F436220

General Info

Members Datasets Scaffolds Average Seq Length
406 213 812 346

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10004654|Ga0207707_100046549
Length 402
Sequence MPNIAIVAAVVLISVFLVIPAIVASFLRNVEAGTIRLVSWLAGGTVIYRGPGKSKEIPLLTTGTTISSKVINVDLDITDQTADLDEHGTPQPIKVRVLASAIVSVGETDILIKTAANRFFAKPDSDQVNTLTDLLSSSARRAINLLTHDQLFSAKSAPRVLPATASPSSAIVAVPQRAVTTQDSSNIETLEDDDDPLAVIIRKACSRELTDLGLIFNSLNIKVVQSEVADARRRMSAAEAQATADIVQAQQARRAKEATIEAERIISDRQRELEQTKAGNAALIAQAEAKRQEAMGVQRVAELDATQIAQARAEKVNKAIAAGGESYFRYRQIEMLPVIAPQIAAALAEAKLITVSGNEEGGAANGTTNQIVSVIQTVLAAQLVSKGGLLGDDSSGSGSKSK

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 2.96
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 4.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10004654 3300025912 Bacteria 12054
2 Ga0058863_11702357 3300004799 Bacteria 2911
3 Ga0070658_10014439 3300005327 Bacteria 6338
4 Ga0070658_10035329 3300005327 Bacteria 4025
5 Ga0070676_10000612 3300005328 Bacteria 17406
6 Ga0070676_10006322 3300005328 Bacteria 6330
7 Ga0070676_10029996 3300005328 Bacteria 3098
8 Ga0070683_100011347 3300005329 Bacteria 7697
9 Ga0070683_100051945 3300005329 Bacteria 3797
10 Ga0070683_100142484 3300005329 Bacteria 2271
11 Ga0070683_100152034 3300005329 Bacteria 2194
12 Ga0070690_100062607 3300005330 Unclassified 2399
13 Ga0070690_100087965 3300005330 Bacteria 2041
14 Ga0070670_100002963 3300005331 Bacteria 14060
15 Ga0070670_100029082 3300005331 Bacteria 4755
16 Ga0070677_10040097 3300005333 Unclassified 1841
17 Ga0068869_100002245 3300005334 Bacteria 11632
18 Ga0070680_100000469 3300005336 Bacteria 27578
19 Ga0070680_100002635 3300005336 Bacteria 13294
20 Ga0070680_100004684 3300005336 Bacteria 10288
21 Ga0070680_100072278 3300005336 Bacteria 2835
22 Ga0068868_100095555 3300005338 Unclassified 2399
23 Ga0070689_100131698 3300005340 Bacteria 2005
24 Ga0070687_100010074 3300005343 Bacteria 4070
25 Ga0070661_100021634 3300005344 Bacteria 4596
26 Ga0070668_100003270 3300005347 Bacteria 11947
27 Ga0070668_100015334 3300005347 Bacteria 5727
28 Ga0070668_100028288 3300005347 Bacteria 4256
29 Ga0070668_100052440 3300005347 Bacteria 3143
30 Ga0070669_100013825 3300005353 Bacteria 5737
31 Ga0070669_100053531 3300005353 Unclassified 2954
32 Ga0070669_100130055 3300005353 Bacteria 1930
33 Ga0070675_100019739 3300005354 Bacteria 5374
34 Ga0070671_100047459 3300005355 Bacteria 3571
35 Ga0070674_100000059 3300005356 Bacteria 48494
36 Ga0070674_100018390 3300005356 Bacteria 4418
37 Ga0070688_100019194 3300005365 Bacteria 3959
38 Ga0070659_100133823 3300005366 Bacteria 2015
39 Ga0070667_100077724 3300005367 Bacteria 2834
40 Ga0070667_100086892 3300005367 Bacteria 2683
41 Ga0070667_100277661 3300005367 Bacteria 1504
42 Ga0070713_100020245 3300005436 Bacteria 5097
43 Ga0070701_10010201 3300005438 Unclassified 4144
44 Ga0070711_100000338 3300005439 Bacteria 24084
45 Ga0070711_100149032 3300005439 Bacteria 1762
46 Ga0070705_100003303 3300005440 Bacteria 7924
47 Ga0070708_100048228 3300005445 Bacteria 3764
48 Ga0070678_100004371 3300005456 Bacteria 8003
49 Ga0070662_100000487 3300005457 Bacteria 23561
50 Ga0070662_100001720 3300005457 Bacteria 13471
51 Ga0070662_100112495 3300005457 Bacteria 2076
52 Ga0070681_10000472 3300005458 Bacteria 32805
53 Ga0070681_10004410 3300005458 Bacteria 13404
54 Ga0070681_10006802 3300005458 Bacteria 11131
55 Ga0070681_10066442 3300005458 Bacteria 3575
56 Ga0070681_10099419 3300005458 Bacteria 2855
57 Ga0068867_100008762 3300005459 Bacteria 7143
58 Ga0068867_100044344 3300005459 Unclassified 3258
59 Ga0068867_100053459 3300005459 Bacteria 2983
60 Ga0070706_100057331 3300005467 Bacteria 3594
61 Ga0070707_100060648 3300005468 Bacteria 3628
62 Ga0070707_100091577 3300005468 Bacteria 2943
63 Ga0070698_100003306 3300005471 Bacteria 17737
64 Ga0070698_100006745 3300005471 Bacteria 12447
65 Ga0070698_100045764 3300005471 Bacteria 4477
66 Ga0070698_100100331 3300005471 Bacteria 2868
67 Ga0070699_100034422 3300005518 Bacteria 4378
68 Ga0070699_100062542 3300005518 Bacteria 3226
69 Ga0070679_100001594 3300005530 Bacteria 20336
70 Ga0070679_100014309 3300005530 Bacteria 7619
71 Ga0070679_100036259 3300005530 Bacteria 4894
72 Ga0070679_100112255 3300005530 Bacteria 2712
73 Ga0070684_100018330 3300005535 Bacteria 5765
74 Ga0070684_100022057 3300005535 Bacteria 5307
75 Ga0070684_100241482 3300005535 Bacteria 1650
76 Ga0070697_100211124 3300005536 Bacteria 1653
77 Ga0068853_100035107 3300005539 Bacteria 4258
78 Ga0068853_100115339 3300005539 Bacteria 2390
79 Ga0070672_100009416 3300005543 Bacteria 6733
80 Ga0070672_100010313 3300005543 Bacteria 6477
81 Ga0070672_100024426 3300005543 Bacteria 4467
82 Ga0070672_100102110 3300005543 Bacteria 2327
83 Ga0070695_100054938 3300005545 Bacteria 2565
84 Ga0070696_100004379 3300005546 Bacteria 9412
85 Ga0070696_100006387 3300005546 Bacteria 7888
86 Ga0070693_100013276 3300005547 Bacteria 4193
87 Ga0070665_100007207 3300005548 Bacteria 11300
88 Ga0070704_100033415 3300005549 Unclassified 3477
89 Ga0068855_100108584 3300005563 Bacteria 3187
90 Ga0070664_100042669 3300005564 Bacteria 3828
91 Ga0070664_100133739 3300005564 Bacteria 2179
92 Ga0068857_100012198 3300005577 Bacteria 7475
93 Ga0068857_100124865 3300005577 Bacteria 2319
94 Ga0068854_100008470 3300005578 Bacteria 6613
95 Ga0068856_100041293 3300005614 Bacteria 4533
96 Ga0070702_100017933 3300005615 Bacteria 3662
97 Ga0070702_100031594 3300005615 Unclassified 2899
98 Ga0068852_100006761 3300005616 Bacteria 8322
99 Ga0068859_100018148 3300005617 Bacteria 7071
100 Ga0068859_100125244 3300005617 Bacteria 2638
101 Ga0068859_100143563 3300005617 Bacteria 2461
102 Ga0068859_100160462 3300005617 Bacteria 2327
103 Ga0068859_100248664 3300005617 Bacteria 1868
104 Ga0068864_100137238 3300005618 Bacteria 2203
105 Ga0068864_100174310 3300005618 Bacteria 1963
106 Ga0068866_10000191 3300005718 Bacteria 28693
107 Ga0068861_100001819 3300005719 Bacteria 13738
108 Ga0068863_100042596 3300005841 Bacteria 4313
109 Ga0068858_100160327 3300005842 Bacteria 2118
110 Ga0068860_100001544 3300005843 Bacteria 24792
111 Ga0068860_100019777 3300005843 Bacteria 6528
112 Ga0068862_100002733 3300005844 Bacteria 15486
113 Ga0068862_100096937 3300005844 Bacteria 2574
114 Ga0068862_100181108 3300005844 Bacteria 1891
115 Ga0070712_100115980 3300006175 Bacteria 2008
116 Ga0097621_100017901 3300006237 Bacteria 5396
117 Ga0075428_100028518 3300006844 Bacteria 6176
118 Ga0075428_100262335 3300006844 Bacteria 1860
119 Ga0075430_100154589 3300006846 Bacteria 1910
120 Ga0075433_10043006 3300006852 Bacteria 3921
121 Ga0075433_10062976 3300006852 Bacteria 3249
122 Ga0075433_10103289 3300006852 Bacteria 2524
123 Ga0075434_100023259 3300006871 Bacteria 6035
124 Ga0075434_100085187 3300006871 Bacteria 3159
125 Ga0075429_100036036 3300006880 Unclassified 4302
126 Ga0068865_100003645 3300006881 Bacteria 9247
127 Ga0068865_100129692 3300006881 Bacteria 1887
128 Ga0075436_100013619 3300006914 Bacteria 5571
129 Ga0075436_100021557 3300006914 Bacteria 4422
130 Ga0075436_100065788 3300006914 Bacteria 2505
131 Ga0097620_100018149 3300006931 Bacteria 7071
132 Ga0097620_100125249 3300006931 Bacteria 2638
133 Ga0097620_100143553 3300006931 Bacteria 2461
134 Ga0097620_100160464 3300006931 Bacteria 2327
135 Ga0097620_100248642 3300006931 Bacteria 1868
136 Ga0105240_10040411 3300009093 Bacteria 5965
137 Ga0105245_10152351 3300009098 Bacteria 2187
138 Ga0114129_10035495 3300009147 Bacteria 7043
139 Ga0114129_10041921 3300009147 Bacteria 6445
140 Ga0114129_10261670 3300009147 Bacteria 2318
141 Ga0114129_10292711 3300009147 Bacteria 2172
142 Ga0105243_10001204 3300009148 Bacteria 23293
143 Ga0105241_10001569 3300009174 Bacteria 17496
144 Ga0105241_10014558 3300009174 Bacteria 5760
145 Ga0105242_10007098 3300009176 Bacteria 8651
146 Ga0105242_10011925 3300009176 Bacteria 6690
147 Ga0105248_10001045 3300009177 Bacteria 30648
148 Ga0105248_10101411 3300009177 Bacteria 3245
149 Ga0105248_10131781 3300009177 Bacteria 2820
150 Ga0105248_10233572 3300009177 Bacteria 2070
151 Ga0105237_10038398 3300009545 Bacteria 4835
152 Ga0105249_10000339 3300009553 Bacteria 47235
153 Ga0105249_10002570 3300009553 Bacteria 15716
154 Ga0105249_10014464 3300009553 Bacteria 6975
155 Ga0105249_10015888 3300009553 Bacteria 6671
156 Ga0105239_10010525 3300010375 Bacteria 10338
157 Ga0157371_10032329 3300013102 Bacteria 3766
158 Ga0157370_10025191 3300013104 Bacteria 5889
159 Ga0157370_10037599 3300013104 Bacteria 4691
160 Ga0157370_10043845 3300013104 Bacteria 4302
161 Ga0157369_10039172 3300013105 Bacteria 5180
162 Ga0157369_10344536 3300013105 Bacteria 1548
163 Ga0157378_10003061 3300013297 Bacteria 14864
164 Ga0163162_10020249 3300013306 Bacteria 6533
165 Ga0163162_10023616 3300013306 Bacteria 6071
166 Ga0163162_10362872 3300013306 Bacteria 1581
167 Ga0157372_10061234 3300013307 Bacteria 4213
168 Ga0157372_10097904 3300013307 Bacteria 3346
169 Ga0157375_10045219 3300013308 Bacteria 4284
170 Ga0157375_10062953 3300013308 Bacteria 3688
171 Ga0157375_10170966 3300013308 Bacteria 2321
172 Ga0157375_10268145 3300013308 Bacteria 1869
173 Ga0157375_10351435 3300013308 Bacteria 1640
174 Ga0163163_10041744 3300014325 Bacteria 4488
175 Ga0163163_10075704 3300014325 Bacteria 3359
176 Ga0163163_10084056 3300014325 Bacteria 3189
177 Ga0163163_10173258 3300014325 Bacteria 2204
178 Ga0157380_10012161 3300014326 Bacteria 6234
179 Ga0157380_10034617 3300014326 Bacteria 3896
180 Ga0157379_10026630 3300014968 Bacteria 5148
181 Ga0157379_10028792 3300014968 Bacteria 4940
182 Ga0157379_10087336 3300014968 Bacteria 2796
183 Ga0157376_10026422 3300014969 Bacteria 4588
184 Ga0163161_10005879 3300017792 Bacteria 8511
185 Ga0163161_10009989 3300017792 Bacteria 6574
186 Ga0163161_10130400 3300017792 Bacteria 1896
187 Ga0213876_10004573 3300021384 Bacteria 7717
188 Ga0213876_10020812 3300021384 Bacteria 3468
189 Ga0213876_10036944 3300021384 Bacteria 2577
190 Ga0207699_10071106 3300025906 Unclassified 2127
191 Ga0207645_10001009 3300025907 Bacteria 23282
192 Ga0207645_10005398 3300025907 Bacteria 9273
193 Ga0207645_10038306 3300025907 Bacteria 3075
194 Ga0207643_10003628 3300025908 Bacteria 8318
195 Ga0207643_10012972 3300025908 Bacteria 4506
196 Ga0207705_10132956 3300025909 Bacteria 1853
197 Ga0207705_10191588 3300025909 Bacteria 1546
198 Ga0207654_10000366 3300025911 Bacteria 26595
199 Ga0207654_10032072 3300025911 Bacteria 2899
200 Ga0207707_10004727 3300025912 Bacteria 11950
201 Ga0207707_10014684 3300025912 Bacteria 6824
202 Ga0207707_10021254 3300025912 Bacteria 5672
203 Ga0207707_10025430 3300025912 Bacteria 5179
204 Ga0207707_10117907 3300025912 Bacteria 2320
205 Ga0207695_10010713 3300025913 Bacteria 11194
206 Ga0207695_10011869 3300025913 Bacteria 10501
207 Ga0207671_10070380 3300025914 Bacteria 2608
208 Ga0207693_10014884 3300025915 Bacteria 6248
209 Ga0207663_10000799 3300025916 Bacteria 14143
210 Ga0207660_10003308 3300025917 Bacteria 10525
211 Ga0207660_10006907 3300025917 Bacteria 7347
212 Ga0207660_10045016 3300025917 Bacteria 3107
213 Ga0207662_10000977 3300025918 Bacteria 13306
214 Ga0207662_10005391 3300025918 Bacteria 6812
215 Ga0207649_10025007 3300025920 Bacteria 3477
216 Ga0207649_10047556 3300025920 Bacteria 2641
217 Ga0207649_10055544 3300025920 Bacteria 2469
218 Ga0207649_10092487 3300025920 Bacteria 1983
219 Ga0207652_10006595 3300025921 Bacteria 9358
220 Ga0207652_10007972 3300025921 Bacteria 8503
221 Ga0207652_10015615 3300025921 Bacteria 6181
222 Ga0207652_10089183 3300025921 Bacteria 2707
223 Ga0207646_10052501 3300025922 Bacteria 3648
224 Ga0207646_10083359 3300025922 Bacteria 2860
225 Ga0207681_10001751 3300025923 Bacteria 13936
226 Ga0207681_10007541 3300025923 Bacteria 6667
227 Ga0207681_10068107 3300025923 Bacteria 2471
228 Ga0207681_10162630 3300025923 Bacteria 1684
229 Ga0207694_10094225 3300025924 Bacteria 2366
230 Ga0207650_10016152 3300025925 Bacteria 5213
231 Ga0207659_10045218 3300025926 Bacteria 3103
232 Ga0207659_10050721 3300025926 Bacteria 2949
233 Ga0207659_10086319 3300025926 Bacteria 2333
234 Ga0207700_10021470 3300025928 Bacteria 4409
235 Ga0207700_10045188 3300025928 Bacteria 3248
236 Ga0207664_10079556 3300025929 Bacteria 2661
237 Ga0207644_10016907 3300025931 Bacteria 4915
238 Ga0207690_10031511 3300025932 Bacteria 3394
239 Ga0207706_10000729 3300025933 Bacteria 34380
240 Ga0207706_10003436 3300025933 Bacteria 15125
241 Ga0207706_10095351 3300025933 Bacteria 2617
242 Ga0207706_10122452 3300025933 Bacteria 2288
243 Ga0207686_10000088 3300025934 Bacteria 76743
244 Ga0207709_10004082 3300025935 Bacteria 8496
245 Ga0207669_10001737 3300025937 Bacteria 9253
246 Ga0207704_10000663 3300025938 Bacteria 15229
247 Ga0207704_10039680 3300025938 Bacteria 2744
248 Ga0207704_10085478 3300025938 Bacteria 2054
249 Ga0207691_10021214 3300025940 Bacteria 6137
250 Ga0207691_10030293 3300025940 Bacteria 5057
251 Ga0207691_10046174 3300025940 Bacteria 4005
252 Ga0207691_10122309 3300025940 Bacteria 2305
253 Ga0207711_10149232 3300025941 Unclassified 2108
254 Ga0207661_10026138 3300025944 Bacteria 4444
255 Ga0207661_10037809 3300025944 Bacteria 3778
256 Ga0207661_10077666 3300025944 Bacteria 2731
257 Ga0207661_10127366 3300025944 Bacteria 2176
258 Ga0207661_10129822 3300025944 Bacteria 2157
259 Ga0207661_10149535 3300025944 Bacteria 2017
260 Ga0207661_10182426 3300025944 Bacteria 1834
261 Ga0207679_10001461 3300025945 Bacteria 14801
262 Ga0207679_10015190 3300025945 Bacteria 5080
263 Ga0207667_10139562 3300025949 Bacteria 2495
264 Ga0207651_10141739 3300025960 Bacteria 1857
265 Ga0207712_10000086 3300025961 Bacteria 107484
266 Ga0207712_10003562 3300025961 Bacteria 9821
267 Ga0207712_10008212 3300025961 Bacteria 6598
268 Ga0207712_10010561 3300025961 Bacteria 5865
269 Ga0207668_10007938 3300025972 Bacteria 6313
270 Ga0207668_10036219 3300025972 Bacteria 3292
271 Ga0207640_10022043 3300025981 Bacteria 3807
272 Ga0207640_10088291 3300025981 Bacteria 2140
273 Ga0207677_10100796 3300026023 Bacteria 2124
274 Ga0207703_10026069 3300026035 Bacteria 4600
275 Ga0207703_10127004 3300026035 Bacteria 2197
276 Ga0207639_10061664 3300026041 Bacteria 2897
277 Ga0207708_10031929 3300026075 Unclassified 3999
278 Ga0207702_10023848 3300026078 Bacteria 5075
279 Ga0207641_10045464 3300026088 Bacteria 3697
280 Ga0207641_10198812 3300026088 Unclassified 1847
281 Ga0207648_10000096 3300026089 Bacteria 83916
282 Ga0207648_10065403 3300026089 Bacteria 3170
283 Ga0207648_10085504 3300026089 Unclassified 2751
284 Ga0207674_10003154 3300026116 Bacteria 20318
285 Ga0207674_10011782 3300026116 Bacteria 9810
286 Ga0207674_10016395 3300026116 Bacteria 8111
287 Ga0207674_10020403 3300026116 Bacteria 7160
288 Ga0207674_10078366 3300026116 Bacteria 3309
289 Ga0207675_100000266 3300026118 Bacteria 49669
290 Ga0207675_100004312 3300026118 Bacteria 13743
291 Ga0207675_100048968 3300026118 Bacteria 3945
292 Ga0207683_10007740 3300026121 Bacteria 9198
293 Ga0207698_10009442 3300026142 Bacteria 6222
294 Ga0268266_10014126 3300028379 Bacteria 6875
295 Ga0268265_10002395 3300028380 Bacteria 14173
296 Ga0268265_10014404 3300028380 Bacteria 5387
297 Ga0268265_10024234 3300028380 Bacteria 4290
298 Ga0268264_10006417 3300028381 Bacteria 9905
299 Ga0268264_10046309 3300028381 Bacteria 3612
300 Ga0307408_100001456 3300031548 Bacteria 17604
301 Ga0307410_10017755 3300031852 Bacteria 4281
302 Ga0307410_10171113 3300031852 Bacteria 1637
303 Ga0307411_10033577 3300032005 Bacteria 3184
304 Ga0307415_100028301 3300032126 Bacteria 3564
305 Ga0373934_0000743 3300035086 Bacteria 11645
306 Ga0373934_0019683 3300035086 Bacteria 2592
307 Ga0373923_0002095 3300035111 Bacteria 6042
308 Ga0373954_0038026 3300035118 Bacteria 2237
309 Ga0373954_0058529 3300035118 Bacteria 1815
310 Ga0373956_0002527 3300035119 Bacteria 7450
311 Ga0373957_0013528 3300035120 Bacteria 2770
312 Ga0373955_0005928 3300035172 Bacteria 5531
313 Ga0373933_0005022 3300035724 Bacteria 7214
314 Ga0395900_0186524 3300037418 Bacteria 2105
315 Ga0395901_0003073 3300038443 Bacteria 16812
316 Ga0436365_0062615 3300039437 Bacteria 2788
317 Ga0436365_0346340 3300039437 Bacteria 26412
318 Ga0436365_1415115 3300039437 Bacteria 12763
319 Ga0466966_0021845 3300044684 Bacteria 4201
320 Ga0466959_0020433 3300045049 Bacteria 4879
321 Ga0451576_0005974 3300045051 Bacteria 15068
322 Ga0451576_0014624 3300045051 Bacteria 8722
323 Ga0495592_0027494 3300046454 Bacteria 4313
324 Ga0495592_0191047 3300046454 Bacteria 1388
325 Ga0495603_0036174 3300046455 Bacteria 2964
326 Ga0495629_0144677 3300046459 Bacteria 1654
327 Ga0495651_0011749 3300046462 Bacteria 6728
328 Ga0495651_0016576 3300046462 Bacteria 5706
329 Ga0495653_0010680 3300046463 Bacteria 7518
330 Ga0495639_0046769 3300046475 Bacteria 1959
331 Ga0495662_0044440 3300046476 Bacteria 2145
332 Ga0495594_0014291 3300046499 Bacteria 4155
333 Ga0495594_0027447 3300046499 Bacteria 3068
334 Ga0495608_0076404 3300046511 Bacteria 2182
335 Ga0495628_0008051 3300046516 Bacteria 9070
336 Ga0495628_0026472 3300046516 Bacteria 4729
337 Ga0495630_0131176 3300046517 Bacteria 1903
338 Ga0495652_0005538 3300046529 Bacteria 11880
339 Ga0495652_0015689 3300046529 Bacteria 6780
340 Ga0495665_0001043 3300046531 Bacteria 14706
341 Ga0495587_0002385 3300046536 Bacteria 12534
342 Ga0495587_0005712 3300046536 Bacteria 8107
343 Ga0495645_0000543 3300046543 Bacteria 25876
344 Ga0495645_0010848 3300046543 Bacteria 6401
345 Ga0495667_0000538 3300046559 Bacteria 24210
346 Ga0495667_0029562 3300046559 Bacteria 3688
347 Ga0495635_0001636 3300046663 Bacteria 15101
348 Ga0495635_0119417 3300046663 Bacteria 1799
349 Ga0495657_0002639 3300046675 Bacteria 15004
350 Ga0495657_0085418 3300046675 Bacteria 2034
351 Ga0495599_0001165 3300046678 Bacteria 14919
352 Ga0495599_0022865 3300046678 Bacteria 3904
353 Ga0495623_0002680 3300046679 Bacteria 11747
354 Ga0495623_0019303 3300046679 Bacteria 4407
355 Ga0495623_0064899 3300046679 Bacteria 2284
356 Ga0495646_0004172 3300046680 Bacteria 9080
357 Ga0495658_0062371 3300046683 Bacteria 2143
358 Ga0495600_0003756 3300046809 Bacteria 8987
359 Ga0495600_0143831 3300046809 Bacteria 1546
360 Ga0495581_0053138 3300047315 Bacteria 2340
361 Ga0495674_0018412 3300047319 Bacteria 6502
362 Ga0495672_0004972 3300047320 Bacteria 10668
363 Ga0495675_0020516 3300047444 Bacteria 4204
364 Ga0495675_0116947 3300047444 Bacteria 1662
365 Ga0495685_045426 3300047447 Bacteria 1496
366 Ga0495684_0001996 3300047471 Bacteria 16406
367 Ga0495684_0005517 3300047471 Bacteria 9851
368 Ga0495684_0037948 3300047471 Bacteria 3695
369 Ga0495602_0058542 3300048088 Bacteria 3371
370 Ga0496102_0009974 3300048905 Bacteria 8167
371 Ga0496104_0007470 3300048907 Bacteria 9660
372 Ga0496106_0023959 3300048909 Unclassified 4536
373 Ga0496106_0053254 3300048909 Bacteria 3056
374 Ga0496108_0034297 3300048911 Bacteria 4216
375 Ga0496108_0101473 3300048911 Unclassified 2455
376 Ga0496109_0005786 3300048912 Bacteria 10348
377 Ga0496109_0011100 3300048912 Bacteria 7724
378 Ga0496111_0022955 3300048914 Bacteria 4375
379 Ga0496112_0035240 3300048915 Bacteria 4873
380 Ga0496112_0035713 3300048915 Bacteria 4844
381 Ga0496115_0122660 3300048918 Bacteria 2139
382 Ga0501038_0233132 3300049574 Bacteria 1464
383 Ga0501043_0161570 3300049579 Bacteria 1750
384 nmdc:mga0k408_87432_c1 3300050493 Bacteria 1830
385 nmdc:mga05p37_242929_c1 3300050507 Bacteria 2164
386 nmdc:mga05p37_36105_c1 3300050507 Bacteria 6063
387 nmdc:mga09592_129910_c1 3300050508 Bacteria 2167
388 nmdc:mga09592_51404_c1 3300050508 Unclassified 3477
389 nmdc:mga0qj67_208498_c1 3300050509 Bacteria 1587
390 nmdc:mga0qj67_57880_c1 3300050509 Bacteria 3073
391 nmdc:mga06r32_376392_c1 3300050510 Bacteria 1403
392 nmdc:mga08y16_147643_c1 3300050511 Bacteria 2444
393 nmdc:mga08y16_40691_c1 3300050511 Bacteria 4870
394 nmdc:mga0n895_191180_c1 3300050512 Bacteria 2078
395 nmdc:mga0n895_22093_c1 3300050512 Bacteria 5963
396 nmdc:mga0n895_55415_c1 3300050512 Bacteria 3902
397 nmdc:mga0rr50_28422_c1 3300050513 Bacteria 3931
398 nmdc:mga08x19_10021_c1 3300050514 Bacteria 5681
399 nmdc:mga08x19_12633_c1 3300050514 Bacteria 5093
400 nmdc:mga08x19_6187_c1 3300050514 Bacteria 7076
401 nmdc:mga0a205_13346_c2 3300050515 Bacteria 2835
402 nmdc:mga0a205_18497_c1 3300050515 Bacteria 6553
403 nmdc:mga0a205_273179_c1 3300050515 Bacteria 1567
404 Ga0495601_0032175 3300053077 Bacteria 3264
405 Ga0495612_0002439 3300053078 Bacteria 7664
406 Ga0495595_0002996 3300053084 Bacteria 6673
407 Ga0207707_10004654
408 Ga0058863_11702357
409 Ga0070658_10014439
410 Ga0070658_10035329
411 Ga0070676_10000612
412 Ga0070676_10006322
413 Ga0070676_10029996
414 Ga0070683_100011347
415 Ga0070683_100051945
416 Ga0070683_100142484
417 Ga0070683_100152034
418 Ga0070690_100062607
419 Ga0070690_100087965
420 Ga0070670_100002963
421 Ga0070670_100029082
422 Ga0070677_10040097
423 Ga0068869_100002245
424 Ga0070680_100000469
425 Ga0070680_100002635
426 Ga0070680_100004684
427 Ga0070680_100072278
428 Ga0068868_100095555
429 Ga0070689_100131698
430 Ga0070687_100010074
431 Ga0070661_100021634
432 Ga0070668_100003270
433 Ga0070668_100015334
434 Ga0070668_100028288
435 Ga0070668_100052440
436 Ga0070669_100013825
437 Ga0070669_100053531
438 Ga0070669_100130055
439 Ga0070675_100019739
440 Ga0070671_100047459
441 Ga0070674_100000059
442 Ga0070674_100018390
443 Ga0070688_100019194
444 Ga0070659_100133823
445 Ga0070667_100077724
446 Ga0070667_100086892
447 Ga0070667_100277661
448 Ga0070713_100020245
449 Ga0070701_10010201
450 Ga0070711_100000338
451 Ga0070711_100149032
452 Ga0070705_100003303
453 Ga0070708_100048228
454 Ga0070678_100004371
455 Ga0070662_100000487
456 Ga0070662_100001720
457 Ga0070662_100112495
458 Ga0070681_10000472
459 Ga0070681_10004410
460 Ga0070681_10006802
461 Ga0070681_10066442
462 Ga0070681_10099419
463 Ga0068867_100008762
464 Ga0068867_100044344
465 Ga0068867_100053459
466 Ga0070706_100057331
467 Ga0070707_100060648
468 Ga0070707_100091577
469 Ga0070698_100003306
470 Ga0070698_100006745
471 Ga0070698_100045764
472 Ga0070698_100100331
473 Ga0070699_100034422
474 Ga0070699_100062542
475 Ga0070679_100001594
476 Ga0070679_100014309
477 Ga0070679_100036259
478 Ga0070679_100112255
479 Ga0070684_100018330
480 Ga0070684_100022057
481 Ga0070684_100241482
482 Ga0070697_100211124
483 Ga0068853_100035107
484 Ga0068853_100115339
485 Ga0070672_100009416
486 Ga0070672_100010313
487 Ga0070672_100024426
488 Ga0070672_100102110
489 Ga0070695_100054938
490 Ga0070696_100004379
491 Ga0070696_100006387
492 Ga0070693_100013276
493 Ga0070665_100007207
494 Ga0070704_100033415
495 Ga0068855_100108584
496 Ga0070664_100042669
497 Ga0070664_100133739
498 Ga0068857_100012198
499 Ga0068857_100124865
500 Ga0068854_100008470
501 Ga0068856_100041293
502 Ga0070702_100017933
503 Ga0070702_100031594
504 Ga0068852_100006761
505 Ga0068859_100018148
506 Ga0068859_100125244
507 Ga0068859_100143563
508 Ga0068859_100160462
509 Ga0068859_100248664
510 Ga0068864_100137238
511 Ga0068864_100174310
512 Ga0068866_10000191
513 Ga0068861_100001819
514 Ga0068863_100042596
515 Ga0068858_100160327
516 Ga0068860_100001544
517 Ga0068860_100019777
518 Ga0068862_100002733
519 Ga0068862_100096937
520 Ga0068862_100181108
521 Ga0070712_100115980
522 Ga0097621_100017901
523 Ga0075428_100028518
524 Ga0075428_100262335
525 Ga0075430_100154589
526 Ga0075433_10043006
527 Ga0075433_10062976
528 Ga0075433_10103289
529 Ga0075434_100023259
530 Ga0075434_100085187
531 Ga0075429_100036036
532 Ga0068865_100003645
533 Ga0068865_100129692
534 Ga0075436_100013619
535 Ga0075436_100021557
536 Ga0075436_100065788
537 Ga0097620_100018149
538 Ga0097620_100125249
539 Ga0097620_100143553
540 Ga0097620_100160464
541 Ga0097620_100248642
542 Ga0105240_10040411
543 Ga0105245_10152351
544 Ga0114129_10035495
545 Ga0114129_10041921
546 Ga0114129_10261670
547 Ga0114129_10292711
548 Ga0105243_10001204
549 Ga0105241_10001569
550 Ga0105241_10014558
551 Ga0105242_10007098
552 Ga0105242_10011925
553 Ga0105248_10001045
554 Ga0105248_10101411
555 Ga0105248_10131781
556 Ga0105248_10233572
557 Ga0105237_10038398
558 Ga0105249_10000339
559 Ga0105249_10002570
560 Ga0105249_10014464
561 Ga0105249_10015888
562 Ga0105239_10010525
563 Ga0157371_10032329
564 Ga0157370_10025191
565 Ga0157370_10037599
566 Ga0157370_10043845
567 Ga0157369_10039172
568 Ga0157369_10344536
569 Ga0157378_10003061
570 Ga0163162_10020249
571 Ga0163162_10023616
572 Ga0163162_10362872
573 Ga0157372_10061234
574 Ga0157372_10097904
575 Ga0157375_10045219
576 Ga0157375_10062953
577 Ga0157375_10170966
578 Ga0157375_10268145
579 Ga0157375_10351435
580 Ga0163163_10041744
581 Ga0163163_10075704
582 Ga0163163_10084056
583 Ga0163163_10173258
584 Ga0157380_10012161
585 Ga0157380_10034617
586 Ga0157379_10026630
587 Ga0157379_10028792
588 Ga0157379_10087336
589 Ga0157376_10026422
590 Ga0163161_10005879
591 Ga0163161_10009989
592 Ga0163161_10130400
593 Ga0213876_10004573
594 Ga0213876_10020812
595 Ga0213876_10036944
596 Ga0207699_10071106
597 Ga0207645_10001009
598 Ga0207645_10005398
599 Ga0207645_10038306
600 Ga0207643_10003628
601 Ga0207643_10012972
602 Ga0207705_10132956
603 Ga0207705_10191588
604 Ga0207654_10000366
605 Ga0207654_10032072
606 Ga0207707_10004727
607 Ga0207707_10014684
608 Ga0207707_10021254
609 Ga0207707_10025430
610 Ga0207707_10117907
611 Ga0207695_10010713
612 Ga0207695_10011869
613 Ga0207671_10070380
614 Ga0207693_10014884
615 Ga0207663_10000799
616 Ga0207660_10003308
617 Ga0207660_10006907
618 Ga0207660_10045016
619 Ga0207662_10000977
620 Ga0207662_10005391
621 Ga0207649_10025007
622 Ga0207649_10047556
623 Ga0207649_10055544
624 Ga0207649_10092487
625 Ga0207652_10006595
626 Ga0207652_10007972
627 Ga0207652_10015615
628 Ga0207652_10089183
629 Ga0207646_10052501
630 Ga0207646_10083359
631 Ga0207681_10001751
632 Ga0207681_10007541
633 Ga0207681_10068107
634 Ga0207681_10162630
635 Ga0207694_10094225
636 Ga0207650_10016152
637 Ga0207659_10045218
638 Ga0207659_10050721
639 Ga0207659_10086319
640 Ga0207700_10021470
641 Ga0207700_10045188
642 Ga0207664_10079556
643 Ga0207644_10016907
644 Ga0207690_10031511
645 Ga0207706_10000729
646 Ga0207706_10003436
647 Ga0207706_10095351
648 Ga0207706_10122452
649 Ga0207686_10000088
650 Ga0207709_10004082
651 Ga0207669_10001737
652 Ga0207704_10000663
653 Ga0207704_10039680
654 Ga0207704_10085478
655 Ga0207691_10021214
656 Ga0207691_10030293
657 Ga0207691_10046174
658 Ga0207691_10122309
659 Ga0207711_10149232
660 Ga0207661_10026138
661 Ga0207661_10037809
662 Ga0207661_10077666
663 Ga0207661_10127366
664 Ga0207661_10129822
665 Ga0207661_10149535
666 Ga0207661_10182426
667 Ga0207679_10001461
668 Ga0207679_10015190
669 Ga0207667_10139562
670 Ga0207651_10141739
671 Ga0207712_10000086
672 Ga0207712_10003562
673 Ga0207712_10008212
674 Ga0207712_10010561
675 Ga0207668_10007938
676 Ga0207668_10036219
677 Ga0207640_10022043
678 Ga0207640_10088291
679 Ga0207677_10100796
680 Ga0207703_10026069
681 Ga0207703_10127004
682 Ga0207639_10061664
683 Ga0207708_10031929
684 Ga0207702_10023848
685 Ga0207641_10045464
686 Ga0207641_10198812
687 Ga0207648_10000096
688 Ga0207648_10065403
689 Ga0207648_10085504
690 Ga0207674_10003154
691 Ga0207674_10011782
692 Ga0207674_10016395
693 Ga0207674_10020403
694 Ga0207674_10078366
695 Ga0207675_100000266
696 Ga0207675_100004312
697 Ga0207675_100048968
698 Ga0207683_10007740
699 Ga0207698_10009442
700 Ga0268266_10014126
701 Ga0268265_10002395
702 Ga0268265_10014404
703 Ga0268265_10024234
704 Ga0268264_10006417
705 Ga0268264_10046309
706 Ga0307408_100001456
707 Ga0307410_10017755
708 Ga0307410_10171113
709 Ga0307411_10033577
710 Ga0307415_100028301
711 Ga0373934_0000743
712 Ga0373934_0019683
713 Ga0373923_0002095
714 Ga0373954_0038026
715 Ga0373954_0058529
716 Ga0373956_0002527
717 Ga0373957_0013528
718 Ga0373955_0005928
719 Ga0373933_0005022
720 Ga0395900_0186524
721 Ga0395901_0003073
722 Ga0436365_0062615
723 Ga0436365_0346340
724 Ga0436365_1415115
725 Ga0466966_0021845
726 Ga0466959_0020433
727 Ga0451576_0005974
728 Ga0451576_0014624
729 Ga0495592_0027494
730 Ga0495592_0191047
731 Ga0495603_0036174
732 Ga0495629_0144677
733 Ga0495651_0011749
734 Ga0495651_0016576
735 Ga0495653_0010680
736 Ga0495639_0046769
737 Ga0495662_0044440
738 Ga0495594_0014291
739 Ga0495594_0027447
740 Ga0495608_0076404
741 Ga0495628_0008051
742 Ga0495628_0026472
743 Ga0495630_0131176
744 Ga0495652_0005538
745 Ga0495652_0015689
746 Ga0495665_0001043
747 Ga0495587_0002385
748 Ga0495587_0005712
749 Ga0495645_0000543
750 Ga0495645_0010848
751 Ga0495667_0000538
752 Ga0495667_0029562
753 Ga0495635_0001636
754 Ga0495635_0119417
755 Ga0495657_0002639
756 Ga0495657_0085418
757 Ga0495599_0001165
758 Ga0495599_0022865
759 Ga0495623_0002680
760 Ga0495623_0019303
761 Ga0495623_0064899
762 Ga0495646_0004172
763 Ga0495658_0062371
764 Ga0495600_0003756
765 Ga0495600_0143831
766 Ga0495581_0053138
767 Ga0495674_0018412
768 Ga0495672_0004972
769 Ga0495675_0020516
770 Ga0495675_0116947
771 Ga0495685_045426
772 Ga0495684_0001996
773 Ga0495684_0005517
774 Ga0495684_0037948
775 Ga0495602_0058542
776 Ga0496102_0009974
777 Ga0496104_0007470
778 Ga0496106_0023959
779 Ga0496106_0053254
780 Ga0496108_0034297
781 Ga0496108_0101473
782 Ga0496109_0005786
783 Ga0496109_0011100
784 Ga0496111_0022955
785 Ga0496112_0035240
786 Ga0496112_0035713
787 Ga0496115_0122660
788 Ga0501038_0233132
789 Ga0501043_0161570
790 nmdc:mga0k408_87432_c1
791 nmdc:mga05p37_242929_c1
792 nmdc:mga05p37_36105_c1
793 nmdc:mga09592_129910_c1
794 nmdc:mga09592_51404_c1
795 nmdc:mga0qj67_208498_c1
796 nmdc:mga0qj67_57880_c1
797 nmdc:mga06r32_376392_c1
798 nmdc:mga08y16_147643_c1
799 nmdc:mga08y16_40691_c1
800 nmdc:mga0n895_191180_c1
801 nmdc:mga0n895_22093_c1
802 nmdc:mga0n895_55415_c1
803 nmdc:mga0rr50_28422_c1
804 nmdc:mga08x19_10021_c1
805 nmdc:mga08x19_12633_c1
806 nmdc:mga08x19_6187_c1
807 nmdc:mga0a205_13346_c2
808 nmdc:mga0a205_18497_c1
809 nmdc:mga0a205_273179_c1
810 Ga0495601_0032175
811 Ga0495612_0002439
812 Ga0495595_0002996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map