F436013

General Info

Members Datasets Scaffolds Average Seq Length
405 187 389 163

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_0458474|Ga0451807_0458474_32_508
Length 158
Sequence MKRSIIALIAICAVTFLGCENSNGQENAKKLSKPAKEWKKTLSANAYHIMVESGTEPPFQNAYHDNHQKGIYVSAATGEVLFSSEDKFDSGTGWPSFVKPVDPKKIKIVKDYTYGVREEVIEASTGLHLGHVFDDGPANRGGKRYCMNSGALKFIKQP

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367651 Pedobacter sp. OK291 Isolate Unclassified
3 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
4 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
5 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
6 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
7 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
11 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
12 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
13 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
21 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
22 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
179 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
187 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0.49
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.89
Nodule 0
Rhizoplane 1.48
Rhizosphere 78.27
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006519 3300001979 Bacteria 4822
2 JGI24740J21852_10011146 3300001979 Bacteria 3432
3 JGI24739J22299_10012706 3300001989 Bacteria 3088
4 JGI24737J22298_10015167 3300001990 Unclassified 2495
5 JGI24735J21928_10000003 3300002067 Bacteria 385983
6 JGI24744J21845_10011597 3300002077 Bacteria 1801
7 JGI25162J39368_1000022 3300002737 Bacteria 239510
8 JGI25154J39366_1000041 3300002738 Bacteria 144221
9 JGI25157J39369_1005103 3300002741 Bacteria 2202
10 JGI25157J39369_1009319 3300002741 Bacteria 1326
11 JGI25164J39214_1001399 3300002772 Bacteria 5723
12 JGI25165J46597_1001179 3300003214 Bacteria 16018
13 JGI25153J46596_10007527 3300003215 Bacteria 5336
14 rootH1_10038740 3300003316 Bacteria 12495
15 rootH1_10038740 3300003323 Bacteria 4304
16 rootH1_10043582 3300003316 Bacteria 19382
17 rootH1_10061015 3300003316 Bacteria 2913
18 rootH1_10126176 3300003316 Bacteria 4481
19 rootH1_10193810 3300003316 Bacteria 1860
20 rootH2_10002077 3300003320 Bacteria 2407
21 rootH2_10003269 3300003320 Bacteria 51191
22 rootH2_10004415 3300003320 Bacteria 27098
23 rootH2_10057092 3300003320 Bacteria 3648
24 rootH2_10073845 3300003320 Bacteria 5806
25 rootH2_10096525 3300003320 Bacteria 5981
26 rootH2_10250623 3300003320 Bacteria 1595
27 rootL2_10109183 3300003322 Bacteria 3216
28 rootL2_10310450 3300003322 Bacteria 1366
29 rootH1_10006785 3300003323 Bacteria 51850
30 rootH1_10028473 3300003323 Bacteria 8789
31 rootH1_10083018 3300003323 Bacteria 5372
32 rootH1_10106222 3300003323 Bacteria 4126
33 rootH1_10256739 3300003323 Bacteria 2474
34 rootH1_10295516 3300003323 Bacteria 1684
35 JGI25160J50197_1023926 3300003354 Bacteria 1746
36 Ga0065165_1036539 3300005262 Bacteria 1498
37 Ga0065714_10078008 3300005288 Bacteria 2625
38 Ga0070658_10000019 3300005327 Bacteria 194742
39 Ga0070658_10302097 3300005327 Bacteria 1365
40 Ga0070676_10001139 3300005328 Bacteria 13274
41 Ga0070683_100082764 3300005329 Bacteria 3006
42 Ga0070660_100076030 3300005339 Unclassified 2630
43 Ga0070660_100290070 3300005339 Bacteria 1340
44 Ga0070660_100812259 3300005339 Unclassified 787
45 Ga0070661_100586282 3300005344 Bacteria 900
46 Ga0070671_100014867 3300005355 Bacteria 6289
47 Ga0070673_100010060 3300005364 Bacteria 6385
48 Ga0070673_100022160 3300005364 Bacteria 4619
49 Ga0070673_100745816 3300005364 Bacteria 901
50 Ga0070659_100000516 3300005366 Bacteria 28377
51 Ga0070659_100052720 3300005366 Unclassified 3200
52 Ga0070659_100184461 3300005366 Bacteria 1713
53 Ga0070662_100000167 3300005457 Bacteria 38204
54 Ga0068867_100000116 3300005459 Bacteria 50447
55 Ga0070679_100107671 3300005530 Bacteria 2773
56 Ga0068853_100029566 3300005539 Bacteria 4621
57 Ga0068853_100061885 3300005539 Bacteria 3238
58 Ga0068853_100310347 3300005539 Bacteria 1460
59 Ga0068853_100317367 3300005539 Bacteria 1444
60 Ga0068853_100476372 3300005539 Bacteria 1176
61 Ga0070672_100044786 3300005543 Bacteria 3419
62 Ga0070665_100000003 3300005548 Bacteria 811857
63 Ga0070665_100000118 3300005548 Bacteria 149830
64 Ga0068855_100000519 3300005563 Bacteria 47297
65 Ga0068855_100004987 3300005563 Bacteria 16203
66 Ga0068855_100036541 3300005563 Bacteria 5846
67 Ga0068855_100104634 3300005563 Bacteria 3255
68 Ga0068855_100147695 3300005563 Bacteria 2675
69 Ga0068855_100246565 3300005563 Bacteria 1994
70 Ga0068855_100247567 3300005563 Bacteria 1989
71 Ga0068855_100433366 3300005563 Bacteria 1437
72 Ga0068855_100865230 3300005563 Bacteria 957
73 Ga0068854_100452075 3300005578 Bacteria 1073
74 Ga0068856_100286632 3300005614 Bacteria 1664
75 Ga0068856_100508535 3300005614 Bacteria 1226
76 Ga0068856_101080656 3300005614 Bacteria 820
77 Ga0068852_100022204 3300005616 Bacteria 5085
78 Ga0068852_100027413 3300005616 Bacteria 4643
79 Ga0068852_100221709 3300005616 Bacteria 1799
80 Ga0068866_10158306 3300005718 Bacteria 1318
81 Ga0068851_10511185 3300005834 Bacteria 721
82 Ga0068858_100493617 3300005842 Bacteria 1182
83 Ga0075366_10000849 3300006195 Bacteria 14722
84 Ga0075366_10033461 3300006195 Bacteria 3028
85 Ga0075366_10156095 3300006195 Bacteria 1382
86 Ga0097621_100000054 3300006237 Bacteria 59756
87 Ga0097621_100000365 3300006237 Bacteria 31399
88 Ga0068871_100000145 3300006358 Bacteria 46320
89 Ga0068871_100000248 3300006358 Bacteria 37581
90 Ga0068865_100000051 3300006881 Bacteria 65346
91 Ga0068865_100000211 3300006881 Bacteria 32506
92 Ga0105240_10002706 3300009093 Bacteria 28164
93 Ga0105240_10010766 3300009093 Bacteria 12824
94 Ga0105240_10109758 3300009093 Bacteria 3340
95 Ga0105240_10155147 3300009093 Bacteria 2724
96 Ga0105240_10219528 3300009093 Bacteria 2216
97 Ga0105240_10222857 3300009093 Bacteria 2196
98 Ga0105240_10249441 3300009093 Bacteria 2054
99 Ga0105240_10267936 3300009093 Bacteria 1968
100 Ga0105240_10544904 3300009093 Bacteria 1284
101 Ga0105240_10652558 3300009093 Bacteria 1153
102 Ga0105240_10908367 3300009093 Bacteria 947
103 Ga0105240_11759600 3300009093 Bacteria 646
104 Ga0105245_10182148 3300009098 Bacteria 2008
105 Ga0105241_10002488 3300009174 Bacteria 13845
106 Ga0105241_10004950 3300009174 Bacteria 9827
107 Ga0105241_10018205 3300009174 Bacteria 5164
108 Ga0105241_10642219 3300009174 Bacteria 963
109 Ga0105242_10081974 3300009176 Unclassified 2699
110 Ga0105237_10001447 3300009545 Bacteria 31365
111 Ga0105237_10001687 3300009545 Bacteria 28587
112 Ga0105237_10002107 3300009545 Bacteria 25126
113 Ga0105237_10002246 3300009545 Bacteria 24061
114 Ga0105237_10026057 3300009545 Bacteria 5976
115 Ga0105237_10026966 3300009545 Bacteria 5869
116 Ga0105237_10255784 3300009545 Bacteria 1753
117 Ga0105237_10359144 3300009545 Bacteria 1461
118 Ga0105237_10523327 3300009545 Bacteria 1193
119 Ga0105237_10726683 3300009545 Bacteria 999
120 Ga0105237_10994846 3300009545 Bacteria 845
121 Ga0105238_10096637 3300009551 Bacteria 2940
122 Ga0105238_10183082 3300009551 Bacteria 2071
123 Ga0105238_11102221 3300009551 Bacteria 817
124 Ga0105239_10000002 3300010375 Bacteria 610298
125 Ga0105239_10000440 3300010375 Bacteria 60691
126 Ga0105239_10001688 3300010375 Bacteria 29112
127 Ga0105239_10013721 3300010375 Bacteria 8996
128 Ga0105239_10067347 3300010375 Bacteria 3934
129 Ga0105239_10075730 3300010375 Bacteria 3701
130 Ga0105239_10133585 3300010375 Bacteria 2762
131 Ga0105239_10655837 3300010375 Bacteria 1199
132 Ga0105239_10727843 3300010375 Bacteria 1135
133 Ga0105246_10104735 3300011119 Bacteria 2066
134 Ga0157373_10000273 3300013100 Bacteria 41492
135 Ga0157371_10042240 3300013102 Bacteria 3250
136 Ga0157371_10142645 3300013102 Bacteria 1706
137 Ga0157370_10223259 3300013104 Bacteria 1745
138 Ga0157370_10386921 3300013104 Bacteria 1288
139 Ga0157370_10664814 3300013104 Unclassified 952
140 Ga0157369_10003273 3300013105 Bacteria 19291
141 Ga0157369_10368658 3300013105 Bacteria 1491
142 Ga0157374_10010923 3300013296 Bacteria 7840
143 Ga0157374_10014928 3300013296 Bacteria 6807
144 Ga0157374_10027886 3300013296 Bacteria 5098
145 Ga0157374_10036041 3300013296 Bacteria 4530
146 Ga0157374_10078775 3300013296 Bacteria 3121
147 Ga0157374_10238055 3300013296 Unclassified 1789
148 Ga0157374_10394370 3300013296 Bacteria 1380
149 Ga0157374_10939819 3300013296 Bacteria 883
150 Ga0157378_10006148 3300013297 Bacteria 10518
151 Ga0157378_10049108 3300013297 Bacteria 3753
152 Ga0157378_10088410 3300013297 Bacteria 2812
153 Ga0157378_10126255 3300013297 Bacteria 2363
154 Ga0163162_10000012 3300013306 Bacteria 292674
155 Ga0163162_10000064 3300013306 Bacteria 103542
156 Ga0163162_10045985 3300013306 Bacteria 4375
157 Ga0157372_10000021 3300013307 Bacteria 207801
158 Ga0157372_10000428 3300013307 Bacteria 46270
159 Ga0157372_10013237 3300013307 Bacteria 8805
160 Ga0157372_10148143 3300013307 Bacteria 2707
161 Ga0157372_10221212 3300013307 Bacteria 2195
162 Ga0157372_11577403 3300013307 Bacteria 756
163 Ga0157375_10006705 3300013308 Bacteria 10031
164 Ga0157375_10132747 3300013308 Bacteria 2611
165 Ga0157375_11058585 3300013308 Bacteria 948
166 Ga0157377_10031946 3300014745 Bacteria 2864
167 Ga0157377_10604563 3300014745 Bacteria 783
168 Ga0157376_10176159 3300014969 Bacteria 1951
169 Ga0163161_10000046 3300017792 Bacteria 127211
170 Ga0213872_10218640 3300021361 Bacteria 811
171 Ga0224712_10157962 3300022467 Bacteria 1009
172 Ga0207427_100171 3300025231 Bacteria 71988
173 Ga0209437_100024 3300025233 Bacteria 592878
174 Ga0209437_100052 3300025233 Bacteria 380548
175 Ga0209646_1000122 3300025246 Bacteria 144486
176 Ga0209026_1000631 3300025250 Bacteria 22097
177 Ga0209026_1001074 3300025250 Bacteria 13206
178 Ga0209026_1004283 3300025250 Bacteria 4308
179 Ga0209129_1008760 3300025258 Bacteria 2765
180 Ga0209233_1000067 3300025261 Bacteria 380554
181 Ga0209233_1017605 3300025261 Bacteria 1943
182 Ga0209758_1008810 3300025297 Bacteria 6426
183 Ga0207426_1000530 3300025302 Bacteria 55033
184 Ga0207642_10049288 3300025899 Bacteria 1893
185 Ga0207647_10001745 3300025904 Bacteria 16667
186 Ga0207647_10048827 3300025904 Bacteria 2627
187 Ga0207647_10346872 3300025904 Bacteria 841
188 Ga0207645_10000652 3300025907 Bacteria 28838
189 Ga0207645_10000689 3300025907 Bacteria 28055
190 Ga0207705_10000069 3300025909 Bacteria 133094
191 Ga0207705_10000090 3300025909 Bacteria 113233
192 Ga0207705_10222965 3300025909 Bacteria 1432
193 Ga0207654_10002503 3300025911 Bacteria 9337
194 Ga0207695_10005523 3300025913 Bacteria 16736
195 Ga0207695_10008620 3300025913 Bacteria 12740
196 Ga0207695_10057959 3300025913 Bacteria 4022
197 Ga0207695_10070621 3300025913 Bacteria 3569
198 Ga0207695_10103414 3300025913 Bacteria 2840
199 Ga0207695_10378568 3300025913 Bacteria 1301
200 Ga0207695_10426860 3300025913 Unclassified 1209
201 Ga0207695_10469605 3300025913 Bacteria 1141
202 Ga0207695_10858774 3300025913 Bacteria 787
203 Ga0207671_10000514 3300025914 Bacteria 52449
204 Ga0207671_10001726 3300025914 Bacteria 24605
205 Ga0207671_10005896 3300025914 Bacteria 11115
206 Ga0207671_10015797 3300025914 Bacteria 5892
207 Ga0207671_10016854 3300025914 Bacteria 5659
208 Ga0207671_10029911 3300025914 Bacteria 4064
209 Ga0207671_10030260 3300025914 Bacteria 4039
210 Ga0207671_10043295 3300025914 Bacteria 3329
211 Ga0207671_10459431 3300025914 Bacteria 1014
212 Ga0207671_10572392 3300025914 Bacteria 900
213 Ga0207657_10059476 3300025919 Bacteria 3283
214 Ga0207657_10194181 3300025919 Bacteria 1636
215 Ga0207649_10768412 3300025920 Bacteria 751
216 Ga0207652_10218800 3300025921 Bacteria 1716
217 Ga0207694_10044494 3300025924 Bacteria 3428
218 Ga0207694_10313937 3300025924 Bacteria 1293
219 Ga0207687_10957381 3300025927 Bacteria 733
220 Ga0207644_10000740 3300025931 Bacteria 20704
221 Ga0207644_10084522 3300025931 Bacteria 2352
222 Ga0207690_10000858 3300025932 Bacteria 19501
223 Ga0207690_10135939 3300025932 Bacteria 1805
224 Ga0207706_10000257 3300025933 Bacteria 57965
225 Ga0207686_10085649 3300025934 Unclassified 2068
226 Ga0207669_10788387 3300025937 Bacteria 787
227 Ga0207704_10000046 3300025938 Bacteria 86187
228 Ga0207704_10000124 3300025938 Bacteria 41992
229 Ga0207691_10125730 3300025940 Bacteria 2269
230 Ga0207661_10059886 3300025944 Bacteria 3070
231 Ga0207667_10000037 3300025949 Bacteria 297252
232 Ga0207667_10009468 3300025949 Bacteria 11471
233 Ga0207667_10013674 3300025949 Bacteria 9276
234 Ga0207667_10029747 3300025949 Bacteria 5918
235 Ga0207667_10037208 3300025949 Bacteria 5204
236 Ga0207667_10063923 3300025949 Bacteria 3844
237 Ga0207667_10105967 3300025949 Bacteria 2900
238 Ga0207667_10216246 3300025949 Bacteria 1964
239 Ga0207667_10336000 3300025949 Bacteria 1542
240 Ga0207667_11478407 3300025949 Bacteria 651
241 Ga0207651_10013857 3300025960 Bacteria 4632
242 Ga0207651_10669449 3300025960 Bacteria 912
243 Ga0207640_11125079 3300025981 Bacteria 696
244 Ga0207677_10093089 3300026023 Bacteria 2196
245 Ga0207703_10417559 3300026035 Bacteria 1248
246 Ga0207639_10007160 3300026041 Bacteria 7599
247 Ga0207639_10014135 3300026041 Bacteria 5605
248 Ga0207639_10040324 3300026041 Bacteria 3484
249 Ga0207639_10360390 3300026041 Bacteria 1301
250 Ga0207639_11029301 3300026041 Bacteria 771
251 Ga0207639_11299376 3300026041 Unclassified 683
252 Ga0207639_12098895 3300026041 Bacteria 526
253 Ga0207702_10001627 3300026078 Bacteria 22236
254 Ga0207702_10052628 3300026078 Unclassified 3446
255 Ga0207702_10501487 3300026078 Bacteria 1183
256 Ga0207648_10000257 3300026089 Bacteria 57438
257 Ga0207683_11028565 3300026121 Bacteria 765
258 Ga0207698_10016186 3300026142 Bacteria 5019
259 Ga0207698_10094490 3300026142 Bacteria 2458
260 Ga0207698_10377284 3300026142 Bacteria 1348
261 Ga0268266_10000078 3300028379 Bacteria 213632
262 Ga0268266_10000121 3300028379 Bacteria 154995
263 Ga0307517_10002529 3300028786 Bacteria 29143
264 Ga0307515_10000778 3300028794 Bacteria 73451
265 Ga0307515_10003029 3300028794 Bacteria 35637
266 Ga0265327_10228315 3300031251 Bacteria 835
267 Ga0265327_10265282 3300031251 Bacteria 762
268 Ga0307516_10323489 3300031730 Bacteria 1213
269 Ga0307416_100000001 3300032002 Bacteria 515017
270 Ga0307507_10002030 3300033179 Bacteria 43887
271 Ga0307510_10001211 3300033180 Bacteria 27977
272 Ga0307510_10006887 3300033180 Bacteria 13556
273 Ga0395899_0000001 3300037312 Bacteria 1750322
274 Ga0395899_0000534 3300037312 Bacteria 41504
275 Ga0395899_0008563 3300037312 Bacteria 7880
276 Ga0395899_0030071 3300037312 Bacteria 4087
277 Ga0395899_0080360 3300037312 Bacteria 2373
278 Ga0395900_0001900 3300037418 Bacteria 23785
279 Ga0395900_0010207 3300037418 Bacteria 9604
280 Ga0395900_0012659 3300037418 Bacteria 8624
281 Ga0395898_0034902 3300037466 Bacteria 5005
282 Ga0395898_0085793 3300037466 Bacteria 3035
283 Ga0395898_0113865 3300037466 Bacteria 2592
284 Ga0395905_0000347 3300037471 Bacteria 65943
285 Ga0395905_0000807 3300037471 Bacteria 41139
286 Ga0395905_0001935 3300037471 Bacteria 23767
287 Ga0395901_0004286 3300038443 Bacteria 14391
288 Ga0395901_0012756 3300038443 Bacteria 8524
289 Ga0395901_0014688 3300038443 Bacteria 7958
290 Ga0436361_0527238 3300039447 Bacteria 5128
291 Ga0451794_03868 3300041446 Bacteria 506
292 Ga0451791_0631650 3300041451 Bacteria 719
293 Ga0451807_0458474 3300041486 Bacteria 578
294 Ga0451807_1440092 3300041486 Bacteria 626
295 Ga0451845_0976831 3300041501 Bacteria 675
296 Ga0439448_0009718 3300042005 Bacteria 2840
297 Ga0439448_0040466 3300042005 Bacteria 1506
298 Ga0466966_0005500 3300044684 Bacteria 8322
299 Ga0466966_0050448 3300044684 Bacteria 2647
300 Ga0466959_0082070 3300045049 Bacteria 2323
301 Ga0495592_0175107 3300046454 Bacteria 1466
302 Ga0495638_0144358 3300046460 Bacteria 1386
303 Ga0495638_0194796 3300046460 Bacteria 1148
304 Ga0495650_0000023 3300046471 Bacteria 527763
305 Ga0495585_0000801 3300046492 Bacteria 27427
306 Ga0495585_0001092 3300046492 Bacteria 22350
307 Ga0495585_0002645 3300046492 Bacteria 12593
308 Ga0495583_0085099 3300046506 Bacteria 1369
309 Ga0495606_0000654 3300046507 Bacteria 54570
310 Ga0495606_0021048 3300046507 Bacteria 4786
311 Ga0495606_0024461 3300046507 Bacteria 4351
312 Ga0495606_0140490 3300046507 Unclassified 1427
313 Ga0495606_0292720 3300046507 Bacteria 885
314 Ga0495606_0550798 3300046507 Bacteria 574
315 Ga0495610_0002450 3300046512 Bacteria 15599
316 Ga0495610_0155525 3300046512 Bacteria 971
317 Ga0495616_0000975 3300046513 Bacteria 20508
318 Ga0495616_0005764 3300046513 Bacteria 7575
319 Ga0495616_0006078 3300046513 Bacteria 7357
320 Ga0495631_0008419 3300046518 Bacteria 5199
321 Ga0495631_0015907 3300046518 Bacteria 3595
322 Ga0495632_0094409 3300046519 Bacteria 1415
323 Ga0495637_0094597 3300046520 Bacteria 1174
324 Ga0495644_0006888 3300046523 Bacteria 4401
325 Ga0495648_0003373 3300046524 Bacteria 14063
326 Ga0495652_0029328 3300046529 Bacteria 4835
327 Ga0495587_0315603 3300046536 Bacteria 873
328 Ga0495609_0244700 3300046538 Bacteria 740
329 Ga0495622_0027492 3300046557 Bacteria 2655
330 Ga0495633_0000081 3300046558 Bacteria 125903
331 Ga0495668_0000003 3300046616 Bacteria 695023
332 Ga0495668_0267647 3300046616 Bacteria 936
333 Ga0495611_0155468 3300046648 Bacteria 1068
334 Ga0495625_0000003 3300046660 Bacteria 686847
335 Ga0495625_0000308 3300046660 Bacteria 74661
336 Ga0495625_0000846 3300046660 Bacteria 41815
337 Ga0495625_0007119 3300046660 Bacteria 9827
338 Ga0495625_0052665 3300046660 Bacteria 2913
339 Ga0495625_0095093 3300046660 Bacteria 2055
340 Ga0495661_0007257 3300046665 Bacteria 7727
341 Ga0495661_0011791 3300046665 Bacteria 5921
342 Ga0495661_0090970 3300046665 Bacteria 1736
343 Ga0495661_0134149 3300046665 Bacteria 1353
344 Ga0495599_0496517 3300046678 Bacteria 719
345 Ga0495669_0182631 3300046684 Bacteria 1000
346 Ga0495649_0000105 3300046694 Bacteria 74750
347 Ga0495649_0052972 3300046694 Bacteria 2198
348 Ga0495649_0159660 3300046694 Unclassified 1182
349 Ga0495589_0235803 3300046794 Bacteria 857
350 Ga0495683_0063052 3300047323 Bacteria 1832
351 Ga0495683_0182841 3300047323 Bacteria 956
352 Ga0495683_0193913 3300047323 Bacteria 920
353 Ga0495687_000304 3300047443 Bacteria 64746
354 Ga0495687_001036 3300047443 Bacteria 27592
355 Ga0495687_001602 3300047443 Bacteria 20428
356 Ga0495687_003533 3300047443 Bacteria 11252
357 Ga0495687_026477 3300047443 Bacteria 2729
358 Ga0495679_096763 3300047446 Bacteria 823
359 Ga0495686_0000367 3300047472 Bacteria 73112
360 Ga0495686_0003019 3300047472 Bacteria 14949
361 Ga0495686_0043771 3300047472 Bacteria 2837
362 Ga0495686_0234944 3300047472 Bacteria 1036
363 Ga0495686_0498500 3300047472 Bacteria 641
364 Ga0495614_0079342 3300048089 Bacteria 1421
365 Ga0496126_0732500 3300048929 Bacteria 765
366 Ga0495678_014896 3300049459 Bacteria 3601
367 Ga0501034_0372145 3300049571 Bacteria 1355
368 Ga0501037_0130154 3300049573 Bacteria 1805
369 Ga0501047_0058846 3300049581 Bacteria 3712
370 Ga0501044_0122979 3300049823 Bacteria 2594
371 nmdc:mga0k408_15328_c1 3300050493 Bacteria 4237
372 nmdc:mga0k408_175_c1 3300050493 Bacteria 32183
373 nmdc:mga0k408_28311_c1 3300050493 Bacteria 3185
374 nmdc:mga0k408_58301_c2 3300050493 Bacteria 1918
375 Ga0500635_0001938 3300053080 Bacteria 5050
376 Ga0500635_0003111 3300053080 Bacteria 4150
377 Ga0500635_0004872 3300053080 Bacteria 3484
378 Ga0500635_0072720 3300053080 Bacteria 1222
379 Ga0500646_0151007 3300053090 Bacteria 769
380 Ga0500650_0142770 3300053098 Bacteria 1110
381 Ga0500608_000329 3300053122 Bacteria 18275
382 Ga0500608_020757 3300053122 Bacteria 3025
383 Ga0500618_000004 3300053125 Bacteria 293180
384 Ga0500652_027537 3300053131 Bacteria 2199
385 Ga0500564_134933 3300053138 Bacteria 1065
386 Ga0500568_0022342 3300053139 Bacteria 2707
387 Ga0500616_0273092 3300053153 Bacteria 713
388 Ga0500622_0000864 3300053156 Bacteria 25792
389 Ga0500624_000533 3300053157 Bacteria 10784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0007119 Ga0495625_0007119_4696_5148 146
2 iso_pu_bacteria 2739367651 2739590207 147
3 3300025921 Ga0207652_10218800 Ga0207652_102188003 148
4 3300041446 Ga0451794_03868 Ga0451794_03868_26_490 148
5 3300032002 Ga0307416_100000001 Ga0307416_100000001123 149
6 3300003322 rootL2_10109183 rootL2_101091834 150
7 3300003323 rootH1_10295516 rootH1_102955162 150
8 3300053080 Ga0500635_0004872 Ga0500635_0004872_321_824 150
9 3300005327 Ga0070658_10000019 Ga0070658_1000001985 152
10 3300005339 Ga0070660_100290070 Ga0070660_1002900701 152
11 3300005530 Ga0070679_100107671 Ga0070679_1001076713 152
12 3300005539 Ga0068853_100310347 Ga0068853_1003103473 152
13 3300005563 Ga0068855_100246565 Ga0068855_1002465652 152
14 3300009093 Ga0105240_10249441 Ga0105240_102494413 152
15 3300009545 Ga0105237_10002246 Ga0105237_100022464 152
16 3300009545 Ga0105237_10726683 Ga0105237_107266832 152
17 3300010375 Ga0105239_10075730 Ga0105239_100757303 152
18 3300013104 Ga0157370_10386921 Ga0157370_103869212 152
19 3300013296 Ga0157374_10036041 Ga0157374_100360414 152
20 3300013296 Ga0157374_10394370 Ga0157374_103943703 152
21 3300013297 Ga0157378_10006148 Ga0157378_100061484 152
22 3300013307 Ga0157372_11577403 Ga0157372_115774032 152
23 3300013308 Ga0157375_11058585 Ga0157375_110585852 152
24 3300025909 Ga0207705_10000069 Ga0207705_1000006987 152
25 3300025913 Ga0207695_10378568 Ga0207695_103785683 152
26 3300025914 Ga0207671_10001726 Ga0207671_1000172619 152
27 3300025914 Ga0207671_10459431 Ga0207671_104594312 152
28 3300025919 Ga0207657_10194181 Ga0207657_101941812 152
29 3300025949 Ga0207667_10037208 Ga0207667_100372083 152
30 3300026041 Ga0207639_10360390 Ga0207639_103603903 152
31 3300026078 Ga0207702_10052628 Ga0207702_100526283 152
32 3300026142 Ga0207698_10377284 Ga0207698_103772841 152
33 3300031251 Ga0265327_10265282 Ga0265327_102652822 152
34 3300037312 Ga0395899_0080360 Ga0395899_0080360_1560_2024 152
35 3300037418 Ga0395900_0010207 Ga0395900_0010207_724_1188 152
36 3300037466 Ga0395898_0085793 Ga0395898_0085793_243_707 152
37 3300037471 Ga0395905_0000807 Ga0395905_0000807_12537_13001 152
38 3300038443 Ga0395901_0004286 Ga0395901_0004286_7485_7949 152
39 3300046557 Ga0495622_0027492 Ga0495622_0027492_691_1161 152
40 iso_pu_bacteria 2919437846 2919441649 152
41 3300005355 Ga0070671_100014867 Ga0070671_1000148674 153
42 3300025931 Ga0207644_10000740 Ga0207644_1000074015 153
43 iso_pu_bacteria 2599185184 2599478518 153
44 iso_pu_bacteria 2852623160 2852623441 153
45 iso_pu_bacteria 2884933994 2884937680 153
46 iso_pu_bacteria 2928147474 2928149398 153
47 3300003316 rootH1_10061015 rootH1_100610153 154
48 3300005339 Ga0070660_100812259 Ga0070660_1008122592 154
49 3300009093 Ga0105240_10267936 Ga0105240_102679363 154
50 3300009545 Ga0105237_10026966 Ga0105237_100269663 154
51 3300010375 Ga0105239_10727843 Ga0105239_107278431 154
52 3300025250 Ga0209026_1004283 Ga0209026_10042833 154
53 3300025913 Ga0207695_10858774 Ga0207695_108587742 154
54 3300025914 Ga0207671_10043295 Ga0207671_100432955 154
55 iso_pu_bacteria 2599185184 2599479439 154
56 iso_pu_bacteria 2739367651 2739589445 154
57 iso_pu_bacteria 2842722452 2842723032 154
58 iso_pu_bacteria 2842909656 2842913988 154
59 iso_pu_bacteria 2849281842 2849283729 154
60 iso_pu_bacteria 2857627736 2857628151 154
61 iso_pu_bacteria 2928078545 2928082255 154
62 iso_pu_bacteria 2928147474 2928149168 154
63 iso_pu_bacteria 2932082852 2932084970 154
64 3300003320 rootH2_10004415 rootH2_1000441523 155
65 3300003322 rootL2_10310450 rootL2_103104502 155
66 3300005327 Ga0070658_10302097 Ga0070658_103020972 155
67 3300005364 Ga0070673_100010060 Ga0070673_1000100602 155
68 3300005459 Ga0068867_100000116 Ga0068867_1000001165 155
69 3300005539 Ga0068853_100476372 Ga0068853_1004763722 155
70 3300005548 Ga0070665_100000003 Ga0070665_100000003347 155
71 3300005616 Ga0068852_100022204 Ga0068852_1000222044 155
72 3300005718 Ga0068866_10158306 Ga0068866_101583062 155
73 3300006237 Ga0097621_100000054 Ga0097621_10000005424 155
74 3300006358 Ga0068871_100000145 Ga0068871_10000014524 155
75 3300006881 Ga0068865_100000051 Ga0068865_10000005132 155
76 3300009098 Ga0105245_10182148 Ga0105245_101821482 155
77 3300009174 Ga0105241_10002488 Ga0105241_100024889 155
78 3300009545 Ga0105237_10001447 Ga0105237_1000144720 155
79 3300009551 Ga0105238_10096637 Ga0105238_100966373 155
80 3300013104 Ga0157370_10223259 Ga0157370_102232592 155
81 3300013296 Ga0157374_10078775 Ga0157374_100787753 155
82 3300013297 Ga0157378_10049108 Ga0157378_100491082 155
83 3300013297 Ga0157378_10126255 Ga0157378_101262552 155
84 3300013306 Ga0163162_10000064 Ga0163162_100000646 155
85 3300013307 Ga0157372_10221212 Ga0157372_102212123 155
86 3300013308 Ga0157375_10006705 Ga0157375_100067057 155
87 3300013308 Ga0157375_10132747 Ga0157375_101327472 155
88 3300014745 Ga0157377_10604563 Ga0157377_106045632 155
89 3300025899 Ga0207642_10049288 Ga0207642_100492883 155
90 3300025907 Ga0207645_10000652 Ga0207645_1000065216 155
91 3300025909 Ga0207705_10222965 Ga0207705_102229652 155
92 3300025913 Ga0207695_10005523 Ga0207695_100055232 155
93 3300025914 Ga0207671_10015797 Ga0207671_100157973 155
94 3300025924 Ga0207694_10313937 Ga0207694_103139373 155
95 3300025927 Ga0207687_10957381 Ga0207687_109573812 155
96 3300025931 Ga0207644_10084522 Ga0207644_100845221 155
97 3300025938 Ga0207704_10000046 Ga0207704_1000004631 155
98 3300025940 Ga0207691_10125730 Ga0207691_101257303 155
99 3300025949 Ga0207667_10009468 Ga0207667_100094689 155
100 3300026023 Ga0207677_10093089 Ga0207677_100930893 155
101 3300026041 Ga0207639_10040324 Ga0207639_100403243 155
102 3300026089 Ga0207648_10000257 Ga0207648_1000025745 155
103 3300026142 Ga0207698_10016186 Ga0207698_100161863 155
104 3300028379 Ga0268266_10000078 Ga0268266_10000078137 155
105 3300028794 Ga0307515_10000778 Ga0307515_1000077830 155
106 3300028794 Ga0307515_10003029 Ga0307515_1000302916 155
107 3300031730 Ga0307516_10323489 Ga0307516_103234892 155
108 3300033180 Ga0307510_10001211 Ga0307510_1000121118 155
109 3300041451 Ga0451791_0631650 Ga0451791_0631650_32_505 155
110 3300042005 Ga0439448_0009718 Ga0439448_0009718_1025_1498 155
111 3300046507 Ga0495606_0550798 Ga0495606_0550798_22_495 155
112 3300046518 Ga0495631_0015907 Ga0495631_0015907_2743_3216 155
113 3300046523 Ga0495644_0006888 Ga0495644_0006888_2180_2653 155
114 3300046558 Ga0495633_0000081 Ga0495633_0000081_112939_113412 155
115 3300046616 Ga0495668_0267647 Ga0495668_0267647_115_588 155
116 3300046660 Ga0495625_0000846 Ga0495625_0000846_25304_25777 155
117 3300046665 Ga0495661_0090970 Ga0495661_0090970_186_659 155
118 3300046684 Ga0495669_0182631 Ga0495669_0182631_153_626 155
119 3300046694 Ga0495649_0052972 Ga0495649_0052972_872_1345 155
120 3300047323 Ga0495683_0063052 Ga0495683_0063052_408_881 155
121 3300047443 Ga0495687_001036 Ga0495687_001036_893_1366 155
122 3300050493 nmdc:mga0k408_175_c1 nmdc:mga0k408_175_c1_23991_24464 155
123 3300053080 Ga0500635_0001938 Ga0500635_0001938_3160_3633 155
124 3300053122 Ga0500608_000329 Ga0500608_000329_4965_5438 155
125 3300053122 Ga0500608_020757 Ga0500608_020757_1367_1840 155
126 3300053125 Ga0500618_000004 Ga0500618_000004_21771_22244 155
127 3300002737 JGI25162J39368_1000022 JGI25162J39368_1000022205 156
128 3300003323 rootH1_10083018 rootH1_100830187 156
129 3300003323 rootH1_10106222 rootH1_101062222 156
130 3300005288 Ga0065714_10078008 Ga0065714_100780082 156
131 3300005578 Ga0068854_100452075 Ga0068854_1004520752 156
132 3300009093 Ga0105240_10155147 Ga0105240_101551473 156
133 3300009093 Ga0105240_10219528 Ga0105240_102195283 156
134 3300009093 Ga0105240_11759600 Ga0105240_117596002 156
135 3300009545 Ga0105237_10255784 Ga0105237_102557842 156
136 3300009545 Ga0105237_10359144 Ga0105237_103591442 156
137 3300010375 Ga0105239_10000002 Ga0105239_10000002451 156
138 3300010375 Ga0105239_10000440 Ga0105239_100004402 156
139 3300010375 Ga0105239_10001688 Ga0105239_100016882 156
140 3300017792 Ga0163161_10000046 Ga0163161_1000004652 156
141 3300025233 Ga0209437_100024 Ga0209437_100024519 156
142 3300025258 Ga0209129_1008760 Ga0209129_10087602 156
143 3300025914 Ga0207671_10016854 Ga0207671_100168543 156
144 3300025914 Ga0207671_10030260 Ga0207671_100302602 156
145 3300025949 Ga0207667_10105967 Ga0207667_101059673 156
146 3300041486 Ga0451807_0458474 Ga0451807_0458474_32_508 156
147 3300041486 Ga0451807_1440092 Ga0451807_1440092_82_558 156
148 3300046507 Ga0495606_0021048 Ga0495606_0021048_672_1151 156
149 3300046507 Ga0495606_0024461 Ga0495606_0024461_1583_2059 156
150 3300046507 Ga0495606_0292720 Ga0495606_0292720_292_768 156
151 3300046513 Ga0495616_0005764 Ga0495616_0005764_1726_2202 156
152 3300046648 Ga0495611_0155468 Ga0495611_0155468_356_832 156
153 3300046660 Ga0495625_0095093 Ga0495625_0095093_1105_1581 156
154 3300047443 Ga0495687_026477 Ga0495687_026477_1371_1847 156
155 3300047472 Ga0495686_0000367 Ga0495686_0000367_32302_32778 156
156 3300047472 Ga0495686_0003019 Ga0495686_0003019_2291_2767 156
157 3300047472 Ga0495686_0234944 Ga0495686_0234944_368_844 156
158 3300049459 Ga0495678_014896 Ga0495678_014896_2345_2821 156
159 3300053080 Ga0500635_0072720 Ga0500635_0072720_695_1171 156
160 3300053138 Ga0500564_134933 Ga0500564_134933_483_959 156
161 3300053153 Ga0500616_0273092 Ga0500616_0273092_86_562 156
162 3300001979 JGI24740J21852_10011146 JGI24740J21852_100111465 157
163 3300002772 JGI25164J39214_1001399 JGI25164J39214_10013995 157
164 3300003214 JGI25165J46597_1001179 JGI25165J46597_10011797 157
165 3300003316 rootH1_10038740 rootH1_100387403 157
166 3300003320 rootH2_10096525 rootH2_100965253 157
167 3300003323 rootH1_10006785 rootH1_1000678517 157
168 3300003323 rootH1_10028473 rootH1_100284734 157
169 3300003323 rootH1_10256739 rootH1_102567393 157
170 3300005539 Ga0068853_100317367 Ga0068853_1003173671 157
171 3300005563 Ga0068855_100000519 Ga0068855_10000051928 157
172 3300005563 Ga0068855_100004987 Ga0068855_10000498719 157
173 3300005563 Ga0068855_100865230 Ga0068855_1008652302 157
174 3300005614 Ga0068856_100286632 Ga0068856_1002866322 157
175 3300005614 Ga0068856_100508535 Ga0068856_1005085353 157
176 3300005616 Ga0068852_100221709 Ga0068852_1002217092 157
177 3300005834 Ga0068851_10511185 Ga0068851_105111851 157
178 3300006195 Ga0075366_10000849 Ga0075366_100008496 157
179 3300006195 Ga0075366_10156095 Ga0075366_101560952 157
180 3300009093 Ga0105240_10109758 Ga0105240_101097582 157
181 3300009093 Ga0105240_10222857 Ga0105240_102228572 157
182 3300009093 Ga0105240_10908367 Ga0105240_109083672 157
183 3300009174 Ga0105241_10642219 Ga0105241_106422192 157
184 3300009545 Ga0105237_10026057 Ga0105237_100260574 157
185 3300009551 Ga0105238_10183082 Ga0105238_101830822 157
186 3300009551 Ga0105238_11102221 Ga0105238_111022212 157
187 3300013105 Ga0157369_10003273 Ga0157369_100032734 157
188 3300013306 Ga0163162_10045985 Ga0163162_100459852 157
189 3300013307 Ga0157372_10000021 Ga0157372_1000002169 157
190 3300022467 Ga0224712_10157962 Ga0224712_101579621 157
191 3300025231 Ga0207427_100171 Ga0207427_10017123 157
192 3300025233 Ga0209437_100052 Ga0209437_10005282 157
193 3300025261 Ga0209233_1000067 Ga0209233_100006782 157
194 3300025904 Ga0207647_10048827 Ga0207647_100488273 157
195 3300025913 Ga0207695_10070621 Ga0207695_100706213 157
196 3300025913 Ga0207695_10103414 Ga0207695_101034141 157
197 3300025913 Ga0207695_10426860 Ga0207695_104268602 157
198 3300025914 Ga0207671_10029911 Ga0207671_100299113 157
199 3300025937 Ga0207669_10788387 Ga0207669_107883872 157
200 3300025949 Ga0207667_10000037 Ga0207667_1000003741 157
201 3300025949 Ga0207667_10013674 Ga0207667_100136749 157
202 3300025949 Ga0207667_10336000 Ga0207667_103360003 157
203 3300025949 Ga0207667_11478407 Ga0207667_114784072 157
204 3300025981 Ga0207640_11125079 Ga0207640_111250791 157
205 3300026035 Ga0207703_10417559 Ga0207703_104175593 157
206 3300026041 Ga0207639_11029301 Ga0207639_110293011 157
207 3300026041 Ga0207639_12098895 Ga0207639_120988951 157
208 3300026078 Ga0207702_10501487 Ga0207702_105014872 157
209 3300037312 Ga0395899_0008563 Ga0395899_0008563_808_1293 157
210 3300044684 Ga0466966_0005500 Ga0466966_0005500_6559_7044 157
211 3300045049 Ga0466959_0082070 Ga0466959_0082070_1585_2070 157
212 3300046454 Ga0495592_0175107 Ga0495592_0175107_525_1013 157
213 3300046460 Ga0495638_0144358 Ga0495638_0144358_455_934 157
214 3300046492 Ga0495585_0001092 Ga0495585_0001092_96_575 157
215 3300046492 Ga0495585_0002645 Ga0495585_0002645_7286_7771 157
216 3300046513 Ga0495616_0006078 Ga0495616_0006078_5389_5868 157
217 3300046524 Ga0495648_0003373 Ga0495648_0003373_10402_10887 157
218 3300046529 Ga0495652_0029328 Ga0495652_0029328_1240_1728 157
219 3300046538 Ga0495609_0244700 Ga0495609_0244700_124_609 157
220 3300046616 Ga0495668_0000003 Ga0495668_0000003_671487_671972 157
221 3300046660 Ga0495625_0000003 Ga0495625_0000003_124279_124758 157
222 3300046660 Ga0495625_0052665 Ga0495625_0052665_402_887 157
223 3300046665 Ga0495661_0007257 Ga0495661_0007257_406_894 157
224 3300046794 Ga0495589_0235803 Ga0495589_0235803_46_525 157
225 3300047443 Ga0495687_001602 Ga0495687_001602_6603_7082 157
226 3300047472 Ga0495686_0043771 Ga0495686_0043771_330_809 157
227 3300048089 Ga0495614_0079342 Ga0495614_0079342_197_682 157
228 3300050493 nmdc:mga0k408_28311_c1 nmdc:mga0k408_28311_c1_473_952 157
229 3300053090 Ga0500646_0151007 Ga0500646_0151007_43_528 157
230 3300053156 Ga0500622_0000864 Ga0500622_0000864_11550_12035 157
231 3300001989 JGI24739J22299_10012706 JGI24739J22299_100127065 158
232 3300001990 JGI24737J22298_10015167 JGI24737J22298_100151672 158
233 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003292 158
234 3300002077 JGI24744J21845_10011597 JGI24744J21845_100115971 158
235 3300003316 rootH1_10043582 rootH1_1004358224 158
236 3300003320 rootH2_10057092 rootH2_100570923 158
237 3300003320 rootH2_10250623 rootH2_102506232 158
238 3300005328 Ga0070676_10001139 Ga0070676_1000113916 158
239 3300005329 Ga0070683_100082764 Ga0070683_1000827643 158
240 3300005339 Ga0070660_100076030 Ga0070660_1000760302 158
241 3300005364 Ga0070673_100022160 Ga0070673_1000221605 158
242 3300005364 Ga0070673_100745816 Ga0070673_1007458161 158
243 3300005366 Ga0070659_100000516 Ga0070659_10000051616 158
244 3300005366 Ga0070659_100052720 Ga0070659_1000527202 158
245 3300005366 Ga0070659_100184461 Ga0070659_1001844613 158
246 3300005457 Ga0070662_100000167 Ga0070662_10000016730 158
247 3300005539 Ga0068853_100029566 Ga0068853_1000295662 158
248 3300005539 Ga0068853_100061885 Ga0068853_1000618852 158
249 3300005543 Ga0070672_100044786 Ga0070672_1000447864 158
250 3300005548 Ga0070665_100000118 Ga0070665_1000001182 158
251 3300005563 Ga0068855_100036541 Ga0068855_1000365412 158
252 3300005614 Ga0068856_101080656 Ga0068856_1010806561 158
253 3300005616 Ga0068852_100027413 Ga0068852_1000274136 158
254 3300005842 Ga0068858_100493617 Ga0068858_1004936171 158
255 3300006195 Ga0075366_10033461 Ga0075366_100334612 158
256 3300006237 Ga0097621_100000365 Ga0097621_10000036525 158
257 3300006358 Ga0068871_100000248 Ga0068871_1000002487 158
258 3300006881 Ga0068865_100000211 Ga0068865_1000002114 158
259 3300009093 Ga0105240_10010766 Ga0105240_100107669 158
260 3300009174 Ga0105241_10004950 Ga0105241_100049507 158
261 3300009545 Ga0105237_10994846 Ga0105237_109948462 158
262 3300010375 Ga0105239_10013721 Ga0105239_100137217 158
263 3300011119 Ga0105246_10104735 Ga0105246_101047352 158
264 3300013100 Ga0157373_10000273 Ga0157373_1000027310 158
265 3300013102 Ga0157371_10042240 Ga0157371_100422404 158
266 3300013102 Ga0157371_10142645 Ga0157371_101426452 158
267 3300013104 Ga0157370_10664814 Ga0157370_106648142 158
268 3300013105 Ga0157369_10368658 Ga0157369_103686581 158
269 3300013296 Ga0157374_10010923 Ga0157374_100109237 158
270 3300013296 Ga0157374_10939819 Ga0157374_109398192 158
271 3300013307 Ga0157372_10000428 Ga0157372_1000042812 158
272 3300013307 Ga0157372_10013237 Ga0157372_100132375 158
273 3300013307 Ga0157372_10148143 Ga0157372_101481432 158
274 3300014745 Ga0157377_10031946 Ga0157377_100319461 158
275 3300025261 Ga0209233_1017605 Ga0209233_10176053 158
276 3300025904 Ga0207647_10001745 Ga0207647_100017456 158
277 3300025907 Ga0207645_10000689 Ga0207645_100006899 158
278 3300025911 Ga0207654_10002503 Ga0207654_100025033 158
279 3300025913 Ga0207695_10057959 Ga0207695_100579594 158
280 3300025914 Ga0207671_10005896 Ga0207671_100058967 158
281 3300025919 Ga0207657_10059476 Ga0207657_100594763 158
282 3300025924 Ga0207694_10044494 Ga0207694_100444946 158
283 3300025932 Ga0207690_10000858 Ga0207690_1000085816 158
284 3300025932 Ga0207690_10135939 Ga0207690_101359391 158
285 3300025933 Ga0207706_10000257 Ga0207706_1000025710 158
286 3300025934 Ga0207686_10085649 Ga0207686_100856492 158
287 3300025938 Ga0207704_10000124 Ga0207704_100001248 158
288 3300025944 Ga0207661_10059886 Ga0207661_100598863 158
289 3300025949 Ga0207667_10063923 Ga0207667_100639235 158
290 3300025960 Ga0207651_10013857 Ga0207651_100138572 158
291 3300025960 Ga0207651_10669449 Ga0207651_106694491 158
292 3300026041 Ga0207639_10007160 Ga0207639_100071606 158
293 3300026041 Ga0207639_10014135 Ga0207639_100141352 158
294 3300026121 Ga0207683_11028565 Ga0207683_110285651 158
295 3300026142 Ga0207698_10094490 Ga0207698_100944901 158
296 3300028379 Ga0268266_10000121 Ga0268266_10000121154 158
297 3300033179 Ga0307507_10002030 Ga0307507_1000203012 158
298 3300033180 Ga0307510_10006887 Ga0307510_100068873 158
299 3300037312 Ga0395899_0000001 Ga0395899_0000001_1471588_1472067 158
300 3300041501 Ga0451845_0976831 Ga0451845_0976831_145_639 158
301 3300044684 Ga0466966_0050448 Ga0466966_0050448_1496_1975 158
302 3300046460 Ga0495638_0194796 Ga0495638_0194796_108_602 158
303 3300046471 Ga0495650_0000023 Ga0495650_0000023_4019_4513 158
304 3300046492 Ga0495585_0000801 Ga0495585_0000801_3553_4047 158
305 3300046506 Ga0495583_0085099 Ga0495583_0085099_202_696 158
306 3300046507 Ga0495606_0000654 Ga0495606_0000654_5323_5817 158
307 3300046512 Ga0495610_0002450 Ga0495610_0002450_4739_5233 158
308 3300046512 Ga0495610_0155525 Ga0495610_0155525_79_573 158
309 3300046513 Ga0495616_0000975 Ga0495616_0000975_18032_18526 158
310 3300046519 Ga0495632_0094409 Ga0495632_0094409_497_991 158
311 3300046520 Ga0495637_0094597 Ga0495637_0094597_21_515 158
312 3300046660 Ga0495625_0000308 Ga0495625_0000308_70467_70961 158
313 3300046665 Ga0495661_0011791 Ga0495661_0011791_3955_4449 158
314 3300046665 Ga0495661_0134149 Ga0495661_0134149_545_1039 158
315 3300046678 Ga0495599_0496517 Ga0495599_0496517_100_594 158
316 3300046694 Ga0495649_0000105 Ga0495649_0000105_3591_4085 158
317 3300047323 Ga0495683_0193913 Ga0495683_0193913_206_700 158
318 3300047443 Ga0495687_000304 Ga0495687_000304_61475_61969 158
319 3300047446 Ga0495679_096763 Ga0495679_096763_179_673 158
320 3300047472 Ga0495686_0498500 Ga0495686_0498500_32_526 158
321 3300048929 Ga0496126_0732500 Ga0496126_0732500_188_694 158
322 3300050493 nmdc:mga0k408_15328_c1 nmdc:mga0k408_15328_c1_1047_1544 158
323 3300050493 nmdc:mga0k408_58301_c2 nmdc:mga0k408_58301_c2_392_886 158
324 3300053157 Ga0500624_000533 Ga0500624_000533_9663_10163 158
325 iso_pu_bacteria 2929921140 2929925310 158
326 iso_pu_bacteria 8003151029 8003154197 158
327 3300002741 JGI25157J39369_1005103 JGI25157J39369_10051033 160
328 3300003316 rootH1_10126176 rootH1_101261764 160
329 3300003316 rootH1_10193810 rootH1_101938102 160
330 3300003320 rootH2_10003269 rootH2_1000326952 160
331 3300005344 Ga0070661_100586282 Ga0070661_1005862821 160
332 3300005563 Ga0068855_100104634 Ga0068855_1001046342 160
333 3300005563 Ga0068855_100147695 Ga0068855_1001476953 160
334 3300005563 Ga0068855_100247567 Ga0068855_1002475672 160
335 3300005563 Ga0068855_100433366 Ga0068855_1004333663 160
336 3300009093 Ga0105240_10002706 Ga0105240_1000270611 160
337 3300009093 Ga0105240_10544904 Ga0105240_105449042 160
338 3300009093 Ga0105240_10652558 Ga0105240_106525581 160
339 3300009174 Ga0105241_10018205 Ga0105241_100182056 160
340 3300009176 Ga0105242_10081974 Ga0105242_100819742 160
341 3300009545 Ga0105237_10001687 Ga0105237_1000168725 160
342 3300009545 Ga0105237_10002107 Ga0105237_100021078 160
343 3300009545 Ga0105237_10523327 Ga0105237_105233271 160
344 3300010375 Ga0105239_10067347 Ga0105239_100673473 160
345 3300010375 Ga0105239_10133585 Ga0105239_101335853 160
346 3300013296 Ga0157374_10014928 Ga0157374_100149286 160
347 3300013296 Ga0157374_10027886 Ga0157374_100278865 160
348 3300013296 Ga0157374_10238055 Ga0157374_102380552 160
349 3300013297 Ga0157378_10088410 Ga0157378_100884102 160
350 3300013306 Ga0163162_10000012 Ga0163162_1000001212 160
351 3300014969 Ga0157376_10176159 Ga0157376_101761592 160
352 3300021361 Ga0213872_10218640 Ga0213872_102186401 160
353 3300025250 Ga0209026_1001074 Ga0209026_100107411 160
354 3300025904 Ga0207647_10346872 Ga0207647_103468722 160
355 3300025909 Ga0207705_10000090 Ga0207705_1000009042 160
356 3300025913 Ga0207695_10008620 Ga0207695_100086201 160
357 3300025913 Ga0207695_10469605 Ga0207695_104696052 160
358 3300025914 Ga0207671_10000514 Ga0207671_1000051425 160
359 3300025914 Ga0207671_10572392 Ga0207671_105723921 160
360 3300025920 Ga0207649_10768412 Ga0207649_107684121 160
361 3300025949 Ga0207667_10029747 Ga0207667_100297472 160
362 3300025949 Ga0207667_10216246 Ga0207667_102162462 160
363 3300026041 Ga0207639_11299376 Ga0207639_112993761 160
364 3300026078 Ga0207702_10001627 Ga0207702_1000162720 160
365 3300028786 Ga0307517_10002529 Ga0307517_1000252912 160
366 3300031251 Ga0265327_10228315 Ga0265327_102283151 160
367 3300037312 Ga0395899_0000534 Ga0395899_0000534_15048_15560 160
368 3300037312 Ga0395899_0030071 Ga0395899_0030071_1494_2012 160
369 3300037418 Ga0395900_0001900 Ga0395900_0001900_12089_12601 160
370 3300037418 Ga0395900_0012659 Ga0395900_0012659_4346_4864 160
371 3300037466 Ga0395898_0034902 Ga0395898_0034902_4424_4936 160
372 3300037466 Ga0395898_0113865 Ga0395898_0113865_1361_1879 160
373 3300037471 Ga0395905_0000347 Ga0395905_0000347_35205_35723 160
374 3300037471 Ga0395905_0001935 Ga0395905_0001935_11774_12286 160
375 3300038443 Ga0395901_0012756 Ga0395901_0012756_2925_3443 160
376 3300038443 Ga0395901_0014688 Ga0395901_0014688_608_1120 160
377 3300039447 Ga0436361_0527238 Ga0436361_0527238_179_691 160
378 3300042005 Ga0439448_0040466 Ga0439448_0040466_757_1269 160
379 3300046507 Ga0495606_0140490 Ga0495606_0140490_461_973 160
380 3300046518 Ga0495631_0008419 Ga0495631_0008419_924_1436 160
381 3300046536 Ga0495587_0315603 Ga0495587_0315603_103_615 160
382 3300046694 Ga0495649_0159660 Ga0495649_0159660_194_706 160
383 3300047323 Ga0495683_0182841 Ga0495683_0182841_276_788 160
384 3300047443 Ga0495687_003533 Ga0495687_003533_3388_3900 160
385 3300053080 Ga0500635_0003111 Ga0500635_0003111_2999_3511 160
386 3300053098 Ga0500650_0142770 Ga0500650_0142770_441_953 160
387 3300001979 JGI24740J21852_10006519 JGI24740J21852_100065196 162
388 3300002738 JGI25154J39366_1000041 JGI25154J39366_100004116 162
389 3300002741 JGI25157J39369_1009319 JGI25157J39369_10093192 162
390 3300003215 JGI25153J46596_10007527 JGI25153J46596_100075276 162
391 3300003320 rootH2_10002077 rootH2_100020774 162
392 3300003320 rootH2_10073845 rootH2_100738455 162
393 3300003354 JGI25160J50197_1023926 JGI25160J50197_10239262 162
394 3300005262 Ga0065165_1036539 Ga0065165_10365392 162
395 3300010375 Ga0105239_10655837 Ga0105239_106558372 162
396 3300025246 Ga0209646_1000122 Ga0209646_100012217 162
397 3300025250 Ga0209026_1000631 Ga0209026_100063113 162
398 3300025297 Ga0209758_1008810 Ga0209758_10088103 162
399 3300025302 Ga0207426_1000530 Ga0207426_100053029 162
400 3300049571 Ga0501034_0372145 Ga0501034_0372145_354_848 162
401 3300049573 Ga0501037_0130154 Ga0501037_0130154_674_1168 162
402 3300049581 Ga0501047_0058846 Ga0501047_0058846_2860_3354 162
403 3300049823 Ga0501044_0122979 Ga0501044_0122979_1186_1680 162
404 3300053131 Ga0500652_027537 Ga0500652_027537_183_671 162
405 3300053139 Ga0500568_0022342 Ga0500568_0022342_201_689 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

37

156

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cxk-assembly1.cif.gz_A 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. 0.9483 38 160
3hch-assembly1.cif.gz_A structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.947 33 158
7cto-assembly6.cif.gz_F staphylococcus aureus msrb 0.9452 41 158
3hch-assembly2.cif.gz_B structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.9436 34 158
7cto-assembly1.cif.gz_A staphylococcus aureus msrb 0.9425 41 158
ID Description Score Start End Superfamily
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9358 30 160 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9349 34 159 2.170.150.20
3e0oC00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9275 35 158 2.170.150.20
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9272 27 159 2.170.150.20
af_P25566_29_168_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9245 44 159 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A2T4X0N1-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9848 30 158 GO:0008113
GO:0033743
GO:0033744
GO:0036211
AF-A0A497YR04-F1-model_v4 deleted 0.9847 25 160
AF-A0A1G7VLF4-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.9789 22 160 GO:0005737
GO:0006979
GO:0030091
GO:0033743
AF-A0A350NWS3-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9779 40 159 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A7V8E792-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9762 37 162 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743

Feature Viewer

pLDDT pTM Quality
89.12 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map