189967 Ga0373923_0189967_363_833 152
268 3300035113 Ga0373936_0012952 Ga0373936_0012952_1019_1486 152
269 3300035116 Ga0373945_0004115 Ga0373945_0004115_2422_2889 152
270 3300035116 Ga0373945_0062927 Ga0373945_0062927_859_1326 152
271 3300035120 Ga0373957_0180494 Ga0373957_0180494_158_616 152
272 3300035170 Ga0373943_0005342 Ga0373943_0005342_2904_3371 152
273 3300035170 Ga0373943_0007754 Ga0373943_0007754_2401_2868 152
274 3300035170 Ga0373943_0544049 Ga0373943_0544049_97_555 152
275 3300035171 Ga0373946_0007359 Ga0373946_0007359_846_1313 152
276 3300035171 Ga0373946_0008447 Ga0373946_0008447_2449_2916 152
277 3300035171 Ga0373946_0254828 Ga0373946_0254828_99_557 152
278 3300035172 Ga0373955_0098804 Ga0373955_0098804_853_1323 152
279 3300035398 Ga0316574_0023619 Ga0316574_0023619_2501_2977 152
280 3300035398 Ga0316574_0063465 Ga0316574_0063465_1142_1618 152
281 3300035398 Ga0316574_0079377 Ga0316574_0079377_640_1116 152
282 3300035398 Ga0316574_0171982 Ga0316574_0171982_493_969 152
283 3300035398 Ga0316574_0206415 Ga0316574_0206415_447_923 152
284 3300035410 Ga0373924_0078241 Ga0373924_0078241_315_782 152
285 3300035692 Ga0373935_0010469 Ga0373935_0010469_2516_2983 152
286 3300035692 Ga0373935_0021920 Ga0373935_0021920_2426_2893 152
287 3300035695 Ga0373927_0000710 Ga0373927_0000710_5548_6015 152
288 3300035695 Ga0373927_0027199 Ga0373927_0027199_2418_2885 152
289 3300035695 Ga0373927_0110578 Ga0373927_0110578_682_1146 152
290 3300035724 Ga0373933_0160568 Ga0373933_0160568_664_1134 152
291 3300035725 Ga0373947_0001253 Ga0373947_0001253_867_1334 152
292 3300035725 Ga0373947_0021519 Ga0373947_0021519_739_1206 152
293 3300035725 Ga0373947_0464307 Ga0373947_0464307_189_647 152
294 3300036401 Ga0373937_0175493 Ga0373937_0175493_153_623 152
295 3300036647 Ga0316582_0025422 Ga0316582_0025422_2516_2992 152
296 3300036647 Ga0316582_0031114 Ga0316582_0031114_1949_2425 152
297 3300036647 Ga0316582_0096378 Ga0316582_0096378_897_1373 152
298 3300036647 Ga0316582_0167929 Ga0316582_0167929_455_931 152
299 3300036712 Ga0316584_0031968 Ga0316584_0031968_2778_3254 152
300 3300036712 Ga0316584_0038241 Ga0316584_0038241_2443_2919 152
301 3300036712 Ga0316584_0159152 Ga0316584_0159152_754_1230 152
302 3300036712 Ga0316584_0323760 Ga0316584_0323760_476_952 152
303 3300036712 Ga0316584_0765888 Ga0316584_0765888_170_646 152
304 3300037068 Ga0373925_0025929 Ga0373925_0025929_1395_1862 152
305 3300037068 Ga0373925_0026714 Ga0373925_0026714_1352_1819 152
306 3300037068 Ga0373925_0288056 Ga0373925_0288056_729_1187 152
307 3300037588 Ga0316581_0010468 Ga0316581_0010468_295_771 152
308 3300037853 Ga0436364_0638058 Ga0436364_0638058_457_915 152
309 3300038741 Ga0400488_01967 Ga0400488_01967_1097_1573 152
310 3300039062 Ga0400483_077164 Ga0400483_077164_570_1046 152
311 3300039062 Ga0400483_200900 Ga0400483_200900_1608_2084 152
312 3300039437 Ga0436365_0510313 Ga0436365_0510313_1969_2427 152
313 3300039450 Ga0436363_0012398 Ga0436363_0012398_2157_2615 152
314 3300039450 Ga0436363_0354999 Ga0436363_0354999_2767_3225 152
315 3300039453 Ga0436362_0803576 Ga0436362_0803576_2278_2736 152
316 3300039453 Ga0436362_1032644 Ga0436362_1032644_117_590 152
317 3300042461 Ga0439460_0016257 Ga0439460_0016257_117_596 152
318 3300042876 Ga0451577_1002647 Ga0451577_1002647_163_624 152
319 3300045836 Ga0466958_0417009 Ga0466958_0417009_94_573 152
320 3300045976 Ga0466967_0224176 Ga0466967_0224176_1224_1703 152
321 3300046454 Ga0495592_0211705 Ga0495592_0211705_364_822 152
322 3300046463 Ga0495653_0251601 Ga0495653_0251601_74_541 152
323 3300046472 Ga0495580_0028560 Ga0495580_0028560_863_1330 152
324 3300046472 Ga0495580_0059276 Ga0495580_0059276_997_1464 152
325 3300046472 Ga0495580_0302434 Ga0495580_0302434_593_1051 152
326 3300046472 Ga0495580_0549372 Ga0495580_0549372_46_504 152
327 3300046473 Ga0495582_0050375 Ga0495582_0050375_963_1430 152
328 3300046473 Ga0495582_0097285 Ga0495582_0097285_705_1163 152
329 3300046473 Ga0495582_0332190 Ga0495582_0332190_219_677 152
330 3300046475 Ga0495639_0011341 Ga0495639_0011341_2416_2883 152
331 3300046475 Ga0495639_0223962 Ga0495639_0223962_96_563 152
332 3300046476 Ga0495662_0011800 Ga0495662_0011800_1405_1872 152
333 3300046476 Ga0495662_0428244 Ga0495662_0428244_74_538 152
334 3300046477 Ga0495664_0034186 Ga0495664_0034186_634_1092 152
335 3300046477 Ga0495664_0459363 Ga0495664_0459363_182_649 152
336 3300046499 Ga0495594_0197210 Ga0495594_0197210_633_1091 152
337 3300046499 Ga0495594_0333761 Ga0495594_0333761_251_709 152
338 3300046500 Ga0495596_0076020 Ga0495596_0076020_566_1036 152
339 3300046506 Ga0495583_0036529 Ga0495583_0036529_494_964 152
340 3300046516 Ga0495628_0028045 Ga0495628_0028045_1050_1508 152
341 3300046517 Ga0495630_0020831 Ga0495630_0020831_851_1318 152
342 3300046517 Ga0495630_0023369 Ga0495630_0023369_2404_2871 152
343 3300046517 Ga0495630_0243383 Ga0495630_0243383_762_1220 152
344 3300046517 Ga0495630_0259630 Ga0495630_0259630_327_791 152
345 3300046517 Ga0495630_0386103 Ga0495630_0386103_69_527 152
346 3300046526 Ga0495666_0011815 Ga0495666_0011815_1495_1962 152
347 3300046526 Ga0495666_0027983 Ga0495666_0027983_1425_1892 152
348 3300046530 Ga0495654_0238952 Ga0495654_0238952_145_618 152
349 3300046531 Ga0495665_0016008 Ga0495665_0016008_2669_3136 152
350 3300046531 Ga0495665_0017055 Ga0495665_0017055_1034_1501 152
351 3300046531 Ga0495665_0040343 Ga0495665_0040343_472_930 152
352 3300046533 Ga0495640_0031698 Ga0495640_0031698_841_1308 152
353 3300046533 Ga0495640_0201484 Ga0495640_0201484_785_1243 152
354 3300046535 Ga0495586_0018232 Ga0495586_0018232_2416_2883 152
355 3300046535 Ga0495586_0101705 Ga0495586_0101705_875_1342 152
356 3300046535 Ga0495586_0126382 Ga0495586_0126382_691_1155 152
357 3300046536 Ga0495587_0144022 Ga0495587_0144022_226_684 152
358 3300046543 Ga0495645_0183907 Ga0495645_0183907_106_564 152
359 3300046559 Ga0495667_0594416 Ga0495667_0594416_76_534 152
360 3300046642 Ga0495634_0025687 Ga0495634_0025687_1412_1879 152
361 3300046663 Ga0495635_0045379 Ga0495635_0045379_114_581 152
362 3300046663 Ga0495635_0052638 Ga0495635_0052638_2284_2742 152
363 3300046663 Ga0495635_0270486 Ga0495635_0270486_442_912 152
364 3300046675 Ga0495657_0543644 Ga0495657_0543644_126_584 152
365 3300046678 Ga0495599_0061125 Ga0495599_0061125_1380_1838 152
366 3300046680 Ga0495646_0482487 Ga0495646_0482487_81_539 152
367 3300046683 Ga0495658_0256943 Ga0495658_0256943_164_631 152
368 3300046689 Ga0495613_0117499 Ga0495613_0117499_1022_1480 152
369 3300046690 Ga0495624_0020255 Ga0495624_0020255_2426_2893 152
370 3300046690 Ga0495624_0026257 Ga0495624_0026257_921_1388 152
371 3300046690 Ga0495624_0059645 Ga0495624_0059645_1103_1567 152
372 3300046694 Ga0495649_0199370 Ga0495649_0199370_85_555 152
373 3300046794 Ga0495589_0007056 Ga0495589_0007056_2481_2951 152
374 3300047315 Ga0495581_0227709 Ga0495581_0227709_112_579 152
375 3300047315 Ga0495581_0377537 Ga0495581_0377537_98_556 152
376 3300047319 Ga0495674_0035779 Ga0495674_0035779_1375_1842 152
377 3300047319 Ga0495674_0044119 Ga0495674_0044119_2654_3121 152
378 3300047321 Ga0495676_0036616 Ga0495676_0036616_2423_2890 152
379 3300047321 Ga0495676_0040370 Ga0495676_0040370_927_1394 152
380 3300047321 Ga0495676_0627834 Ga0495676_0627834_211_669 152
381 3300047444 Ga0495675_0024945 Ga0495675_0024945_594_1052 152
382 3300047471 Ga0495684_0084820 Ga0495684_0084820_907_1365 152
383 3300047471 Ga0495684_0392476 Ga0495684_0392476_464_931 152
384 3300047471 Ga0495684_0465738 Ga0495684_0465738_307_765 152
385 3300047673 Ga0495593_0013165 Ga0495593_0013165_2508_2975 152
386 3300048088 Ga0495602_0204091 Ga0495602_0204091_521_979 152
387 3300048089 Ga0495614_0010717 Ga0495614_0010717_2549_3016 152
388 3300048909 Ga0496106_1074357 Ga0496106_1074357_33_491 152
389 3300048911 Ga0496108_0600540 Ga0496108_0600540_119_577 152
390 3300049574 Ga0501038_0298627 Ga0501038_0298627_128_616 152
391 3300049576 Ga0501040_0438113 Ga0501040_0438113_287_745 152
392 3300049580 Ga0501046_0568073 Ga0501046_0568073_277_735 152
393 3300049741 Ga0501079_0844626 Ga0501079_0844626_153_611 152
394 3300049742 Ga0501080_1250902 Ga0501080_1250902_14_472 152
395 3300049742 Ga0501080_1503815 Ga0501080_1503815_35_493 152
396 3300050507 nmdc:mga05p37_691804_c1 nmdc:mga05p37_691804_c1_441_902 152
397 3300050509 nmdc:mga0qj67_14089_c1 nmdc:mga0qj67_14089_c1_3660_4118 152
398 3300050509 nmdc:mga0qj67_64631_c1 nmdc:mga0qj67_64631_c1_2345_2812 152
399 3300050510 nmdc:mga06r32_1100401_c1 nmdc:mga06r32_1100401_c1_17_484 152
400 3300050510 nmdc:mga06r32_246206_c1 nmdc:mga06r32_246206_c1_770_1237 152
401 3300050510 nmdc:mga06r32_705347_c1 nmdc:mga06r32_705347_c1_152_610 152
402 3300050512 nmdc:mga0n895_61829_c1 nmdc:mga0n895_61829_c1_748_1215 152
403 3300050512 nmdc:mga0n895_827296_c1 nmdc:mga0n895_827296_c1_274_741 152
404 3300050515 nmdc:mga0a205_54687_c2 nmdc:mga0a205_54687_c2_2498_2965 152
405 3300053078 Ga0495612_0118828 Ga0495612_0118828_519_986 152
406 3300053078 Ga0495612_0384875 Ga0495612_0384875_59_517 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13518

HTH_28

Helix-turn-helix domain

58

110

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly2.cif.gz_C-2 dna-binding domain of deor in complex with the dna operator 0.853 42 83
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.8426 42 84
5cy2-assembly2.cif.gz_E tn3 resolvase - site iii complex crystal form ii 0.8162 44 81
2x48-assembly1.cif.gz_A orf 55 from sulfolobus islandicus rudivirus 1 0.7914 42 77
4g8x-assembly1.cif.gz_A g1 orf67 / staphyloccus aureus sigmaa domain 4 complex 0.7908 43 77
ID Description Score Start End Superfamily
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8567 42 83 1.10.10.10
4l5jD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8544 41 84 1.10.10.10
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8535 41 84 1.10.10.10
4l5jA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8534 42 84 1.10.10.10
4l5jB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8528 41 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1M5Z2-F1-model_v4 Helix-turn-helix domain-containing protein 0.9553 1 93
AF-Q79FW3-F1-model_v4 Transposase 0.9515 39 92 GO:0043565
AF-A0A7G1IC18-F1-model_v4 Helix-turn-helix domain protein 0.9497 1 92
AF-J5EKF4-F1-model_v4 Insertion element IS150 protein InsJ-like helix-turn-helix domain-containing protein 0.9381 40 92 GO:0043565
AF-A0A1T4SKC1-F1-model_v4 Leucine-zipper of insertion element IS481 0.9266 41 94 GO:0043565

Feature Viewer

pLDDT pTM Quality
89.29 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map