F435989

General Info

Members Datasets Scaffolds Average Seq Length
405 202 810 299

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0052339|Ga0373944_0052339_87_1040
Length 317
Sequence VTHLKGVEVIRKHTRRAAKAAFAISLGVAIVIGLLAAAFARPAQSAGTTVVLGTKNFGEEYILGQLYGQALKAKGFHVAFKGSFGSSELADVAIRHGKMNFYPEYTGVIALDLAKVSTAPKTAVATYNVAQKYEQKHHLTLLKPTPFYDSDTFTMLTKTANQLGVKTIADMKGKAFSYAALPECDQRITCILGFEQIYRLTNITFVPLASISVYTLLDEGKTTAGDGYSTDPQQLQHSKYTALKDTKHIFGFQNVAPVVSQKLLKGTSGKLLASICNKVSSKLTLAAMQAMNKAYVVNKLTPKQIAHAFLKANHLLG

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
53 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 5.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.62
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0052339 3300035089 Bacteria 1290
2 Ga0058862_10005221 3300004803 Bacteria 1379
3 Ga0070658_10002021 3300005327 Bacteria 17019
4 Ga0070658_10031798 3300005327 Bacteria 4239
5 Ga0070658_10218730 3300005327 Bacteria 1610
6 Ga0070683_100007102 3300005329 Bacteria 9437
7 Ga0070683_100007974 3300005329 Bacteria 8984
8 Ga0070683_100141768 3300005329 Bacteria 2277
9 Ga0070683_100173599 3300005329 Unclassified 2046
10 Ga0070680_100090220 3300005336 Bacteria 2537
11 Ga0070680_100101953 3300005336 Bacteria 2383
12 Ga0070680_100218854 3300005336 Bacteria 1607
13 Ga0070682_100038912 3300005337 Bacteria 2919
14 Ga0070660_100017755 3300005339 Bacteria 5189
15 Ga0070660_100018972 3300005339 Bacteria 5035
16 Ga0070660_100023791 3300005339 Bacteria 4540
17 Ga0070660_100047760 3300005339 Bacteria 3285
18 Ga0070660_100125123 3300005339 Bacteria 2054
19 Ga0070691_10030850 3300005341 Bacteria 2511
20 Ga0070661_100047245 3300005344 Bacteria 3150
21 Ga0070659_100071339 3300005366 Bacteria 2761
22 Ga0070709_10015512 3300005434 Bacteria 4337
23 Ga0070714_100008167 3300005435 Bacteria 8159
24 Ga0070714_100008590 3300005435 Bacteria 7992
25 Ga0070714_100050634 3300005435 Bacteria 3539
26 Ga0070714_100074280 3300005435 Bacteria 2947
27 Ga0070714_100075404 3300005435 Bacteria 2926
28 Ga0070714_100084228 3300005435 Bacteria 2774
29 Ga0070714_100099534 3300005435 Bacteria 2559
30 Ga0070714_100157112 3300005435 Bacteria 2054
31 Ga0070714_100319928 3300005435 Bacteria 1451
32 Ga0070713_100061200 3300005436 Bacteria 3149
33 Ga0070713_100077959 3300005436 Bacteria 2819
34 Ga0070710_10006781 3300005437 Bacteria 5521
35 Ga0070711_100055485 3300005439 Bacteria 2737
36 Ga0070711_100432912 3300005439 Unclassified 1074
37 Ga0070681_10053500 3300005458 Bacteria 4024
38 Ga0070681_10085899 3300005458 Archaea 3099
39 Ga0070681_10196382 3300005458 Bacteria 1937
40 Ga0070698_100035438 3300005471 Bacteria 5161
41 Ga0070698_100052577 3300005471 Bacteria 4143
42 Ga0070699_100124245 3300005518 Bacteria 2271
43 Ga0070679_100057447 3300005530 Bacteria 3878
44 Ga0070679_100134867 3300005530 Bacteria 2450
45 Ga0070679_100205563 3300005530 Bacteria 1934
46 Ga0070684_100024995 3300005535 Bacteria 5016
47 Ga0070684_100037508 3300005535 Bacteria 4158
48 Ga0070684_100120677 3300005535 Archaea 2358
49 Ga0070684_100269273 3300005535 Bacteria 1559
50 Ga0070695_100000662 3300005545 Bacteria 18372
51 Ga0070693_100091589 3300005547 Bacteria 1834
52 Ga0070704_100025097 3300005549 Bacteria 3920
53 Ga0068855_100028525 3300005563 Bacteria 6676
54 Ga0068855_100234380 3300005563 Bacteria 2053
55 Ga0068856_100243958 3300005614 Bacteria 1812
56 Ga0068852_100092485 3300005616 Bacteria 2709
57 Ga0070717_10001661 3300006028 Bacteria 15459
58 Ga0070717_10007565 3300006028 Bacteria 8071
59 Ga0070717_10015274 3300006028 Bacteria 5927
60 Ga0070715_10001940 3300006163 Bacteria 6224
61 Ga0070716_100015868 3300006173 Bacteria 3880
62 Ga0075433_10418585 3300006852 Unclassified 1181
63 Ga0075434_100009375 3300006871 Bacteria 9123
64 Ga0075436_100055926 3300006914 Bacteria 2726
65 Ga0075435_100008772 3300007076 Bacteria 7279
66 Ga0105240_10006789 3300009093 Bacteria 16741
67 Ga0105240_10079728 3300009093 Bacteria 4028
68 Ga0105240_10117127 3300009093 Bacteria 3213
69 Ga0105240_10567621 3300009093 Unclassified 1253
70 Ga0105245_10027483 3300009098 Bacteria 5013
71 Ga0105245_10060633 3300009098 Bacteria 3407
72 Ga0105247_10019358 3300009101 Bacteria 4085
73 Ga0105237_10047968 3300009545 Bacteria 4294
74 Ga0105237_10364865 3300009545 Bacteria 1449
75 Ga0105238_10114759 3300009551 Bacteria 2673
76 Ga0105238_10126161 3300009551 Bacteria 2538
77 Ga0157373_10231515 3300013100 Bacteria 1305
78 Ga0157371_10052366 3300013102 Bacteria 2899
79 Ga0157370_10012506 3300013104 Bacteria 8797
80 Ga0157370_10106342 3300013104 Bacteria 2626
81 Ga0157369_10002228 3300013105 Bacteria 23342
82 Ga0157369_10099605 3300013105 Bacteria 3098
83 Ga0157369_10149645 3300013105 Bacteria 2467
84 Ga0157374_10021840 3300013296 Bacteria 5702
85 Ga0157374_10185810 3300013296 Bacteria 2032
86 Ga0163162_10069765 3300013306 Bacteria 3567
87 Ga0157372_10073801 3300013307 Bacteria 3846
88 Ga0157372_10166101 3300013307 Bacteria 2552
89 Ga0157372_10343860 3300013307 Bacteria 1738
90 Ga0157375_10410830 3300013308 Bacteria 1520
91 Ga0182008_10001322 3300014497 Bacteria 16890
92 Ga0182008_10104868 3300014497 Unclassified 1398
93 Ga0157376_10019984 3300014969 Bacteria 5172
94 Ga0182006_1019457 3300015261 Bacteria 2857
95 Ga0197907_10609480 3300020069 Bacteria 2066
96 Ga0197907_10844919 3300020069 Bacteria 1079
97 Ga0197907_11115951 3300020069 Bacteria 998
98 Ga0197907_11150316 3300020069 Bacteria 2306
99 Ga0206356_10359923 3300020070 Unclassified 1362
100 Ga0206356_10852227 3300020070 Bacteria 5471
101 Ga0206355_1203836 3300020076 Unclassified 1000
102 Ga0206352_10040748 3300020078 Bacteria 1140
103 Ga0206350_11278009 3300020080 Bacteria 995
104 Ga0206354_11614651 3300020081 Unclassified 1547
105 Ga0206353_10010158 3300020082 Bacteria 3074
106 Ga0206353_11676003 3300020082 Bacteria 2791
107 Ga0213876_10056134 3300021384 Bacteria 2079
108 Ga0224712_10011993 3300022467 Bacteria 2710
109 Ga0224712_10145613 3300022467 Unclassified 1046
110 Ga0207692_10006661 3300025898 Bacteria 4696
111 Ga0207685_10003869 3300025905 Bacteria 3711
112 Ga0207699_10006851 3300025906 Bacteria 5541
113 Ga0207705_10032844 3300025909 Bacteria 3708
114 Ga0207705_10177901 3300025909 Bacteria 1604
115 Ga0207705_10201943 3300025909 Bacteria 1506
116 Ga0207707_10065321 3300025912 Bacteria 3170
117 Ga0207695_10015759 3300025913 Bacteria 8883
118 Ga0207695_10047817 3300025913 Bacteria 4523
119 Ga0207671_10042212 3300025914 Bacteria 3376
120 Ga0207693_10009423 3300025915 Bacteria 7962
121 Ga0207693_10041785 3300025915 Bacteria 3609
122 Ga0207693_10094906 3300025915 Bacteria 2338
123 Ga0207693_10168507 3300025915 Bacteria 1724
124 Ga0207693_10269954 3300025915 Unclassified 1333
125 Ga0207663_10022085 3300025916 Bacteria 3633
126 Ga0207660_10156605 3300025917 Bacteria 1754
127 Ga0207657_10001594 3300025919 Bacteria 24378
128 Ga0207657_10002639 3300025919 Bacteria 19358
129 Ga0207657_10024601 3300025919 Bacteria 5570
130 Ga0207657_10050954 3300025919 Bacteria 3600
131 Ga0207652_10076381 3300025921 Bacteria 2921
132 Ga0207652_10160636 3300025921 Bacteria 2014
133 Ga0207652_10227424 3300025921 Bacteria 1681
134 Ga0207652_10228811 3300025921 Bacteria 1676
135 Ga0207694_10136424 3300025924 Bacteria 1971
136 Ga0207700_10015162 3300025928 Bacteria 5071
137 Ga0207700_10065022 3300025928 Bacteria 2781
138 Ga0207700_10102863 3300025928 Bacteria 2282
139 Ga0207700_10107360 3300025928 Bacteria 2240
140 Ga0207664_10031070 3300025929 Bacteria 4083
141 Ga0207664_10033425 3300025929 Bacteria 3950
142 Ga0207664_10051705 3300025929 Bacteria 3246
143 Ga0207664_10109569 3300025929 Bacteria 2294
144 Ga0207664_10178020 3300025929 Bacteria 1824
145 Ga0207664_10179522 3300025929 Bacteria 1817
146 Ga0207644_10051497 3300025931 Bacteria 2956
147 Ga0207665_10002970 3300025939 Bacteria 11367
148 Ga0207661_10012990 3300025944 Bacteria 6078
149 Ga0207661_10039296 3300025944 Bacteria 3713
150 Ga0207661_10116740 3300025944 Bacteria 2266
151 Ga0207667_10125539 3300025949 Bacteria 2643
152 Ga0207640_10183311 3300025981 Bacteria 1572
153 Ga0207639_10306836 3300026041 Bacteria 1405
154 Ga0207702_10233987 3300026078 Bacteria 1718
155 Ga0207702_10431744 3300026078 Unclassified 1275
156 Ga0207702_10470630 3300026078 Bacteria 1222
157 Ga0207698_10152476 3300026142 Bacteria 2008
158 Ga0207698_10255196 3300026142 Unclassified 1607
159 Ga0265337_1014602 3300028556 Bacteria 2600
160 Ga0265319_1006947 3300028563 Bacteria 5159
161 Ga0265319_1033622 3300028563 Unclassified 1769
162 Ga0265334_10001771 3300028573 Bacteria 10306
163 Ga0265334_10031674 3300028573 Bacteria 2112
164 Ga0265318_10000065 3300028577 Bacteria 102014
165 Ga0265318_10005549 3300028577 Bacteria 5918
166 Ga0265322_10008393 3300028654 Bacteria 3008
167 Ga0265338_10003947 3300028800 Bacteria 20441
168 Ga0265338_10005613 3300028800 Bacteria 16301
169 Ga0265338_10025445 3300028800 Bacteria 6004
170 Ga0265338_10176881 3300028800 Unclassified 1630
171 Ga0265330_10023887 3300031235 Bacteria 2773
172 Ga0265332_10014377 3300031238 Bacteria 3500
173 Ga0265328_10014985 3300031239 Bacteria 3043
174 Ga0265328_10060656 3300031239 Bacteria 1389
175 Ga0265320_10017081 3300031240 Bacteria 4041
176 Ga0265320_10019921 3300031240 Bacteria 3652
177 Ga0265325_10001766 3300031241 Bacteria 14981
178 Ga0265325_10039704 3300031241 Bacteria 2476
179 Ga0265329_10005954 3300031242 Bacteria 4883
180 Ga0265329_10018443 3300031242 Bacteria 2386
181 Ga0265340_10007707 3300031247 Bacteria 5839
182 Ga0265339_10007161 3300031249 Bacteria 7237
183 Ga0265339_10013743 3300031249 Bacteria 4899
184 Ga0265339_10063400 3300031249 Bacteria 1985
185 Ga0265339_10072654 3300031249 Unclassified 1830
186 Ga0265331_10045984 3300031250 Bacteria 2105
187 Ga0265331_10122348 3300031250 Bacteria 1189
188 Ga0265327_10022498 3300031251 Bacteria 3766
189 Ga0265316_10011772 3300031344 Bacteria 7868
190 Ga0265316_10054248 3300031344 Bacteria 3138
191 Ga0265313_10014704 3300031595 Bacteria 4607
192 Ga0265313_10026470 3300031595 Bacteria 3055
193 Ga0265314_10024369 3300031711 Bacteria 4589
194 Ga0265314_10099473 3300031711 Bacteria 1873
195 Ga0265314_10127118 3300031711 Bacteria 1595
196 Ga0265342_10089231 3300031712 Bacteria 1769
197 Ga0265342_10146300 3300031712 Unclassified 1315
198 Ga0265342_10175994 3300031712 Unclassified 1174
199 Ga0373928_0017609 3300035084 Bacteria 1472
200 Ga0373931_0049217 3300035691 Bacteria 2237
201 Ga0373947_0011949 3300035725 Bacteria 4974
202 Ga0373947_0196319 3300035725 Bacteria 1319
203 Ga0373937_0011467 3300036401 Bacteria 7780
204 Ga0373925_0005496 3300037068 Bacteria 9432
205 Ga0395899_0077598 3300037312 Bacteria 2422
206 Ga0395900_0023100 3300037418 Bacteria 6365
207 Ga0395900_0501309 3300037418 Bacteria 1164
208 Ga0395898_0023959 3300037466 Bacteria 6160
209 Ga0395898_0033551 3300037466 Bacteria 5121
210 Ga0395898_0260996 3300037466 Bacteria 1652
211 Ga0395905_0092572 3300037471 Bacteria 2835
212 Ga0395905_0137462 3300037471 Bacteria 2299
213 Ga0395901_0081033 3300038443 Bacteria 3390
214 Ga0395901_0329385 3300038443 Unclassified 1579
215 Ga0395901_0360353 3300038443 Bacteria 1499
216 Ga0395901_0619629 3300038443 Bacteria 1089
217 Ga0436365_0579134 3300039437 Bacteria 2716
218 Ga0466965_0100908 3300044683 Bacteria 1476
219 Ga0466966_0004484 3300044684 Bacteria 9210
220 Ga0466966_0018235 3300044684 Bacteria 4630
221 Ga0466961_0037136 3300044693 Bacteria 3125
222 Ga0466961_0050708 3300044693 Bacteria 2650
223 Ga0466963_0001101 3300044694 Bacteria 14066
224 Ga0466963_0001541 3300044694 Bacteria 12487
225 Ga0466963_0003398 3300044694 Bacteria 9103
226 Ga0466963_0004742 3300044694 Bacteria 7936
227 Ga0466963_0006462 3300044694 Bacteria 6933
228 Ga0466963_0007162 3300044694 Bacteria 6648
229 Ga0466963_0009520 3300044694 Bacteria 5852
230 Ga0466963_0012238 3300044694 Bacteria 5246
231 Ga0466963_0047715 3300044694 Bacteria 2827
232 Ga0466963_0116606 3300044694 Bacteria 1835
233 Ga0466963_0126307 3300044694 Bacteria 1763
234 Ga0466964_0025483 3300044706 Unclassified 2309
235 Ga0466971_0009193 3300044719 Bacteria 4320
236 Ga0466971_0013412 3300044719 Bacteria 3600
237 Ga0466971_0067038 3300044719 Unclassified 1627
238 Ga0466968_0012963 3300044735 Bacteria 3271
239 Ga0466968_0029887 3300044735 Bacteria 2255
240 Ga0466957_0033033 3300044842 Bacteria 3102
241 Ga0466957_0047993 3300044842 Bacteria 2595
242 Ga0466957_0160850 3300044842 Bacteria 1458
243 Ga0466957_0185476 3300044842 Unclassified 1360
244 Ga0466960_0007711 3300044901 Bacteria 4386
245 Ga0466960_0022477 3300044901 Unclassified 2820
246 Ga0466959_0019542 3300045049 Bacteria 4981
247 Ga0466959_0029267 3300045049 Bacteria 4081
248 Ga0466959_0272228 3300045049 Bacteria 1164
249 Ga0466959_0304112 3300045049 Bacteria 1092
250 Ga0466958_0001955 3300045836 Bacteria 10119
251 Ga0466958_0003210 3300045836 Bacteria 8443
252 Ga0466958_0003974 3300045836 Bacteria 7749
253 Ga0466958_0007368 3300045836 Bacteria 6046
254 Ga0466958_0050006 3300045836 Bacteria 2530
255 Ga0466967_0000726 3300045976 Bacteria 16862
256 Ga0466967_0003404 3300045976 Bacteria 10369
257 Ga0466967_0003444 3300045976 Bacteria 10325
258 Ga0466967_0020542 3300045976 Bacteria 5342
259 Ga0466967_0026159 3300045976 Bacteria 4827
260 Ga0466967_0071185 3300045976 Bacteria 3113
261 Ga0466967_0088009 3300045976 Bacteria 2817
262 Ga0466967_0161365 3300045976 Bacteria 2104
263 Ga0466967_0178878 3300045976 Bacteria 1999
264 Ga0466967_0224496 3300045976 Bacteria 1786
265 Ga0466967_0263903 3300045976 Bacteria 1648
266 Ga0466967_0307200 3300045976 Bacteria 1527
267 Ga0495592_0042359 3300046454 Bacteria 3409
268 Ga0495603_0033074 3300046455 Bacteria 3112
269 Ga0495629_0009195 3300046459 Bacteria 7233
270 Ga0495629_0011405 3300046459 Bacteria 6455
271 Ga0495629_0018265 3300046459 Bacteria 5022
272 Ga0495641_0056458 3300046461 Bacteria 1779
273 Ga0495651_0051538 3300046462 Bacteria 3172
274 Ga0495653_0042698 3300046463 Bacteria 3529
275 Ga0495653_0051918 3300046463 Bacteria 3145
276 Ga0495582_0007436 3300046473 Bacteria 6063
277 Ga0495582_0024824 3300046473 Bacteria 3282
278 Ga0495582_0108874 3300046473 Bacteria 1556
279 Ga0495639_0003598 3300046475 Bacteria 6683
280 Ga0495662_0023609 3300046476 Bacteria 2969
281 Ga0495664_0008677 3300046477 Bacteria 5674
282 Ga0495608_0019717 3300046511 Bacteria 4639
283 Ga0495618_0011521 3300046514 Bacteria 5364
284 Ga0495628_0052046 3300046516 Bacteria 3235
285 Ga0495630_0035226 3300046517 Bacteria 3740
286 Ga0495630_0057401 3300046517 Bacteria 2917
287 Ga0495630_0157175 3300046517 Bacteria 1730
288 Ga0495630_0304404 3300046517 Bacteria 1218
289 Ga0495630_0365139 3300046517 Bacteria 1105
290 Ga0495666_0001262 3300046526 Bacteria 12271
291 Ga0495652_0013407 3300046529 Bacteria 7377
292 Ga0495652_0024107 3300046529 Bacteria 5388
293 Ga0495665_0001177 3300046531 Bacteria 13926
294 Ga0495640_0010231 3300046533 Bacteria 7258
295 Ga0495586_0015066 3300046535 Bacteria 4111
296 Ga0495586_0094281 3300046535 Bacteria 1656
297 Ga0495586_0108316 3300046535 Bacteria 1545
298 Ga0495587_0066306 3300046536 Bacteria 2106
299 Ga0495645_0037650 3300046543 Bacteria 3527
300 Ga0495645_0193275 3300046543 Bacteria 1385
301 Ga0495645_0254861 3300046543 Bacteria 1165
302 Ga0495667_0044164 3300046559 Bacteria 2952
303 Ga0495634_0036123 3300046642 Bacteria 3380
304 Ga0495634_0179653 3300046642 Bacteria 1325
305 Ga0495635_0006110 3300046663 Bacteria 8397
306 Ga0495657_0010149 3300046675 Bacteria 7091
307 Ga0495657_0213697 3300046675 Bacteria 1172
308 Ga0495646_0149520 3300046680 Unclassified 1300
309 Ga0495647_0002011 3300046681 Bacteria 6349
310 Ga0495658_0017332 3300046683 Bacteria 3718
311 Ga0495658_0075231 3300046683 Bacteria 1970
312 Ga0495613_0007047 3300046689 Bacteria 8368
313 Ga0495613_0040101 3300046689 Bacteria 3470
314 Ga0495624_0000735 3300046690 Bacteria 25747
315 Ga0495581_0006223 3300047315 Bacteria 6920
316 Ga0495581_0133873 3300047315 Bacteria 1444
317 Ga0495604_0158047 3300047317 Unclassified 1604
318 Ga0495674_0230246 3300047319 Bacteria 1529
319 Ga0495674_0371285 3300047319 Bacteria 1158
320 Ga0495676_0029412 3300047321 Bacteria 4677
321 Ga0495680_0013574 3300047322 Bacteria 7099
322 Ga0495680_0020257 3300047322 Bacteria 5600
323 Ga0495684_0004690 3300047471 Bacteria 10667
324 Ga0495684_0009895 3300047471 Bacteria 7361
325 Ga0495684_0011738 3300047471 Bacteria 6762
326 Ga0495593_0001435 3300047673 Bacteria 13980
327 Ga0495614_0011661 3300048089 Bacteria 3865
328 Ga0496101_0019181 3300048904 Bacteria 4664
329 Ga0496101_0076202 3300048904 Unclassified 2471
330 Ga0496101_0275884 3300048904 Bacteria 1313
331 Ga0496102_0021859 3300048905 Bacteria 5663
332 Ga0496102_0043398 3300048905 Bacteria 4077
333 Ga0496102_0353131 3300048905 Unclassified 1384
334 Ga0496103_0171054 3300048906 Unclassified 1395
335 Ga0496104_0026530 3300048907 Bacteria 5351
336 Ga0496105_0005309 3300048908 Bacteria 9768
337 Ga0496105_0025200 3300048908 Bacteria 4838
338 Ga0496105_0032298 3300048908 Unclassified 4295
339 Ga0496106_0031185 3300048909 Bacteria 3971
340 Ga0496106_0226696 3300048909 Bacteria 1491
341 Ga0496107_0019399 3300048910 Bacteria 4796
342 Ga0496107_0022056 3300048910 Bacteria 4499
343 Ga0496107_0100563 3300048910 Bacteria 2120
344 Ga0496107_0148065 3300048910 Bacteria 1736
345 Ga0496108_0005534 3300048911 Bacteria 10220
346 Ga0496108_0012460 3300048911 Bacteria 6923
347 Ga0496108_0040260 3300048911 Bacteria 3894
348 Ga0496108_0363968 3300048911 Unclassified 1262
349 Ga0496109_0002433 3300048912 Bacteria 15585
350 Ga0496109_0003799 3300048912 Bacteria 12605
351 Ga0496109_0011477 3300048912 Bacteria 7619
352 Ga0496109_0052319 3300048912 Bacteria 3721
353 Ga0496109_0560118 3300048912 Unclassified 1078
354 Ga0496110_0005461 3300048913 Bacteria 9971
355 Ga0496110_0117419 3300048913 Bacteria 2396
356 Ga0496111_0000491 3300048914 Bacteria 20365
357 Ga0496111_0014027 3300048914 Bacteria 5465
358 Ga0496111_0085673 3300048914 Bacteria 2304
359 Ga0496112_0068040 3300048915 Bacteria 3516
360 Ga0496112_0116571 3300048915 Bacteria 2641
361 Ga0496112_0162829 3300048915 Unclassified 2197
362 Ga0496112_0258496 3300048915 Bacteria 1691
363 Ga0496112_0457267 3300048915 Unclassified 1214
364 Ga0496113_0003433 3300048916 Bacteria 9485
365 Ga0496114_0013162 3300048917 Bacteria 6630
366 Ga0496114_0020758 3300048917 Bacteria 5333
367 Ga0496114_0061536 3300048917 Bacteria 3140
368 Ga0496115_0014099 3300048918 Bacteria 6052
369 Ga0496115_0053122 3300048918 Bacteria 3251
370 Ga0496115_0162048 3300048918 Bacteria 1848
371 Ga0501034_0060944 3300049571 Bacteria 3790
372 Ga0501067_0053444 3300049583 Bacteria 2238
373 Ga0501067_0116158 3300049583 Bacteria 1488
374 Ga0501070_0010919 3300049586 Bacteria 7672
375 Ga0501070_0016765 3300049586 Bacteria 6150
376 Ga0501072_0059769 3300049588 Bacteria 3005
377 Ga0501073_0011172 3300049589 Bacteria 6566
378 Ga0501074_0123766 3300049590 Bacteria 1849
379 Ga0501079_0007976 3300049741 Bacteria 8023
380 Ga0501080_0006255 3300049742 Bacteria 10685
381 Ga0501080_0079826 3300049742 Bacteria 3041
382 Ga0501083_0000383 3300049744 Bacteria 28055
383 nmdc:mga08x19_192664_c1 3300050514 Bacteria 1395
384 nmdc:mga08x19_55502_c1 3300050514 Bacteria 2553
385 nmdc:mga0a205_144559_c1 3300050515 Bacteria 2278
386 Ga0495601_0012727 3300053077 Bacteria 5048
387 Ga0495601_0019466 3300053077 Bacteria 4139
388 Ga0495612_0003001 3300053078 Bacteria 7009
389 Ga0495595_0039461 3300053084 Bacteria 2154
390 Ga0495595_0094492 3300053084 Bacteria 1437
391 Ga0495619_0086855 3300053085 Bacteria 2114
392 Ga0495619_0373006 3300053085 Unclassified 986
393 Ga0587093_006482 3300059478 Bacteria 1277
394 Ga0587070_018297 3300059491 Unclassified 1147
395 Ga0587073_0020519 3300059492 Bacteria 1261
396 Ga0587083_0018309 3300059505 Unclassified 1265
397 Ga0587094_017091 3300059513 Unclassified 1017
398 Ga0587115_008903 3300059626 Bacteria 1220
399 Ga0587128_008927 3300059630 Bacteria 1308
400 Ga0587119_006091 3300059658 Unclassified 1257
401 Ga0466962_0002927 3300061719 Bacteria 8137
402 Ga0466962_0013555 3300061719 Bacteria 3925
403 Ga0466962_0015900 3300061719 Bacteria 3631
404 Ga0466962_0077812 3300061719 Bacteria 1586
405 Ga0530510_0054444 3300061734 Bacteria 2891
406 Ga0373944_0052339
407 Ga0058862_10005221
408 Ga0070658_10002021
409 Ga0070658_10031798
410 Ga0070658_10218730
411 Ga0070683_100007102
412 Ga0070683_100007974
413 Ga0070683_100141768
414 Ga0070683_100173599
415 Ga0070680_100090220
416 Ga0070680_100101953
417 Ga0070680_100218854
418 Ga0070682_100038912
419 Ga0070660_100017755
420 Ga0070660_100018972
421 Ga0070660_100023791
422 Ga0070660_100047760
423 Ga0070660_100125123
424 Ga0070691_10030850
425 Ga0070661_100047245
426 Ga0070659_100071339
427 Ga0070709_10015512
428 Ga0070714_100008167
429 Ga0070714_100008590
430 Ga0070714_100050634
431 Ga0070714_100074280
432 Ga0070714_100075404
433 Ga0070714_100084228
434 Ga0070714_100099534
435 Ga0070714_100157112
436 Ga0070714_100319928
437 Ga0070713_100061200
438 Ga0070713_100077959
439 Ga0070710_10006781
440 Ga0070711_100055485
441 Ga0070711_100432912
442 Ga0070681_10053500
443 Ga0070681_10085899
444 Ga0070681_10196382
445 Ga0070698_100035438
446 Ga0070698_100052577
447 Ga0070699_100124245
448 Ga0070679_100057447
449 Ga0070679_100134867
450 Ga0070679_100205563
451 Ga0070684_100024995
452 Ga0070684_100037508
453 Ga0070684_100120677
454 Ga0070684_100269273
455 Ga0070695_100000662
456 Ga0070693_100091589
457 Ga0070704_100025097
458 Ga0068855_100028525
459 Ga0068855_100234380
460 Ga0068856_100243958
461 Ga0068852_100092485
462 Ga0070717_10001661
463 Ga0070717_10007565
464 Ga0070717_10015274
465 Ga0070715_10001940
466 Ga0070716_100015868
467 Ga0075433_10418585
468 Ga0075434_100009375
469 Ga0075436_100055926
470 Ga0075435_100008772
471 Ga0105240_10006789
472 Ga0105240_10079728
473 Ga0105240_10117127
474 Ga0105240_10567621
475 Ga0105245_10027483
476 Ga0105245_10060633
477 Ga0105247_10019358
478 Ga0105237_10047968
479 Ga0105237_10364865
480 Ga0105238_10114759
481 Ga0105238_10126161
482 Ga0157373_10231515
483 Ga0157371_10052366
484 Ga0157370_10012506
485 Ga0157370_10106342
486 Ga0157369_10002228
487 Ga0157369_10099605
488 Ga0157369_10149645
489 Ga0157374_10021840
490 Ga0157374_10185810
491 Ga0163162_10069765
492 Ga0157372_10073801
493 Ga0157372_10166101
494 Ga0157372_10343860
495 Ga0157375_10410830
496 Ga0182008_10001322
497 Ga0182008_10104868
498 Ga0157376_10019984
499 Ga0182006_1019457
500 Ga0197907_10609480
501 Ga0197907_10844919
502 Ga0197907_11115951
503 Ga0197907_11150316
504 Ga0206356_10359923
505 Ga0206356_10852227
506 Ga0206355_1203836
507 Ga0206352_10040748
508 Ga0206350_11278009
509 Ga0206354_11614651
510 Ga0206353_10010158
511 Ga0206353_11676003
512 Ga0213876_10056134
513 Ga0224712_10011993
514 Ga0224712_10145613
515 Ga0207692_10006661
516 Ga0207685_10003869
517 Ga0207699_10006851
518 Ga0207705_10032844
519 Ga0207705_10177901
520 Ga0207705_10201943
521 Ga0207707_10065321
522 Ga0207695_10015759
523 Ga0207695_10047817
524 Ga0207671_10042212
525 Ga0207693_10009423
526 Ga0207693_10041785
527 Ga0207693_10094906
528 Ga0207693_10168507
529 Ga0207693_10269954
530 Ga0207663_10022085
531 Ga0207660_10156605
532 Ga0207657_10001594
533 Ga0207657_10002639
534 Ga0207657_10024601
535 Ga0207657_10050954
536 Ga0207652_10076381
537 Ga0207652_10160636
538 Ga0207652_10227424
539 Ga0207652_10228811
540 Ga0207694_10136424
541 Ga0207700_10015162
542 Ga0207700_10065022
543 Ga0207700_10102863
544 Ga0207700_10107360
545 Ga0207664_10031070
546 Ga0207664_10033425
547 Ga0207664_10051705
548 Ga0207664_10109569
549 Ga0207664_10178020
550 Ga0207664_10179522
551 Ga0207644_10051497
552 Ga0207665_10002970
553 Ga0207661_10012990
554 Ga0207661_10039296
555 Ga0207661_10116740
556 Ga0207667_10125539
557 Ga0207640_10183311
558 Ga0207639_10306836
559 Ga0207702_10233987
560 Ga0207702_10431744
561 Ga0207702_10470630
562 Ga0207698_10152476
563 Ga0207698_10255196
564 Ga0265337_1014602
565 Ga0265319_1006947
566 Ga0265319_1033622
567 Ga0265334_10001771
568 Ga0265334_10031674
569 Ga0265318_10000065
570 Ga0265318_10005549
571 Ga0265322_10008393
572 Ga0265338_10003947
573 Ga0265338_10005613
574 Ga0265338_10025445
575 Ga0265338_10176881
576 Ga0265330_10023887
577 Ga0265332_10014377
578 Ga0265328_10014985
579 Ga0265328_10060656
580 Ga0265320_10017081
581 Ga0265320_10019921
582 Ga0265325_10001766
583 Ga0265325_10039704
584 Ga0265329_10005954
585 Ga0265329_10018443
586 Ga0265340_10007707
587 Ga0265339_10007161
588 Ga0265339_10013743
589 Ga0265339_10063400
590 Ga0265339_10072654
591 Ga0265331_10045984
592 Ga0265331_10122348
593 Ga0265327_10022498
594 Ga0265316_10011772
595 Ga0265316_10054248
596 Ga0265313_10014704
597 Ga0265313_10026470
598 Ga0265314_10024369
599 Ga0265314_10099473
600 Ga0265314_10127118
601 Ga0265342_10089231
602 Ga0265342_10146300
603 Ga0265342_10175994
604 Ga0373928_0017609
605 Ga0373931_0049217
606 Ga0373947_0011949
607 Ga0373947_0196319
608 Ga0373937_0011467
609 Ga0373925_0005496
610 Ga0395899_0077598
611 Ga0395900_0023100
612 Ga0395900_0501309
613 Ga0395898_0023959
614 Ga0395898_0033551
615 Ga0395898_0260996
616 Ga0395905_0092572
617 Ga0395905_0137462
618 Ga0395901_0081033
619 Ga0395901_0329385
620 Ga0395901_0360353
621 Ga0395901_0619629
622 Ga0436365_0579134
623 Ga0466965_0100908
624 Ga0466966_0004484
625 Ga0466966_0018235
626 Ga0466961_0037136
627 Ga0466961_0050708
628 Ga0466963_0001101
629 Ga0466963_0001541
630 Ga0466963_0003398
631 Ga0466963_0004742
632 Ga0466963_0006462
633 Ga0466963_0007162
634 Ga0466963_0009520
635 Ga0466963_0012238
636 Ga0466963_0047715
637 Ga0466963_0116606
638 Ga0466963_0126307
639 Ga0466964_0025483
640 Ga0466971_0009193
641 Ga0466971_0013412
642 Ga0466971_0067038
643 Ga0466968_0012963
644 Ga0466968_0029887
645 Ga0466957_0033033
646 Ga0466957_0047993
647 Ga0466957_0160850
648 Ga0466957_0185476
649 Ga0466960_0007711
650 Ga0466960_0022477
651 Ga0466959_0019542
652 Ga0466959_0029267
653 Ga0466959_0272228
654 Ga0466959_0304112
655 Ga0466958_0001955
656 Ga0466958_0003210
657 Ga0466958_0003974
658 Ga0466958_0007368
659 Ga0466958_0050006
660 Ga0466967_0000726
661 Ga0466967_0003404
662 Ga0466967_0003444
663 Ga0466967_0020542
664 Ga0466967_0026159
665 Ga0466967_0071185
666 Ga0466967_0088009
667 Ga0466967_0161365
668 Ga0466967_0178878
669 Ga0466967_0224496
670 Ga0466967_0263903
671 Ga0466967_0307200
672 Ga0495592_0042359
673 Ga0495603_0033074
674 Ga0495629_0009195
675 Ga0495629_0011405
676 Ga0495629_0018265
677 Ga0495641_0056458
678 Ga0495651_0051538
679 Ga0495653_0042698
680 Ga0495653_0051918
681 Ga0495582_0007436
682 Ga0495582_0024824
683 Ga0495582_0108874
684 Ga0495639_0003598
685 Ga0495662_0023609
686 Ga0495664_0008677
687 Ga0495608_0019717
688 Ga0495618_0011521
689 Ga0495628_0052046
690 Ga0495630_0035226
691 Ga0495630_0057401
692 Ga0495630_0157175
693 Ga0495630_0304404
694 Ga0495630_0365139
695 Ga0495666_0001262
696 Ga0495652_0013407
697 Ga0495652_0024107
698 Ga0495665_0001177
699 Ga0495640_0010231
700 Ga0495586_0015066
701 Ga0495586_0094281
702 Ga0495586_0108316
703 Ga0495587_0066306
704 Ga0495645_0037650
705 Ga0495645_0193275
706 Ga0495645_0254861
707 Ga0495667_0044164
708 Ga0495634_0036123
709 Ga0495634_0179653
710 Ga0495635_0006110
711 Ga0495657_0010149
712 Ga0495657_0213697
713 Ga0495646_0149520
714 Ga0495647_0002011
715 Ga0495658_0017332
716 Ga0495658_0075231
717 Ga0495613_0007047
718 Ga0495613_0040101
719 Ga0495624_0000735
720 Ga0495581_0006223
721 Ga0495581_0133873
722 Ga0495604_0158047
723 Ga0495674_0230246
724 Ga0495674_0371285
725 Ga0495676_0029412
726 Ga0495680_0013574
727 Ga0495680_0020257
728 Ga0495684_0004690
729 Ga0495684_0009895
730 Ga0495684_0011738
731 Ga0495593_0001435
732 Ga0495614_0011661
733 Ga0496101_0019181
734 Ga0496101_0076202
735 Ga0496101_0275884
736 Ga0496102_0021859
737 Ga0496102_0043398
738 Ga0496102_0353131
739 Ga0496103_0171054
740 Ga0496104_0026530
741 Ga0496105_0005309
742 Ga0496105_0025200
743 Ga0496105_0032298
744 Ga0496106_0031185
745 Ga0496106_0226696
746 Ga0496107_0019399
747 Ga0496107_0022056
748 Ga0496107_0100563
749 Ga0496107_0148065
750 Ga0496108_0005534
751 Ga0496108_0012460
752 Ga0496108_0040260
753 Ga0496108_0363968
754 Ga0496109_0002433
755 Ga0496109_0003799
756 Ga0496109_0011477
757 Ga0496109_0052319
758 Ga0496109_0560118
759 Ga0496110_0005461
760 Ga0496110_0117419
761 Ga0496111_0000491
762 Ga0496111_0014027
763 Ga0496111_0085673
764 Ga0496112_0068040
765 Ga0496112_0116571
766 Ga0496112_0162829
767 Ga0496112_0258496
768 Ga0496112_0457267
769 Ga0496113_0003433
770 Ga0496114_0013162
771 Ga0496114_0020758
772 Ga0496114_0061536
773 Ga0496115_0014099
774 Ga0496115_0053122
775 Ga0496115_0162048
776 Ga0501034_0060944
777 Ga0501067_0053444
778 Ga0501067_0116158
779 Ga0501070_0010919
780 Ga0501070_0016765
781 Ga0501072_0059769
782 Ga0501073_0011172
783 Ga0501074_0123766
784 Ga0501079_0007976
785 Ga0501080_0006255
786 Ga0501080_0079826
787 Ga0501083_0000383
788 nmdc:mga08x19_192664_c1
789 nmdc:mga08x19_55502_c1
790 nmdc:mga0a205_144559_c1
791 Ga0495601_0012727
792 Ga0495601_0019466
793 Ga0495612_0003001
794 Ga0495595_0039461
795 Ga0495595_0094492
796 Ga0495619_0086855
797 Ga0495619_0373006
798 Ga0587093_006482
799 Ga0587070_018297
800 Ga0587073_0020519
801 Ga0587083_0018309
802 Ga0587094_017091
803 Ga0587115_008903
804 Ga0587128_008927
805 Ga0587119_006091
806 Ga0466962_0002927
807 Ga0466962_0013555
808 Ga0466962_0015900
809 Ga0466962_0077812
810 Ga0530510_0054444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

48

312

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sw5-assembly4.cif.gz_D crystal structure of prox from archeoglobus fulgidus in the ligand free form 0.9328 11 274
7s7w-assembly1.cif.gz_A crystal structure of inicsnfr3a nicotine sensor precursor binding protein 0.9306 12 274
3o66-assembly1.cif.gz_A crystal structure of glycine betaine/carnitine/choline abc transporter 0.9233 10 274
3o66-assembly2.cif.gz_B crystal structure of glycine betaine/carnitine/choline abc transporter 0.9188 13 274
7s7y-assembly1.cif.gz_A crystal structure of icytsnfr cytisine sensor precursor binding protein 0.9155 10 274
ID Description Score Start End Superfamily
af_Q2FVH0_34_306_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9415 13 274 3.40.190.10
5ljiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9255 11 45 3.40.50.360
1sw5B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9141 11 274 3.40.190.10
af_Q94AB5_13_248_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9086 11 45 3.40.50.2000
af_Q2FVH0_34_306_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9018 13 274 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4R1HXW9-F1-model_v4 Osmoprotectant transport system substrate-binding protein 0.9776 10 275 GO:0022857
GO:0043190
AF-A0A535P9F8-F1-model_v4 ABC-type glycine betaine transport system substrate-binding domain-containing protein 0.9756 8 274 GO:0022857
GO:0043190
AF-A0A1W9Z324-F1-model_v4 ABC-type glycine betaine transport system substrate-binding domain-containing protein 0.9705 12 274 GO:0022857
GO:0043190
AF-A0A2V8GV36-F1-model_v4 ABC-type glycine betaine transport system substrate-binding domain-containing protein 0.9678 10 109 GO:0022857
GO:0043190
AF-A0A7Z0AC61-F1-model_v4 Osmoprotectant transport system substrate-binding protein 0.9651 10 275 GO:0022857
GO:0043190

Map