F435875

General Info

Members Datasets Scaffolds Average Seq Length
405 240 810 209

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100609889|Ga0070659_1006098892
Length 231
Sequence VSWRCAAGSSGGRRQTDGVLIHPWDEPLADTDALAFVRRTGFGHLVAPGRREVPVVVPTQYVLSDEPAEVFPEVLLHLARPNPVWAALAESPTVVLSVAGEWAYVPAAWKAIGDEDATLGIPTTYYAAVQLVASAEILDEPEAKLAVLRAQLASVEPSSGVADPSVHARKLTGIRGLRLSVREVKAKFKYGGNVDAAHRAAIADRLLSRSGPGDAAARAHILRSLQDGGGE

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
88 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
89 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
170 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
228 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
229 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
230 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
231 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
232 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
233 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
234 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
235 2891562705 Microbispora tritici MT50 Isolate Unclassified
236 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
237 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
238 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
239 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
240 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 1.98
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.46
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100609889 3300005366 Unclassified 938
2 JGI24740J21852_10060413 3300001979 Bacteria 1047
3 JGI24751J29686_10011380 3300002459 Bacteria 1835
4 Ga0070658_10008144 3300005327 Bacteria 8430
5 Ga0070683_100172140 3300005329 Bacteria 2055
6 Ga0070670_100025382 3300005331 Bacteria 5099
7 Ga0068869_100005037 3300005334 Bacteria 8278
8 Ga0068869_100670765 3300005334 Unclassified 882
9 Ga0070666_10353663 3300005335 Bacteria 1052
10 Ga0070680_100004145 3300005336 Bacteria 10857
11 Ga0070680_100046026 3300005336 Bacteria 3548
12 Ga0070680_100056929 3300005336 Bacteria 3195
13 Ga0070680_100061220 3300005336 Bacteria 3081
14 Ga0070680_100148033 3300005336 Bacteria 1971
15 Ga0070682_100014827 3300005337 Bacteria 4510
16 Ga0068868_100269387 3300005338 Bacteria 1438
17 Ga0070660_100038462 3300005339 Bacteria 3632
18 Ga0070660_100097057 3300005339 Bacteria 2331
19 Ga0070660_100254696 3300005339 Bacteria 1432
20 Ga0070689_100070553 3300005340 Bacteria 2728
21 Ga0070691_10002098 3300005341 Bacteria 8817
22 Ga0070687_100183348 3300005343 Unclassified 1255
23 Ga0070687_100397266 3300005343 Bacteria 903
24 Ga0070692_10006661 3300005345 Bacteria 5030
25 Ga0070692_10006860 3300005345 Bacteria 4976
26 Ga0070692_10014032 3300005345 Bacteria 3751
27 Ga0070692_10081633 3300005345 Bacteria 1742
28 Ga0070668_100093680 3300005347 Bacteria 2371
29 Ga0070675_100003495 3300005354 Bacteria 11918
30 Ga0070671_100019757 3300005355 Bacteria 5487
31 Ga0070688_100091051 3300005365 Bacteria 1993
32 Ga0070659_100006716 3300005366 Bacteria 8317
33 Ga0070659_100008827 3300005366 Bacteria 7385
34 Ga0070703_10005951 3300005406 Bacteria 3414
35 Ga0070709_10006128 3300005434 Bacteria 6543
36 Ga0070714_100170221 3300005435 Bacteria 1976
37 Ga0070714_100565137 3300005435 Bacteria 1090
38 Ga0070710_10088631 3300005437 Bacteria 1821
39 Ga0070701_10086106 3300005438 Bacteria 1712
40 Ga0070705_100070904 3300005440 Bacteria 2106
41 Ga0070705_100136642 3300005440 Bacteria 1607
42 Ga0070700_100051189 3300005441 Bacteria 2570
43 Ga0070694_100005105 3300005444 Bacteria 7914
44 Ga0070694_100048686 3300005444 Bacteria 2852
45 Ga0070694_100169895 3300005444 Bacteria 1605
46 Ga0070708_100081115 3300005445 Bacteria 2936
47 Ga0070708_100091909 3300005445 Bacteria 2764
48 Ga0070663_100002630 3300005455 Bacteria 10160
49 Ga0070663_100007392 3300005455 Bacteria 6683
50 Ga0070678_100003284 3300005456 Bacteria 8991
51 Ga0070662_100665829 3300005457 Bacteria 879
52 Ga0070681_10029719 3300005458 Bacteria 5486
53 Ga0070681_10065994 3300005458 Bacteria 3588
54 Ga0070681_10101550 3300005458 Bacteria 2822
55 Ga0070681_10269928 3300005458 Bacteria 1613
56 Ga0070681_10531306 3300005458 Bacteria 1090
57 Ga0068867_100316394 3300005459 Bacteria 1292
58 Ga0070685_10046168 3300005466 Bacteria 2500
59 Ga0070706_100050038 3300005467 Bacteria 3856
60 Ga0070706_100089219 3300005467 Bacteria 2859
61 Ga0070706_100204917 3300005467 Bacteria 1842
62 Ga0070706_100541897 3300005467 Bacteria 1082
63 Ga0070706_100648555 3300005467 Unclassified 980
64 Ga0070706_100659090 3300005467 Bacteria 971
65 Ga0070707_100006843 3300005468 Bacteria 10558
66 Ga0070707_100015737 3300005468 Bacteria 7101
67 Ga0070707_100330331 3300005468 Bacteria 1481
68 Ga0070707_100395244 3300005468 Bacteria 1342
69 Ga0070707_101105951 3300005468 Bacteria 758
70 Ga0070698_100000291 3300005471 Bacteria 50991
71 Ga0070698_100013997 3300005471 Bacteria 8484
72 Ga0070698_100015443 3300005471 Bacteria 8068
73 Ga0070698_100018003 3300005471 Bacteria 7439
74 Ga0070699_100037125 3300005518 Bacteria 4216
75 Ga0070699_100144796 3300005518 Bacteria 2099
76 Ga0070699_100373797 3300005518 Unclassified 1286
77 Ga0070699_100464189 3300005518 Bacteria 1148
78 Ga0070699_100831211 3300005518 Bacteria 845
79 Ga0070679_100003619 3300005530 Bacteria 14125
80 Ga0070679_100044695 3300005530 Bacteria 4413
81 Ga0070679_100089525 3300005530 Bacteria 3065
82 Ga0070679_100123236 3300005530 Bacteria 2575
83 Ga0070679_100380310 3300005530 Unclassified 1359
84 Ga0070679_100641117 3300005530 Bacteria 1005
85 Ga0070684_100224705 3300005535 Bacteria 1713
86 Ga0070684_100370061 3300005535 Bacteria 1319
87 Ga0070697_100015514 3300005536 Bacteria 5981
88 Ga0070697_100015945 3300005536 Bacteria 5906
89 Ga0070697_100302319 3300005536 Bacteria 1375
90 Ga0068853_100185017 3300005539 Bacteria 1890
91 Ga0070686_100112761 3300005544 Bacteria 1855
92 Ga0070695_100392096 3300005545 Bacteria 1050
93 Ga0070696_100074062 3300005546 Bacteria 2400
94 Ga0070696_100328107 3300005546 Unclassified 1179
95 Ga0070693_100003635 3300005547 Bacteria 7207
96 Ga0070665_100235813 3300005548 Bacteria 1830
97 Ga0070704_100013615 3300005549 Bacteria 5055
98 Ga0070704_100451072 3300005549 Bacteria 1107
99 Ga0070704_100452759 3300005549 Bacteria 1105
100 Ga0070664_100122175 3300005564 Bacteria 2281
101 Ga0068857_100037676 3300005577 Bacteria 4284
102 Ga0068854_100195620 3300005578 Bacteria 1587
103 Ga0068854_100645039 3300005578 Bacteria 908
104 Ga0068856_100008985 3300005614 Bacteria 9722
105 Ga0068856_100128076 3300005614 Bacteria 2542
106 Ga0070702_100072472 3300005615 Bacteria 2038
107 Ga0068852_100001501 3300005616 Bacteria 15792
108 Ga0068852_100448021 3300005616 Bacteria 1277
109 Ga0068859_100463646 3300005617 Bacteria 1363
110 Ga0068864_100017342 3300005618 Bacteria 6002
111 Ga0068861_100321531 3300005719 Bacteria 1348
112 Ga0068851_10031927 3300005834 Bacteria 2619
113 Ga0068870_10000117 3300005840 Bacteria 27108
114 Ga0068863_100022596 3300005841 Bacteria 6007
115 Ga0068858_100065326 3300005842 Bacteria 3366
116 Ga0068860_100123105 3300005843 Bacteria 2485
117 Ga0070717_10075158 3300006028 Bacteria 2826
118 Ga0070717_10117143 3300006028 Bacteria 2278
119 Ga0070717_10156071 3300006028 Bacteria 1977
120 Ga0070716_100199436 3300006173 Bacteria 1329
121 Ga0070716_100426072 3300006173 Bacteria 961
122 Ga0097621_100035672 3300006237 Bacteria 3976
123 Ga0068871_100255754 3300006358 Bacteria 1526
124 Ga0075428_100056898 3300006844 Bacteria 4282
125 Ga0075431_100550683 3300006847 Bacteria 1141
126 Ga0075433_10041357 3300006852 Bacteria 3993
127 Ga0075433_10174664 3300006852 Bacteria 1911
128 Ga0075433_10337703 3300006852 Unclassified 1332
129 Ga0075434_100005145 3300006871 Bacteria 11877
130 Ga0075434_100292561 3300006871 Unclassified 1649
131 Ga0075434_100381472 3300006871 Bacteria 1430
132 Ga0075434_100480262 3300006871 Bacteria 1264
133 Ga0075429_100000405 3300006880 Bacteria 31890
134 Ga0075429_100441299 3300006880 Bacteria 1140
135 Ga0075436_100000577 3300006914 Bacteria 23957
136 Ga0075436_100015247 3300006914 Bacteria 5262
137 Ga0075436_100033899 3300006914 Bacteria 3519
138 Ga0097620_100463636 3300006931 Bacteria 1363
139 Ga0075435_100072369 3300007076 Bacteria 2816
140 Ga0075435_100125173 3300007076 Bacteria 2147
141 Ga0075435_100130163 3300007076 Bacteria 2105
142 Ga0075435_100679251 3300007076 Bacteria 894
143 Ga0105240_10338972 3300009093 Bacteria 1708
144 Ga0111539_10096308 3300009094 Bacteria 3476
145 Ga0111539_10151126 3300009094 Bacteria 2718
146 Ga0105247_10005072 3300009101 Bacteria 8347
147 Ga0114129_10057185 3300009147 Bacteria 5460
148 Ga0114129_10098242 3300009147 Bacteria 4052
149 Ga0114129_10141715 3300009147 Bacteria 3294
150 Ga0114129_10156879 3300009147 Bacteria 3111
151 Ga0114129_10393099 3300009147 Viruses 1828
152 Ga0114129_10762155 3300009147 Bacteria 1238
153 Ga0114129_10957911 3300009147 Bacteria 1080
154 Ga0105241_10008648 3300009174 Bacteria 7484
155 Ga0105241_10504051 3300009174 Unclassified 1080
156 Ga0105242_10361063 3300009176 Bacteria 1344
157 Ga0105242_10703760 3300009176 Unclassified 989
158 Ga0105248_10122071 3300009177 Bacteria 2939
159 Ga0105248_10877431 3300009177 Bacteria 1013
160 Ga0105237_10050047 3300009545 Bacteria 4199
161 Ga0105238_10049670 3300009551 Bacteria 4224
162 Ga0105249_10366523 3300009553 Bacteria 1463
163 Ga0105246_10002923 3300011119 Bacteria 10335
164 Ga0157317_1002261 3300012475 Bacteria 1125
165 Ga0157347_1016689 3300012502 Bacteria 829
166 Ga0157313_1004978 3300012503 Bacteria 940
167 Ga0157373_10361751 3300013100 Bacteria 1036
168 Ga0157373_10388815 3300013100 Bacteria 999
169 Ga0157371_10046401 3300013102 Bacteria 3090
170 Ga0157370_10024473 3300013104 Bacteria 5980
171 Ga0157369_10043274 3300013105 Bacteria 4909
172 Ga0157369_10176215 3300013105 Bacteria 2251
173 Ga0157369_10185670 3300013105 Bacteria 2187
174 Ga0157369_10289377 3300013105 Bacteria 1706
175 Ga0157374_10032947 3300013296 Bacteria 4723
176 Ga0163163_10080702 3300014325 Bacteria 3253
177 Ga0157380_10319221 3300014326 Bacteria 1439
178 Ga0182008_10152776 3300014497 Bacteria 1158
179 Ga0157377_10064863 3300014745 Bacteria 2096
180 Ga0157379_10020411 3300014968 Bacteria 5857
181 Ga0197907_10004069 3300020069 Bacteria 1418
182 Ga0206350_10092184 3300020080 Bacteria 853
183 Ga0206353_10040890 3300020082 Bacteria 3614
184 Ga0206353_10274823 3300020082 Bacteria 1544
185 Ga0206353_10341238 3300020082 Bacteria 988
186 Ga0206353_10507980 3300020082 Bacteria 2297
187 Ga0206353_10845098 3300020082 Bacteria 2677
188 Ga0224712_10016384 3300022467 Bacteria 2434
189 Ga0207426_1027351 3300025302 Bacteria 1900
190 Ga0207656_10005666 3300025321 Bacteria 4435
191 Ga0207713_1016617 3300025735 Bacteria 3728
192 Ga0207653_10000075 3300025885 Bacteria 73038
193 Ga0207692_10034515 3300025898 Bacteria 2450
194 Ga0207688_10041761 3300025901 Bacteria 2552
195 Ga0207680_10101889 3300025903 Bacteria 1846
196 Ga0207699_10005542 3300025906 Bacteria 6055
197 Ga0207645_10026757 3300025907 Bacteria 3726
198 Ga0207643_10004322 3300025908 Bacteria 7639
199 Ga0207705_10008688 3300025909 Bacteria 7399
200 Ga0207684_10000262 3300025910 Bacteria 78292
201 Ga0207684_10013294 3300025910 Bacteria 7121
202 Ga0207684_10022854 3300025910 Bacteria 5340
203 Ga0207684_10175551 3300025910 Bacteria 1847
204 Ga0207684_10643371 3300025910 Unclassified 904
205 Ga0207684_10804581 3300025910 Unclassified 794
206 Ga0207654_10036189 3300025911 Bacteria 2756
207 Ga0207707_10032359 3300025912 Bacteria 4577
208 Ga0207707_10041309 3300025912 Bacteria 4028
209 Ga0207671_10084126 3300025914 Bacteria 2389
210 Ga0207660_10011428 3300025917 Bacteria 5779
211 Ga0207660_10045426 3300025917 Bacteria 3094
212 Ga0207660_10060356 3300025917 Bacteria 2726
213 Ga0207660_10152791 3300025917 Unclassified 1775
214 Ga0207660_10191725 3300025917 Bacteria 1592
215 Ga0207662_10006904 3300025918 Bacteria 6155
216 Ga0207662_10037034 3300025918 Bacteria 2854
217 Ga0207657_10095913 3300025919 Bacteria 2468
218 Ga0207657_10143096 3300025919 Bacteria 1953
219 Ga0207649_10081655 3300025920 Bacteria 2094
220 Ga0207652_10003401 3300025921 Bacteria 13136
221 Ga0207652_10007622 3300025921 Bacteria 8710
222 Ga0207652_10114960 3300025921 Bacteria 2390
223 Ga0207646_10000014 3300025922 Bacteria 345047
224 Ga0207646_10001195 3300025922 Bacteria 32677
225 Ga0207646_10008477 3300025922 Bacteria 10298
226 Ga0207646_10013380 3300025922 Bacteria 7851
227 Ga0207646_10052143 3300025922 Bacteria 3660
228 Ga0207646_10432830 3300025922 Bacteria 1187
229 Ga0207694_10025126 3300025924 Bacteria 4526
230 Ga0207650_10008359 3300025925 Bacteria 7065
231 Ga0207659_10024927 3300025926 Bacteria 4014
232 Ga0207687_10008816 3300025927 Bacteria 6593
233 Ga0207700_10022164 3300025928 Bacteria 4352
234 Ga0207700_10446623 3300025928 Bacteria 1139
235 Ga0207664_10126232 3300025929 Bacteria 2148
236 Ga0207664_10159101 3300025929 Bacteria 1925
237 Ga0207644_10026061 3300025931 Bacteria 4025
238 Ga0207690_10003506 3300025932 Bacteria 9348
239 Ga0207690_10022445 3300025932 Bacteria 3927
240 Ga0207690_10081488 3300025932 Bacteria 2261
241 Ga0207690_10151789 3300025932 Bacteria 1718
242 Ga0207706_10659470 3300025933 Bacteria 896
243 Ga0207686_10243824 3300025934 Bacteria 1309
244 Ga0207704_10077245 3300025938 Bacteria 2137
245 Ga0207704_10144718 3300025938 Bacteria 1668
246 Ga0207665_10109057 3300025939 Bacteria 1943
247 Ga0207691_10217559 3300025940 Bacteria 1657
248 Ga0207711_10064551 3300025941 Bacteria 3163
249 Ga0207689_10000247 3300025942 Bacteria 48421
250 Ga0207689_10167055 3300025942 Bacteria 1813
251 Ga0207661_10016839 3300025944 Bacteria 5397
252 Ga0207661_10103435 3300025944 Bacteria 2396
253 Ga0207661_10109392 3300025944 Bacteria 2335
254 Ga0207679_10003122 3300025945 Bacteria 10242
255 Ga0207679_10090122 3300025945 Bacteria 2369
256 Ga0207679_10408710 3300025945 Bacteria 1195
257 Ga0207667_10335686 3300025949 Bacteria 1543
258 Ga0207651_10085161 3300025960 Bacteria 2292
259 Ga0207651_10125082 3300025960 Bacteria 1958
260 Ga0207651_11055350 3300025960 Bacteria 727
261 Ga0207712_10171274 3300025961 Bacteria 1697
262 Ga0207668_10006608 3300025972 Bacteria 6857
263 Ga0207668_10029057 3300025972 Bacteria 3621
264 Ga0207640_10301952 3300025981 Bacteria 1267
265 Ga0207658_10705965 3300025986 Bacteria 912
266 Ga0207677_10093833 3300026023 Bacteria 2189
267 Ga0207677_10109906 3300026023 Bacteria 2051
268 Ga0207703_10206090 3300026035 Bacteria 1750
269 Ga0207639_10019223 3300026041 Bacteria 4868
270 Ga0207678_10000047 3300026067 Bacteria 91240
271 Ga0207678_10000642 3300026067 Bacteria 32117
272 Ga0207708_10068009 3300026075 Bacteria 2726
273 Ga0207708_10076339 3300026075 Bacteria 2570
274 Ga0207702_10004755 3300026078 Bacteria 11986
275 Ga0207641_10062179 3300026088 Bacteria 3185
276 Ga0207676_10005258 3300026095 Bacteria 9160
277 Ga0207674_10777540 3300026116 Unclassified 924
278 Ga0207675_100273452 3300026118 Bacteria 1640
279 Ga0207675_100422785 3300026118 Bacteria 1316
280 Ga0207675_100729441 3300026118 Bacteria 1001
281 Ga0207683_10003277 3300026121 Bacteria 14107
282 Ga0207698_10037324 3300026142 Bacteria 3577
283 Ga0207428_10002607 3300027907 Bacteria 18004
284 Ga0268266_10201538 3300028379 Bacteria 1821
285 Ga0307515_10117407 3300028794 Bacteria 3045
286 Ga0307514_10022882 3300031649 Bacteria 5074
287 Ga0307507_10041772 3300033179 Bacteria 4582
288 Ga0373925_0754024 3300037068 Unclassified 802
289 Ga0395899_0193345 3300037312 Bacteria 1423
290 Ga0451853_2341392 3300041512 Bacteria 1622
291 Ga0439448_0003020 3300042005 Bacteria 4622
292 Ga0439463_032674 3300042016 Bacteria 1315
293 Ga0439459_0006254 3300042438 Bacteria 1979
294 Ga0466972_0003734 3300044658 Bacteria 7571
295 Ga0466965_0024859 3300044683 Bacteria 2898
296 Ga0466961_0038560 3300044693 Bacteria 3065
297 Ga0466961_0046456 3300044693 Bacteria 2777
298 Ga0466961_0195303 3300044693 Bacteria 1253
299 Ga0466961_0214043 3300044693 Bacteria 1189
300 Ga0466961_0258601 3300044693 Bacteria 1068
301 Ga0466963_0003069 3300044694 Bacteria 9459
302 Ga0466963_0015331 3300044694 Bacteria 4742
303 Ga0466963_0171899 3300044694 Bacteria 1511
304 Ga0466963_0240479 3300044694 Bacteria 1270
305 Ga0466963_0276025 3300044694 Bacteria 1181
306 Ga0466963_0294125 3300044694 Bacteria 1142
307 Ga0466963_0558850 3300044694 Bacteria 808
308 Ga0466964_0139282 3300044706 Bacteria 1113
309 Ga0466971_0082197 3300044719 Bacteria 1470
310 Ga0466971_0153079 3300044719 Bacteria 1077
311 Ga0466970_0043910 3300044765 Bacteria 2380
312 Ga0466970_0059570 3300044765 Bacteria 2045
313 Ga0466957_0004034 3300044842 Bacteria 8128
314 Ga0466957_0016323 3300044842 Bacteria 4343
315 Ga0466957_0175571 3300044842 Bacteria 1397
316 Ga0466957_0293152 3300044842 Bacteria 1091
317 Ga0466957_0374278 3300044842 Bacteria 970
318 Ga0466960_0064608 3300044901 Bacteria 1805
319 Ga0466960_0080658 3300044901 Bacteria 1639
320 Ga0466960_0180337 3300044901 Bacteria 1144
321 Ga0466959_0375388 3300045049 Bacteria 968
322 Ga0466958_0000255 3300045836 Bacteria 20624
323 Ga0466958_0114286 3300045836 Bacteria 1686
324 Ga0466967_0019278 3300045976 Bacteria 5481
325 Ga0466967_0034367 3300045976 Bacteria 4302
326 Ga0466967_0103979 3300045976 Bacteria 2599
327 Ga0466967_1337361 3300045976 Bacteria 714
328 Ga0495629_0154819 3300046459 Bacteria 1593
329 Ga0495651_0004180 3300046462 Bacteria 11057
330 Ga0495608_0004084 3300046511 Bacteria 10473
331 Ga0495587_0009876 3300046536 Bacteria 6093
332 Ga0495645_0068781 3300046543 Bacteria 2556
333 Ga0495667_0006940 3300046559 Bacteria 7678
334 Ga0495657_0003615 3300046675 Bacteria 12568
335 Ga0495623_0365234 3300046679 Unclassified 783
336 Ga0495600_0059668 3300046809 Bacteria 2492
337 Ga0495680_0039251 3300047322 Bacteria 3778
338 Ga0495675_0021853 3300047444 Bacteria 4076
339 Ga0495675_0042630 3300047444 Bacteria 2891
340 Ga0495602_0246183 3300048088 Bacteria 1335
341 Ga0496100_0133516 3300048903 Bacteria 1751
342 Ga0496100_0404850 3300048903 Bacteria 1040
343 Ga0496101_0042153 3300048904 Bacteria 3258
344 Ga0496104_0011108 3300048907 Bacteria 8056
345 Ga0496105_0004590 3300048908 Bacteria 10405
346 Ga0496106_0033505 3300048909 Bacteria 3832
347 Ga0496107_0014310 3300048910 Bacteria 5556
348 Ga0496108_0011686 3300048911 Bacteria 7141
349 Ga0496109_0014956 3300048912 Bacteria 6755
350 Ga0496110_0036738 3300048913 Bacteria 4255
351 Ga0496111_0000426 3300048914 Bacteria 21285
352 Ga0496112_0215309 3300048915 Bacteria 1877
353 Ga0496113_0016938 3300048916 Bacteria 5045
354 Ga0496115_0034452 3300048918 Bacteria 4002
355 Ga0501034_0749912 3300049571 Bacteria 872
356 Ga0501036_0384361 3300049572 Bacteria 1171
357 Ga0501046_0582590 3300049580 Bacteria 795
358 Ga0501047_0404007 3300049581 Bacteria 1199
359 Ga0501047_0449218 3300049581 Bacteria 1118
360 Ga0501068_0024211 3300049584 Bacteria 3564
361 Ga0501074_0329977 3300049590 Bacteria 1083
362 Ga0501080_0673876 3300049742 Bacteria 914
363 Ga0501044_0164369 3300049823 Bacteria 2194
364 nmdc:mga05p37_1451514_c1 3300050507 Bacteria 687
365 nmdc:mga05p37_145942_c1 3300050507 Unclassified 2898
366 nmdc:mga05p37_31494_c1 3300050507 Bacteria 4297
367 nmdc:mga05p37_32016_c1 3300050507 Bacteria 6430
368 nmdc:mga05p37_519146_c1 3300050507 Bacteria 1363
369 nmdc:mga05p37_878732_c1 3300050507 Unclassified 970
370 nmdc:mga09592_3515_c1 3300050508 Bacteria 12666
371 nmdc:mga06r32_469366_c1 3300050510 Bacteria 1237
372 nmdc:mga08y16_43766_c1 3300050511 Bacteria 4693
373 nmdc:mga0n895_3834_c1 3300050512 Bacteria 12196
374 nmdc:mga0n895_586024_c1 3300050512 Unclassified 1119
375 nmdc:mga0n895_693814_c1 3300050512 Bacteria 1014
376 nmdc:mga0n895_81173_c1 3300050512 Unclassified 3231
377 nmdc:mga0rr50_310510_c1 3300050513 Bacteria 1321
378 nmdc:mga0rr50_5714_c1 3300050513 Bacteria 7456
379 nmdc:mga08x19_121776_c1 3300050514 Bacteria 1749
380 nmdc:mga08x19_18109_c1 3300050514 Bacteria 4315
381 nmdc:mga08x19_2946_c1 3300050514 Bacteria 10229
382 nmdc:mga0a205_10571_c1 3300050515 Bacteria 8481
383 nmdc:mga0a205_18968_c1 3300050515 Bacteria 6480
384 nmdc:mga0a205_190490_c1 3300050515 Bacteria 1943
385 Ga0495595_0015369 3300053084 Bacteria 3265
386 Ga0495619_0236220 3300053085 Bacteria 1267
387 Ga0466962_0027741 3300061719 Bacteria 2715
388 Ga0466962_0039036 3300061719 Bacteria 2274
389 Ga0466962_0054401 3300061719 Bacteria 1913
390 Ga0466962_0164401 3300061719 Bacteria 1079
391 2515852876 2515154155 Bacteria 7985436
392 2676473234 2675903058 Bacteria 6822861
393 2676489981 2675903060 Bacteria 10051191
394 2827631832 2827628540 Bacteria 6858585
395 2856742033 2856741275 Bacteria 8096094
396 2884693878 2884693830 Bacteria 11273186
397 2891401331 2891395885 Bacteria 9251614
398 2891558328 2891554331 Bacteria 8812224
399 2891566703 2891562705 Bacteria 8039471
400 2895437846 2895427314 Bacteria 13147766
401 2895448268 2895442618 Bacteria 11027144
402 2917740545 2917736166 Bacteria 9690793
403 2990093363 2990088156 Bacteria 6657676
404 8003322251 8003314358 Bacteria 10575343
405 8003322254 8003314358 Bacteria 10575343
406 Ga0070659_100609889
407 JGI24740J21852_10060413
408 JGI24751J29686_10011380
409 Ga0070658_10008144
410 Ga0070683_100172140
411 Ga0070670_100025382
412 Ga0068869_100005037
413 Ga0068869_100670765
414 Ga0070666_10353663
415 Ga0070680_100004145
416 Ga0070680_100046026
417 Ga0070680_100056929
418 Ga0070680_100061220
419 Ga0070680_100148033
420 Ga0070682_100014827
421 Ga0068868_100269387
422 Ga0070660_100038462
423 Ga0070660_100097057
424 Ga0070660_100254696
425 Ga0070689_100070553
426 Ga0070691_10002098
427 Ga0070687_100183348
428 Ga0070687_100397266
429 Ga0070692_10006661
430 Ga0070692_10006860
431 Ga0070692_10014032
432 Ga0070692_10081633
433 Ga0070668_100093680
434 Ga0070675_100003495
435 Ga0070671_100019757
436 Ga0070688_100091051
437 Ga0070659_100006716
438 Ga0070659_100008827
439 Ga0070703_10005951
440 Ga0070709_10006128
441 Ga0070714_100170221
442 Ga0070714_100565137
443 Ga0070710_10088631
444 Ga0070701_10086106
445 Ga0070705_100070904
446 Ga0070705_100136642
447 Ga0070700_100051189
448 Ga0070694_100005105
449 Ga0070694_100048686
450 Ga0070694_100169895
451 Ga0070708_100081115
452 Ga0070708_100091909
453 Ga0070663_100002630
454 Ga0070663_100007392
455 Ga0070678_100003284
456 Ga0070662_100665829
457 Ga0070681_10029719
458 Ga0070681_10065994
459 Ga0070681_10101550
460 Ga0070681_10269928
461 Ga0070681_10531306
462 Ga0068867_100316394
463 Ga0070685_10046168
464 Ga0070706_100050038
465 Ga0070706_100089219
466 Ga0070706_100204917
467 Ga0070706_100541897
468 Ga0070706_100648555
469 Ga0070706_100659090
470 Ga0070707_100006843
471 Ga0070707_100015737
472 Ga0070707_100330331
473 Ga0070707_100395244
474 Ga0070707_101105951
475 Ga0070698_100000291
476 Ga0070698_100013997
477 Ga0070698_100015443
478 Ga0070698_100018003
479 Ga0070699_100037125
480 Ga0070699_100144796
481 Ga0070699_100373797
482 Ga0070699_100464189
483 Ga0070699_100831211
484 Ga0070679_100003619
485 Ga0070679_100044695
486 Ga0070679_100089525
487 Ga0070679_100123236
488 Ga0070679_100380310
489 Ga0070679_100641117
490 Ga0070684_100224705
491 Ga0070684_100370061
492 Ga0070697_100015514
493 Ga0070697_100015945
494 Ga0070697_100302319
495 Ga0068853_100185017
496 Ga0070686_100112761
497 Ga0070695_100392096
498 Ga0070696_100074062
499 Ga0070696_100328107
500 Ga0070693_100003635
501 Ga0070665_100235813
502 Ga0070704_100013615
503 Ga0070704_100451072
504 Ga0070704_100452759
505 Ga0070664_100122175
506 Ga0068857_100037676
507 Ga0068854_100195620
508 Ga0068854_100645039
509 Ga0068856_100008985
510 Ga0068856_100128076
511 Ga0070702_100072472
512 Ga0068852_100001501
513 Ga0068852_100448021
514 Ga0068859_100463646
515 Ga0068864_100017342
516 Ga0068861_100321531
517 Ga0068851_10031927
518 Ga0068870_10000117
519 Ga0068863_100022596
520 Ga0068858_100065326
521 Ga0068860_100123105
522 Ga0070717_10075158
523 Ga0070717_10117143
524 Ga0070717_10156071
525 Ga0070716_100199436
526 Ga0070716_100426072
527 Ga0097621_100035672
528 Ga0068871_100255754
529 Ga0075428_100056898
530 Ga0075431_100550683
531 Ga0075433_10041357
532 Ga0075433_10174664
533 Ga0075433_10337703
534 Ga0075434_100005145
535 Ga0075434_100292561
536 Ga0075434_100381472
537 Ga0075434_100480262
538 Ga0075429_100000405
539 Ga0075429_100441299
540 Ga0075436_100000577
541 Ga0075436_100015247
542 Ga0075436_100033899
543 Ga0097620_100463636
544 Ga0075435_100072369
545 Ga0075435_100125173
546 Ga0075435_100130163
547 Ga0075435_100679251
548 Ga0105240_10338972
549 Ga0111539_10096308
550 Ga0111539_10151126
551 Ga0105247_10005072
552 Ga0114129_10057185
553 Ga0114129_10098242
554 Ga0114129_10141715
555 Ga0114129_10156879
556 Ga0114129_10393099
557 Ga0114129_10762155
558 Ga0114129_10957911
559 Ga0105241_10008648
560 Ga0105241_10504051
561 Ga0105242_10361063
562 Ga0105242_10703760
563 Ga0105248_10122071
564 Ga0105248_10877431
565 Ga0105237_10050047
566 Ga0105238_10049670
567 Ga0105249_10366523
568 Ga0105246_10002923
569 Ga0157317_1002261
570 Ga0157347_1016689
571 Ga0157313_1004978
572 Ga0157373_10361751
573 Ga0157373_10388815
574 Ga0157371_10046401
575 Ga0157370_10024473
576 Ga0157369_10043274
577 Ga0157369_10176215
578 Ga0157369_10185670
579 Ga0157369_10289377
580 Ga0157374_10032947
581 Ga0163163_10080702
582 Ga0157380_10319221
583 Ga0182008_10152776
584 Ga0157377_10064863
585 Ga0157379_10020411
586 Ga0197907_10004069
587 Ga0206350_10092184
588 Ga0206353_10040890
589 Ga0206353_10274823
590 Ga0206353_10341238
591 Ga0206353_10507980
592 Ga0206353_10845098
593 Ga0224712_10016384
594 Ga0207426_1027351
595 Ga0207656_10005666
596 Ga0207713_1016617
597 Ga0207653_10000075
598 Ga0207692_10034515
599 Ga0207688_10041761
600 Ga0207680_10101889
601 Ga0207699_10005542
602 Ga0207645_10026757
603 Ga0207643_10004322
604 Ga0207705_10008688
605 Ga0207684_10000262
606 Ga0207684_10013294
607 Ga0207684_10022854
608 Ga0207684_10175551
609 Ga0207684_10643371
610 Ga0207684_10804581
611 Ga0207654_10036189
612 Ga0207707_10032359
613 Ga0207707_10041309
614 Ga0207671_10084126
615 Ga0207660_10011428
616 Ga0207660_10045426
617 Ga0207660_10060356
618 Ga0207660_10152791
619 Ga0207660_10191725
620 Ga0207662_10006904
621 Ga0207662_10037034
622 Ga0207657_10095913
623 Ga0207657_10143096
624 Ga0207649_10081655
625 Ga0207652_10003401
626 Ga0207652_10007622
627 Ga0207652_10114960
628 Ga0207646_10000014
629 Ga0207646_10001195
630 Ga0207646_10008477
631 Ga0207646_10013380
632 Ga0207646_10052143
633 Ga0207646_10432830
634 Ga0207694_10025126
635 Ga0207650_10008359
636 Ga0207659_10024927
637 Ga0207687_10008816
638 Ga0207700_10022164
639 Ga0207700_10446623
640 Ga0207664_10126232
641 Ga0207664_10159101
642 Ga0207644_10026061
643 Ga0207690_10003506
644 Ga0207690_10022445
645 Ga0207690_10081488
646 Ga0207690_10151789
647 Ga0207706_10659470
648 Ga0207686_10243824
649 Ga0207704_10077245
650 Ga0207704_10144718
651 Ga0207665_10109057
652 Ga0207691_10217559
653 Ga0207711_10064551
654 Ga0207689_10000247
655 Ga0207689_10167055
656 Ga0207661_10016839
657 Ga0207661_10103435
658 Ga0207661_10109392
659 Ga0207679_10003122
660 Ga0207679_10090122
661 Ga0207679_10408710
662 Ga0207667_10335686
663 Ga0207651_10085161
664 Ga0207651_10125082
665 Ga0207651_11055350
666 Ga0207712_10171274
667 Ga0207668_10006608
668 Ga0207668_10029057
669 Ga0207640_10301952
670 Ga0207658_10705965
671 Ga0207677_10093833
672 Ga0207677_10109906
673 Ga0207703_10206090
674 Ga0207639_10019223
675 Ga0207678_10000047
676 Ga0207678_10000642
677 Ga0207708_10068009
678 Ga0207708_10076339
679 Ga0207702_10004755
680 Ga0207641_10062179
681 Ga0207676_10005258
682 Ga0207674_10777540
683 Ga0207675_100273452
684 Ga0207675_100422785
685 Ga0207675_100729441
686 Ga0207683_10003277
687 Ga0207698_10037324
688 Ga0207428_10002607
689 Ga0268266_10201538
690 Ga0307515_10117407
691 Ga0307514_10022882
692 Ga0307507_10041772
693 Ga0373925_0754024
694 Ga0395899_0193345
695 Ga0451853_2341392
696 Ga0439448_0003020
697 Ga0439463_032674
698 Ga0439459_0006254
699 Ga0466972_0003734
700 Ga0466965_0024859
701 Ga0466961_0038560
702 Ga0466961_0046456
703 Ga0466961_0195303
704 Ga0466961_0214043
705 Ga0466961_0258601
706 Ga0466963_0003069
707 Ga0466963_0015331
708 Ga0466963_0171899
709 Ga0466963_0240479
710 Ga0466963_0276025
711 Ga0466963_0294125
712 Ga0466963_0558850
713 Ga0466964_0139282
714 Ga0466971_0082197
715 Ga0466971_0153079
716 Ga0466970_0043910
717 Ga0466970_0059570
718 Ga0466957_0004034
719 Ga0466957_0016323
720 Ga0466957_0175571
721 Ga0466957_0293152
722 Ga0466957_0374278
723 Ga0466960_0064608
724 Ga0466960_0080658
725 Ga0466960_0180337
726 Ga0466959_0375388
727 Ga0466958_0000255
728 Ga0466958_0114286
729 Ga0466967_0019278
730 Ga0466967_0034367
731 Ga0466967_0103979
732 Ga0466967_1337361
733 Ga0495629_0154819
734 Ga0495651_0004180
735 Ga0495608_0004084
736 Ga0495587_0009876
737 Ga0495645_0068781
738 Ga0495667_0006940
739 Ga0495657_0003615
740 Ga0495623_0365234
741 Ga0495600_0059668
742 Ga0495680_0039251
743 Ga0495675_0021853
744 Ga0495675_0042630
745 Ga0495602_0246183
746 Ga0496100_0133516
747 Ga0496100_0404850
748 Ga0496101_0042153
749 Ga0496104_0011108
750 Ga0496105_0004590
751 Ga0496106_0033505
752 Ga0496107_0014310
753 Ga0496108_0011686
754 Ga0496109_0014956
755 Ga0496110_0036738
756 Ga0496111_0000426
757 Ga0496112_0215309
758 Ga0496113_0016938
759 Ga0496115_0034452
760 Ga0501034_0749912
761 Ga0501036_0384361
762 Ga0501046_0582590
763 Ga0501047_0404007
764 Ga0501047_0449218
765 Ga0501068_0024211
766 Ga0501074_0329977
767 Ga0501080_0673876
768 Ga0501044_0164369
769 nmdc:mga05p37_1451514_c1
770 nmdc:mga05p37_145942_c1
771 nmdc:mga05p37_31494_c1
772 nmdc:mga05p37_32016_c1
773 nmdc:mga05p37_519146_c1
774 nmdc:mga05p37_878732_c1
775 nmdc:mga09592_3515_c1
776 nmdc:mga06r32_469366_c1
777 nmdc:mga08y16_43766_c1
778 nmdc:mga0n895_3834_c1
779 nmdc:mga0n895_586024_c1
780 nmdc:mga0n895_693814_c1
781 nmdc:mga0n895_81173_c1
782 nmdc:mga0rr50_310510_c1
783 nmdc:mga0rr50_5714_c1
784 nmdc:mga08x19_121776_c1
785 nmdc:mga08x19_18109_c1
786 nmdc:mga08x19_2946_c1
787 nmdc:mga0a205_10571_c1
788 nmdc:mga0a205_18968_c1
789 nmdc:mga0a205_190490_c1
790 Ga0495595_0015369
791 Ga0495619_0236220
792 Ga0466962_0027741
793 Ga0466962_0039036
794 Ga0466962_0054401
795 Ga0466962_0164401
796 2515852876
797 2676473234
798 2676489981
799 2827631832
800 2856742033
801 2884693878
802 2891401331
803 2891558328
804 2891566703
805 2895437846
806 2895448268
807 2917740545
808 2990093363
809 8003322251
810 8003322254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04299

FMN_bind_2

Putative FMN-binding domain

26

183

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8696 9 201
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8611 9 201
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.852 7 201
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.839 7 201
2fg9-assembly1.cif.gz_A crystal structure of a putative 5-nitroimidazole antibiotic resistance protein (bt_3078) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution 0.8317 6 167
ID Description Score Start End Superfamily
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8461 7 199 2.30.110.10
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8286 7 199 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8195 1 204 2.30.110.10
2furB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8008 9 169 2.30.110.10
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7887 6 169 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A543CCL9-F1-model_v4 PaiB family negative transcriptional regulator 0.9924 1 204
AF-A0A536PPA8-F1-model_v4 FMN-binding negative transcriptional regulator 0.9829 1 72
AF-A0A543CCL9-F1-model_v4 PaiB family negative transcriptional regulator 0.9733 1 204
AF-A0A536JKC6-F1-model_v4 FMN-binding negative transcriptional regulator 0.9713 1 204
AF-A0A2V9YNU7-F1-model_v4 Transcriptional regulator 0.9702 3 208

Map