F435667

General Info

Members Datasets Scaffolds Average Seq Length
404 168 808 202

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10320475|Ga0163163_103204752
Length 223
Sequence VIMTTPNTQLPTPSVQVPHSNEAVIEPLLEIRHRLAVACGAALLVAGVLLVTVILPAEYAIDPLGTGARLGLLQLGETGKQVAALEAGKGAAAGGVPILAPQETTFTQETVTFQLKPKEGMEYKYRLEKGESLLYSWSSSAPMNTEFHAEPDGAPRGYAQSYEKKDGMTGASGTLTAPFAGIHGWYWQNTTDQDQTVTLSSAGYYNLAHEFRTDQPVKNKNFK

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
137 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
138 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
154 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.5
Rhizosphere 99.5
Stem 0
Stem Tuber 0
Unclassified 16.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10320475 3300014325 Bacteria 1604
2 JGI24746J21847_1002544 3300001977 Bacteria 2895
3 Ga0065714_10085456 3300005288 Bacteria 2148
4 Ga0065712_10090686 3300005290 Bacteria 2399
5 Ga0065712_10124515 3300005290 Bacteria 1625
6 Ga0065715_10021739 3300005293 Bacteria 2218
7 Ga0065715_10105587 3300005293 Bacteria 2883
8 Ga0065715_10123434 3300005293 Bacteria 2178
9 Ga0065715_10143077 3300005293 Bacteria 1825
10 Ga0065715_10422002 3300005293 Unclassified 857
11 Ga0065707_10127500 3300005295 Bacteria 1982
12 Ga0065707_10146296 3300005295 Bacteria 1710
13 Ga0070676_10016023 3300005328 Bacteria 4139
14 Ga0070676_10501618 3300005328 Unclassified 862
15 Ga0070683_100191927 3300005329 Unclassified 1940
16 Ga0070683_100458196 3300005329 Bacteria 1217
17 Ga0070690_100083444 3300005330 Bacteria 2093
18 Ga0070690_100135501 3300005330 Bacteria 1667
19 Ga0070690_100301403 3300005330 Bacteria 1149
20 Ga0070690_100562367 3300005330 Bacteria 861
21 Ga0070670_100000414 3300005331 Bacteria 35226
22 Ga0070670_100123948 3300005331 Bacteria 2230
23 Ga0070670_100152999 3300005331 Bacteria 1997
24 Ga0070670_100192171 3300005331 Bacteria 1773
25 Ga0070670_100321486 3300005331 Unclassified 1356
26 Ga0070670_100444504 3300005331 Bacteria 1148
27 Ga0070670_100480186 3300005331 Bacteria 1104
28 Ga0070670_100976569 3300005331 Unclassified 770
29 Ga0070677_10002777 3300005333 Bacteria 5607
30 Ga0070677_10008271 3300005333 Bacteria 3496
31 Ga0070677_10020655 3300005333 Bacteria 2403
32 Ga0070677_10206803 3300005333 Bacteria 951
33 Ga0068869_100041576 3300005334 Bacteria 3293
34 Ga0068869_100139953 3300005334 Bacteria 1868
35 Ga0068869_100348571 3300005334 Bacteria 1206
36 Ga0068869_100391538 3300005334 Bacteria 1141
37 Ga0070666_10065179 3300005335 Bacteria 2472
38 Ga0070666_10087770 3300005335 Bacteria 2132
39 Ga0070666_10475401 3300005335 Unclassified 904
40 Ga0068868_100066560 3300005338 Bacteria 2864
41 Ga0068868_101119336 3300005338 Unclassified 725
42 Ga0070689_100074327 3300005340 Bacteria 2659
43 Ga0070689_100788368 3300005340 Bacteria 835
44 Ga0070687_100025806 3300005343 Bacteria 2823
45 Ga0070661_100388792 3300005344 Unclassified 1101
46 Ga0070668_100155103 3300005347 Bacteria 1854
47 Ga0070669_100266106 3300005353 Bacteria 1369
48 Ga0070669_100298623 3300005353 Bacteria 1295
49 Ga0070669_100315557 3300005353 Bacteria 1261
50 Ga0070675_100011669 3300005354 Bacteria 6886
51 Ga0070675_100097620 3300005354 Bacteria 2470
52 Ga0070671_100282325 3300005355 Bacteria 1412
53 Ga0070674_100000307 3300005356 Bacteria 24081
54 Ga0070674_100053112 3300005356 Bacteria 2796
55 Ga0070674_100320350 3300005356 Bacteria 1243
56 Ga0070674_100320754 3300005356 Bacteria 1242
57 Ga0070674_100619054 3300005356 Unclassified 917
58 Ga0070674_100998845 3300005356 Unclassified 734
59 Ga0070673_100052788 3300005364 Bacteria 3190
60 Ga0070673_100109016 3300005364 Bacteria 2293
61 Ga0070673_100381998 3300005364 Bacteria 1256
62 Ga0070673_100387525 3300005364 Bacteria 1247
63 Ga0070688_100026602 3300005365 Bacteria 3438
64 Ga0070688_100062506 3300005365 Bacteria 2357
65 Ga0070688_100129126 3300005365 Bacteria 1703
66 Ga0070667_100145769 3300005367 Bacteria 2076
67 Ga0070713_100061519 3300005436 Bacteria 3141
68 Ga0070701_10089961 3300005438 Bacteria 1680
69 Ga0070701_10155633 3300005438 Unclassified 1320
70 Ga0070701_10179327 3300005438 Bacteria 1239
71 Ga0070705_100037106 3300005440 Bacteria 2746
72 Ga0070705_100040722 3300005440 Unclassified 2644
73 Ga0070705_100535747 3300005440 Unclassified 895
74 Ga0070700_100061271 3300005441 Bacteria 2373
75 Ga0070700_100151160 3300005441 Bacteria 1588
76 Ga0070700_100166170 3300005441 Bacteria 1524
77 Ga0070700_100389981 3300005441 Bacteria 1044
78 Ga0070700_100719296 3300005441 Unclassified 796
79 Ga0070678_100060124 3300005456 Bacteria 2795
80 Ga0070678_100092217 3300005456 Bacteria 2327
81 Ga0070678_100471481 3300005456 Unclassified 1103
82 Ga0070678_101241563 3300005456 Bacteria 692
83 Ga0070662_100100615 3300005457 Bacteria 2187
84 Ga0070662_100144210 3300005457 Bacteria 1849
85 Ga0070662_100248351 3300005457 Bacteria 1429
86 Ga0070681_11114975 3300005458 Unclassified 710
87 Ga0068867_100082480 3300005459 Bacteria 2425
88 Ga0068867_100592834 3300005459 Bacteria 965
89 Ga0068867_100636182 3300005459 Bacteria 934
90 Ga0070685_10047284 3300005466 Bacteria 2474
91 Ga0070685_10139926 3300005466 Bacteria 1522
92 Ga0070685_10195706 3300005466 Bacteria 1311
93 Ga0070685_10238984 3300005466 Unclassified 1198
94 Ga0070698_100125320 3300005471 Bacteria 2526
95 Ga0070699_100012205 3300005518 Bacteria 7414
96 Ga0070684_100168398 3300005535 Bacteria 1989
97 Ga0070684_100300254 3300005535 Bacteria 1474
98 Ga0070672_100017965 3300005543 Bacteria 5102
99 Ga0070672_100065452 3300005543 Bacteria 2875
100 Ga0070672_100081162 3300005543 Bacteria 2599
101 Ga0070672_100087666 3300005543 Bacteria 2505
102 Ga0070672_100898974 3300005543 Unclassified 782
103 Ga0070686_100110811 3300005544 Unclassified 1869
104 Ga0070686_100331653 3300005544 Bacteria 1137
105 Ga0070695_100084942 3300005545 Bacteria 2101
106 Ga0070665_100228061 3300005548 Bacteria 1862
107 Ga0070665_100253435 3300005548 Bacteria 1761
108 Ga0070664_100106894 3300005564 Bacteria 2439
109 Ga0070664_100168210 3300005564 Bacteria 1943
110 Ga0070664_100226843 3300005564 Bacteria 1673
111 Ga0070664_100754637 3300005564 Unclassified 908
112 Ga0068857_100098317 3300005577 Bacteria 2625
113 Ga0068857_100455033 3300005577 Bacteria 1197
114 Ga0068857_100492029 3300005577 Bacteria 1150
115 Ga0068857_100888229 3300005577 Unclassified 854
116 Ga0068854_100453940 3300005578 Unclassified 1071
117 Ga0070702_100845279 3300005615 Unclassified 712
118 Ga0068852_100089937 3300005616 Bacteria 2745
119 Ga0068859_100044591 3300005617 Bacteria 4456
120 Ga0068859_100153849 3300005617 Bacteria 2376
121 Ga0068859_101649941 3300005617 Unclassified 708
122 Ga0068864_100009146 3300005618 Bacteria 8167
123 Ga0068864_100036824 3300005618 Bacteria 4172
124 Ga0068864_100687022 3300005618 Bacteria 999
125 Ga0068864_101198327 3300005618 Unclassified 758
126 Ga0068861_100029869 3300005719 Unclassified 3990
127 Ga0068861_100284278 3300005719 Bacteria 1426
128 Ga0068861_100315320 3300005719 Unclassified 1360
129 Ga0068861_100478355 3300005719 Bacteria 1122
130 Ga0068870_10011272 3300005840 Bacteria 4139
131 Ga0068870_10021711 3300005840 Bacteria 3145
132 Ga0068870_10083966 3300005840 Bacteria 1767
133 Ga0068870_10370896 3300005840 Unclassified 924
134 Ga0068870_10427836 3300005840 Archaea 868
135 Ga0068863_100268064 3300005841 Bacteria 1652
136 Ga0068858_100007655 3300005842 Bacteria 10433
137 Ga0068858_100060212 3300005842 Bacteria 3510
138 Ga0068858_100195650 3300005842 Bacteria 1911
139 Ga0068860_100085448 3300005843 Bacteria 3002
140 Ga0068860_100779275 3300005843 Unclassified 969
141 Ga0068862_100075385 3300005844 Bacteria 2918
142 Ga0068862_100108737 3300005844 Bacteria 2432
143 Ga0068862_100265330 3300005844 Unclassified 1569
144 Ga0068862_100397291 3300005844 Bacteria 1289
145 Ga0068862_100573591 3300005844 Unclassified 1080
146 Ga0081539_10002107 3300005985 Bacteria 29488
147 Ga0097621_100036000 3300006237 Bacteria 3957
148 Ga0097621_100040163 3300006237 Bacteria 3761
149 Ga0068871_100109445 3300006358 Bacteria 2323
150 Ga0068871_100174655 3300006358 Unclassified 1843
151 Ga0075428_100002383 3300006844 Bacteria 20400
152 Ga0075428_100014078 3300006844 Bacteria 8899
153 Ga0075428_100083719 3300006844 Bacteria 3480
154 Ga0075428_100098291 3300006844 Bacteria 3191
155 Ga0075430_100002972 3300006846 Bacteria 14196
156 Ga0075430_100011657 3300006846 Bacteria 7480
157 Ga0075430_100088586 3300006846 Bacteria 2590
158 Ga0075431_100052173 3300006847 Bacteria 4217
159 Ga0075431_100241302 3300006847 Bacteria 1838
160 Ga0075433_10000087 3300006852 Bacteria 42396
161 Ga0075433_10000414 3300006852 Bacteria 27216
162 Ga0075434_100000626 3300006871 Bacteria 27295
163 Ga0075434_100004452 3300006871 Bacteria 12629
164 Ga0075434_100014236 3300006871 Bacteria 7597
165 Ga0075434_101277364 3300006871 Unclassified 745
166 Ga0075434_101423722 3300006871 Bacteria 703
167 Ga0075429_100002180 3300006880 Bacteria 16360
168 Ga0075429_100028111 3300006880 Bacteria 4882
169 Ga0075429_100092196 3300006880 Bacteria 2642
170 Ga0075429_100286654 3300006880 Bacteria 1442
171 Ga0068865_100027284 3300006881 Bacteria 3771
172 Ga0068865_100422493 3300006881 Bacteria 1096
173 Ga0097620_100044588 3300006931 Bacteria 4456
174 Ga0097620_100153848 3300006931 Bacteria 2376
175 Ga0097620_101649980 3300006931 Unclassified 708
176 Ga0111539_10003286 3300009094 Bacteria 21366
177 Ga0111539_10073882 3300009094 Bacteria 4019
178 Ga0111539_10188589 3300009094 Bacteria 2407
179 Ga0111539_10562959 3300009094 Bacteria 1327
180 Ga0111539_10812599 3300009094 Bacteria 1088
181 Ga0105245_10152842 3300009098 Bacteria 2184
182 Ga0114129_10002019 3300009147 Bacteria 27820
183 Ga0114129_10118459 3300009147 Bacteria 3647
184 Ga0114129_10206381 3300009147 Bacteria 2658
185 Ga0105242_10423184 3300009176 Bacteria 1248
186 Ga0105248_10095051 3300009177 Bacteria 3356
187 Ga0105248_10230898 3300009177 Bacteria 2083
188 Ga0105248_10284712 3300009177 Bacteria 1861
189 Ga0105248_11033560 3300009177 Bacteria 928
190 Ga0105249_10169652 3300009553 Bacteria 2115
191 Ga0105249_10312096 3300009553 Bacteria 1581
192 Ga0105249_10332191 3300009553 Bacteria 1534
193 Ga0105249_10355578 3300009553 Bacteria 1485
194 Ga0157374_10227175 3300013296 Bacteria 1833
195 Ga0157374_11197229 3300013296 Unclassified 781
196 Ga0163162_10115623 3300013306 Bacteria 2783
197 Ga0163162_10380572 3300013306 Bacteria 1545
198 Ga0163162_10903086 3300013306 Bacteria 996
199 Ga0157372_11050630 3300013307 Bacteria 943
200 Ga0157375_10439600 3300013308 Bacteria 1470
201 Ga0157375_10713506 3300013308 Bacteria 1156
202 Ga0163163_10039858 3300014325 Bacteria 4586
203 Ga0163163_10260109 3300014325 Bacteria 1786
204 Ga0157380_10008003 3300014326 Bacteria 7528
205 Ga0157380_10069384 3300014326 Bacteria 2844
206 Ga0157380_10098032 3300014326 Bacteria 2434
207 Ga0157380_10138749 3300014326 Bacteria 2085
208 Ga0157380_10184308 3300014326 Bacteria 1837
209 Ga0157380_10321997 3300014326 Bacteria 1434
210 Ga0157380_10420419 3300014326 Bacteria 1275
211 Ga0157377_10032915 3300014745 Bacteria 2826
212 Ga0157379_10018407 3300014968 Bacteria 6158
213 Ga0157379_10029073 3300014968 Bacteria 4915
214 Ga0157379_10114046 3300014968 Bacteria 2429
215 Ga0157376_10591572 3300014969 Bacteria 1103
216 Ga0157376_10936474 3300014969 Bacteria 886
217 Ga0207697_10001016 3300025315 Bacteria 15709
218 Ga0207697_10023865 3300025315 Bacteria 2505
219 Ga0207682_10012235 3300025893 Bacteria 3350
220 Ga0207682_10013127 3300025893 Unclassified 3229
221 Ga0207682_10021575 3300025893 Bacteria 2534
222 Ga0207682_10021826 3300025893 Bacteria 2519
223 Ga0207688_10013888 3300025901 Bacteria 4377
224 Ga0207688_10059669 3300025901 Bacteria 2149
225 Ga0207680_10063163 3300025903 Bacteria 2265
226 Ga0207699_10126654 3300025906 Bacteria 1659
227 Ga0207645_10002884 3300025907 Bacteria 13296
228 Ga0207645_10152722 3300025907 Unclassified 1508
229 Ga0207643_10009275 3300025908 Bacteria 5287
230 Ga0207643_10014580 3300025908 Bacteria 4272
231 Ga0207643_10016665 3300025908 Bacteria 4008
232 Ga0207662_10005253 3300025918 Bacteria 6877
233 Ga0207662_10176020 3300025918 Bacteria 1375
234 Ga0207649_10461069 3300025920 Unclassified 961
235 Ga0207681_10017882 3300025923 Bacteria 4457
236 Ga0207681_10240648 3300025923 Bacteria 1408
237 Ga0207650_10029238 3300025925 Bacteria 3960
238 Ga0207650_10045638 3300025925 Unclassified 3224
239 Ga0207650_10129289 3300025925 Bacteria 1975
240 Ga0207650_10139892 3300025925 Bacteria 1902
241 Ga0207650_10249465 3300025925 Bacteria 1437
242 Ga0207650_10299642 3300025925 Bacteria 1313
243 Ga0207650_10678203 3300025925 Unclassified 870
244 Ga0207659_10015264 3300025926 Bacteria 4972
245 Ga0207659_10028748 3300025926 Bacteria 3781
246 Ga0207659_10081219 3300025926 Bacteria 2396
247 Ga0207659_10737034 3300025926 Bacteria 845
248 Ga0207644_10150440 3300025931 Bacteria 1801
249 Ga0207644_10219637 3300025931 Bacteria 1506
250 Ga0207644_10273325 3300025931 Bacteria 1355
251 Ga0207706_10008412 3300025933 Bacteria 9521
252 Ga0207706_10043975 3300025933 Bacteria 3958
253 Ga0207670_10012229 3300025936 Bacteria 5014
254 Ga0207670_10582722 3300025936 Bacteria 917
255 Ga0207669_10000231 3300025937 Bacteria 25543
256 Ga0207669_10017555 3300025937 Bacteria 3675
257 Ga0207669_10242140 3300025937 Bacteria 1338
258 Ga0207669_10517838 3300025937 Unclassified 957
259 Ga0207704_10039617 3300025938 Bacteria 2746
260 Ga0207704_10115506 3300025938 Unclassified 1824
261 Ga0207691_10007105 3300025940 Bacteria 10810
262 Ga0207691_10022802 3300025940 Bacteria 5901
263 Ga0207691_10025499 3300025940 Bacteria 5550
264 Ga0207691_10396958 3300025940 Bacteria 1176
265 Ga0207711_10143180 3300025941 Bacteria 2152
266 Ga0207689_10007752 3300025942 Bacteria 9396
267 Ga0207689_10025874 3300025942 Bacteria 4915
268 Ga0207689_10055891 3300025942 Bacteria 3247
269 Ga0207689_10471046 3300025942 Bacteria 1051
270 Ga0207661_10566738 3300025944 Unclassified 1041
271 Ga0207679_10028806 3300025945 Bacteria 3859
272 Ga0207679_10078022 3300025945 Bacteria 2522
273 Ga0207679_10151199 3300025945 Bacteria 1889
274 Ga0207679_10640558 3300025945 Bacteria 961
275 Ga0207651_10017816 3300025960 Bacteria 4207
276 Ga0207651_10103409 3300025960 Bacteria 2120
277 Ga0207651_10169339 3300025960 Bacteria 1721
278 Ga0207651_10264662 3300025960 Bacteria 1413
279 Ga0207651_10292172 3300025960 Bacteria 1352
280 Ga0207712_10032917 3300025961 Bacteria 3501
281 Ga0207712_10316141 3300025961 Bacteria 1287
282 Ga0207668_10076008 3300025972 Bacteria 2417
283 Ga0207668_10366960 3300025972 Bacteria 1208
284 Ga0207677_10244268 3300026023 Bacteria 1454
285 Ga0207703_10014387 3300026035 Bacteria 6169
286 Ga0207703_10191222 3300026035 Bacteria 1813
287 Ga0207703_10324325 3300026035 Bacteria 1411
288 Ga0207708_10006005 3300026075 Bacteria 8998
289 Ga0207708_10038269 3300026075 Bacteria 3654
290 Ga0207708_10192049 3300026075 Bacteria 1626
291 Ga0207641_10154987 3300026088 Bacteria 2078
292 Ga0207648_10285373 3300026089 Bacteria 1477
293 Ga0207648_10604342 3300026089 Bacteria 1011
294 Ga0207676_10014828 3300026095 Bacteria 5615
295 Ga0207676_10032474 3300026095 Bacteria 3934
296 Ga0207676_10044621 3300026095 Bacteria 3421
297 Ga0207676_11247415 3300026095 Bacteria 737
298 Ga0207674_10078319 3300026116 Bacteria 3310
299 Ga0207674_10112181 3300026116 Bacteria 2700
300 Ga0207674_10150906 3300026116 Bacteria 2281
301 Ga0207674_10556451 3300026116 Bacteria 1108
302 Ga0207674_11040081 3300026116 Unclassified 788
303 Ga0207675_100005425 3300026118 Bacteria 12217
304 Ga0207675_100189682 3300026118 Unclassified 1971
305 Ga0207675_100451812 3300026118 Bacteria 1273
306 Ga0207683_10091942 3300026121 Bacteria 2703
307 Ga0207683_10147040 3300026121 Bacteria 2126
308 Ga0207683_10626346 3300026121 Bacteria 996
309 Ga0207683_11254384 3300026121 Unclassified 686
310 Ga0207428_10013264 3300027907 Bacteria 7204
311 Ga0207428_10017976 3300027907 Bacteria 6055
312 Ga0207428_10034986 3300027907 Bacteria 4110
313 Ga0207428_10481774 3300027907 Unclassified 902
314 Ga0268266_10255022 3300028379 Bacteria 1624
315 Ga0268265_10189077 3300028380 Bacteria 1776
316 Ga0268265_10246083 3300028380 Bacteria 1581
317 Ga0268265_10704424 3300028380 Unclassified 976
318 Ga0268265_10719536 3300028380 Unclassified 966
319 Ga0268264_10160139 3300028381 Bacteria 2027
320 Ga0307405_10027230 3300031731 Bacteria 3311
321 Ga0307405_10072482 3300031731 Bacteria 2220
322 Ga0307413_10005418 3300031824 Bacteria 5695
323 Ga0307410_10004471 3300031852 Bacteria 7237
324 Ga0307410_10331564 3300031852 Bacteria 1210
325 Ga0307410_10611756 3300031852 Unclassified 910
326 Ga0307406_10306665 3300031901 Bacteria 1222
327 Ga0307412_10022865 3300031911 Bacteria 3839
328 Ga0307412_10093465 3300031911 Bacteria 2110
329 Ga0307409_100031378 3300031995 Bacteria 3834
330 Ga0307409_100091512 3300031995 Bacteria 2493
331 Ga0307416_100112629 3300032002 Bacteria 2401
332 Ga0307416_100187646 3300032002 Bacteria 1946
333 Ga0307416_100447257 3300032002 Bacteria 1344
334 Ga0307416_100458228 3300032002 Bacteria 1329
335 Ga0307416_101106963 3300032002 Unclassified 897
336 Ga0307411_10003340 3300032005 Bacteria 7429
337 Ga0307411_10525611 3300032005 Bacteria 1005
338 Ga0307415_100155266 3300032126 Bacteria 1766
339 Ga0373934_0151396 3300035086 Unclassified 950
340 Ga0373941_0031601 3300035115 Bacteria 1579
341 Ga0373943_0454290 3300035170 Unclassified 745
342 Ga0373955_0080126 3300035172 Bacteria 1844
343 Ga0373961_0076851 3300035241 Bacteria 1043
344 Ga0373931_0296466 3300035691 Bacteria 997
345 Ga0373935_0058484 3300035692 Bacteria 2463
346 Ga0373937_0054067 3300036401 Unclassified 3684
347 Ga0373925_0394084 3300037068 Unclassified 1129
348 Ga0439457_027773 3300042014 Bacteria 1253
349 Ga0450890_010407 3300042127 Unclassified 1197
350 Ga0450898_030162 3300042134 Bacteria 992
351 Ga0439446_0058524 3300042156 Bacteria 1162
352 Ga0439440_0037597 3300042993 Unclassified 1169
353 Ga0495603_0274862 3300046455 Unclassified 969
354 Ga0495629_0318494 3300046459 Bacteria 1063
355 Ga0495580_0104083 3300046472 Bacteria 1973
356 Ga0495628_0353521 3300046516 Bacteria 1080
357 Ga0495663_0069975 3300046525 Bacteria 1116
358 Ga0495663_0202396 3300046525 Unclassified 693
359 Ga0495652_0256893 3300046529 Bacteria 1292
360 Ga0495621_0041335 3300046539 Bacteria 1619
361 Ga0495633_0183177 3300046558 Unclassified 964
362 Ga0495613_0410015 3300046689 Bacteria 923
363 Ga0495624_0359929 3300046690 Bacteria 875
364 Ga0496101_0424790 3300048904 Unclassified 1048
365 Ga0496107_0407486 3300048910 Unclassified 1011
366 Ga0501298_042260 3300049521 Unclassified 927
367 Ga0501202_042363 3300049652 Bacteria 987
368 Ga0501235_040191 3300049669 Unclassified 1069
369 Ga0501259_024277 3300049688 Bacteria 1102
370 Ga0501283_002155 3300049779 Bacteria 2555
371 Ga0501045_0008240 3300049824 Bacteria 7258
372 nmdc:mga05p37_101137_c1 3300050507 Bacteria 3550
373 nmdc:mga05p37_112248_c1 3300050507 Bacteria 3352
374 nmdc:mga05p37_19453_c1 3300050507 Bacteria 8214
375 nmdc:mga05p37_86443_c1 3300050507 Bacteria 3865
376 nmdc:mga09592_224367_c1 3300050508 Bacteria 1628
377 nmdc:mga09592_2353_c1 3300050508 Bacteria 15266
378 nmdc:mga09592_45650_c1 3300050508 Bacteria 3691
379 nmdc:mga09592_45825_c1 3300050508 Bacteria 3683
380 nmdc:mga09592_54347_c2 3300050508 Bacteria 1880
381 nmdc:mga0qj67_29349_c1 3300050509 Bacteria 4273
382 nmdc:mga0qj67_305262_c1 3300050509 Bacteria 1289
383 nmdc:mga0qj67_42798_c1 3300050509 Bacteria 3565
384 nmdc:mga0qj67_465690_c1 3300050509 Bacteria 1017
385 nmdc:mga0qj67_68827_c1 3300050509 Bacteria 2822
386 nmdc:mga06r32_285941_c1 3300050510 Bacteria 1636
387 nmdc:mga06r32_41204_c1 3300050510 Bacteria 4386
388 nmdc:mga06r32_99163_c1 3300050510 Bacteria 2857
389 nmdc:mga08y16_134360_c2 3300050511 Bacteria 1084
390 nmdc:mga08y16_177952_c1 3300050511 Bacteria 2209
391 nmdc:mga08y16_1910_c1 3300050511 Bacteria 21237
392 nmdc:mga08y16_30872_c1 3300050511 Bacteria 5635
393 nmdc:mga08y16_556634_c1 3300050511 Unclassified 1160
394 nmdc:mga0n895_10008_c1 3300050512 Bacteria 8347
395 nmdc:mga0n895_1885455_c1 3300050512 Unclassified 557
396 nmdc:mga0n895_46370_c1 3300050512 Bacteria 4246
397 nmdc:mga0n895_83761_c1 3300050512 Bacteria 3181
398 nmdc:mga0rr50_341603_c1 3300050513 Unclassified 1258
399 nmdc:mga0rr50_3825_c1 3300050513 Bacteria 8739
400 nmdc:mga08x19_101722_c1 3300050514 Bacteria 1908
401 nmdc:mga0a205_11071_c1 3300050515 Bacteria 8299
402 nmdc:mga0a205_151_c1 3300050515 Bacteria 29511
403 nmdc:mga0a205_6986_c1 3300050515 Bacteria 10203
404 Ga0530510_0031917 3300061734 Bacteria 3788
405 Ga0163163_10320475
406 JGI24746J21847_1002544
407 Ga0065714_10085456
408 Ga0065712_10090686
409 Ga0065712_10124515
410 Ga0065715_10021739
411 Ga0065715_10105587
412 Ga0065715_10123434
413 Ga0065715_10143077
414 Ga0065715_10422002
415 Ga0065707_10127500
416 Ga0065707_10146296
417 Ga0070676_10016023
418 Ga0070676_10501618
419 Ga0070683_100191927
420 Ga0070683_100458196
421 Ga0070690_100083444
422 Ga0070690_100135501
423 Ga0070690_100301403
424 Ga0070690_100562367
425 Ga0070670_100000414
426 Ga0070670_100123948
427 Ga0070670_100152999
428 Ga0070670_100192171
429 Ga0070670_100321486
430 Ga0070670_100444504
431 Ga0070670_100480186
432 Ga0070670_100976569
433 Ga0070677_10002777
434 Ga0070677_10008271
435 Ga0070677_10020655
436 Ga0070677_10206803
437 Ga0068869_100041576
438 Ga0068869_100139953
439 Ga0068869_100348571
440 Ga0068869_100391538
441 Ga0070666_10065179
442 Ga0070666_10087770
443 Ga0070666_10475401
444 Ga0068868_100066560
445 Ga0068868_101119336
446 Ga0070689_100074327
447 Ga0070689_100788368
448 Ga0070687_100025806
449 Ga0070661_100388792
450 Ga0070668_100155103
451 Ga0070669_100266106
452 Ga0070669_100298623
453 Ga0070669_100315557
454 Ga0070675_100011669
455 Ga0070675_100097620
456 Ga0070671_100282325
457 Ga0070674_100000307
458 Ga0070674_100053112
459 Ga0070674_100320350
460 Ga0070674_100320754
461 Ga0070674_100619054
462 Ga0070674_100998845
463 Ga0070673_100052788
464 Ga0070673_100109016
465 Ga0070673_100381998
466 Ga0070673_100387525
467 Ga0070688_100026602
468 Ga0070688_100062506
469 Ga0070688_100129126
470 Ga0070667_100145769
471 Ga0070713_100061519
472 Ga0070701_10089961
473 Ga0070701_10155633
474 Ga0070701_10179327
475 Ga0070705_100037106
476 Ga0070705_100040722
477 Ga0070705_100535747
478 Ga0070700_100061271
479 Ga0070700_100151160
480 Ga0070700_100166170
481 Ga0070700_100389981
482 Ga0070700_100719296
483 Ga0070678_100060124
484 Ga0070678_100092217
485 Ga0070678_100471481
486 Ga0070678_101241563
487 Ga0070662_100100615
488 Ga0070662_100144210
489 Ga0070662_100248351
490 Ga0070681_11114975
491 Ga0068867_100082480
492 Ga0068867_100592834
493 Ga0068867_100636182
494 Ga0070685_10047284
495 Ga0070685_10139926
496 Ga0070685_10195706
497 Ga0070685_10238984
498 Ga0070698_100125320
499 Ga0070699_100012205
500 Ga0070684_100168398
501 Ga0070684_100300254
502 Ga0070672_100017965
503 Ga0070672_100065452
504 Ga0070672_100081162
505 Ga0070672_100087666
506 Ga0070672_100898974
507 Ga0070686_100110811
508 Ga0070686_100331653
509 Ga0070695_100084942
510 Ga0070665_100228061
511 Ga0070665_100253435
512 Ga0070664_100106894
513 Ga0070664_100168210
514 Ga0070664_100226843
515 Ga0070664_100754637
516 Ga0068857_100098317
517 Ga0068857_100455033
518 Ga0068857_100492029
519 Ga0068857_100888229
520 Ga0068854_100453940
521 Ga0070702_100845279
522 Ga0068852_100089937
523 Ga0068859_100044591
524 Ga0068859_100153849
525 Ga0068859_101649941
526 Ga0068864_100009146
527 Ga0068864_100036824
528 Ga0068864_100687022
529 Ga0068864_101198327
530 Ga0068861_100029869
531 Ga0068861_100284278
532 Ga0068861_100315320
533 Ga0068861_100478355
534 Ga0068870_10011272
535 Ga0068870_10021711
536 Ga0068870_10083966
537 Ga0068870_10370896
538 Ga0068870_10427836
539 Ga0068863_100268064
540 Ga0068858_100007655
541 Ga0068858_100060212
542 Ga0068858_100195650
543 Ga0068860_100085448
544 Ga0068860_100779275
545 Ga0068862_100075385
546 Ga0068862_100108737
547 Ga0068862_100265330
548 Ga0068862_100397291
549 Ga0068862_100573591
550 Ga0081539_10002107
551 Ga0097621_100036000
552 Ga0097621_100040163
553 Ga0068871_100109445
554 Ga0068871_100174655
555 Ga0075428_100002383
556 Ga0075428_100014078
557 Ga0075428_100083719
558 Ga0075428_100098291
559 Ga0075430_100002972
560 Ga0075430_100011657
561 Ga0075430_100088586
562 Ga0075431_100052173
563 Ga0075431_100241302
564 Ga0075433_10000087
565 Ga0075433_10000414
566 Ga0075434_100000626
567 Ga0075434_100004452
568 Ga0075434_100014236
569 Ga0075434_101277364
570 Ga0075434_101423722
571 Ga0075429_100002180
572 Ga0075429_100028111
573 Ga0075429_100092196
574 Ga0075429_100286654
575 Ga0068865_100027284
576 Ga0068865_100422493
577 Ga0097620_100044588
578 Ga0097620_100153848
579 Ga0097620_101649980
580 Ga0111539_10003286
581 Ga0111539_10073882
582 Ga0111539_10188589
583 Ga0111539_10562959
584 Ga0111539_10812599
585 Ga0105245_10152842
586 Ga0114129_10002019
587 Ga0114129_10118459
588 Ga0114129_10206381
589 Ga0105242_10423184
590 Ga0105248_10095051
591 Ga0105248_10230898
592 Ga0105248_10284712
593 Ga0105248_11033560
594 Ga0105249_10169652
595 Ga0105249_10312096
596 Ga0105249_10332191
597 Ga0105249_10355578
598 Ga0157374_10227175
599 Ga0157374_11197229
600 Ga0163162_10115623
601 Ga0163162_10380572
602 Ga0163162_10903086
603 Ga0157372_11050630
604 Ga0157375_10439600
605 Ga0157375_10713506
606 Ga0163163_10039858
607 Ga0163163_10260109
608 Ga0157380_10008003
609 Ga0157380_10069384
610 Ga0157380_10098032
611 Ga0157380_10138749
612 Ga0157380_10184308
613 Ga0157380_10321997
614 Ga0157380_10420419
615 Ga0157377_10032915
616 Ga0157379_10018407
617 Ga0157379_10029073
618 Ga0157379_10114046
619 Ga0157376_10591572
620 Ga0157376_10936474
621 Ga0207697_10001016
622 Ga0207697_10023865
623 Ga0207682_10012235
624 Ga0207682_10013127
625 Ga0207682_10021575
626 Ga0207682_10021826
627 Ga0207688_10013888
628 Ga0207688_10059669
629 Ga0207680_10063163
630 Ga0207699_10126654
631 Ga0207645_10002884
632 Ga0207645_10152722
633 Ga0207643_10009275
634 Ga0207643_10014580
635 Ga0207643_10016665
636 Ga0207662_10005253
637 Ga0207662_10176020
638 Ga0207649_10461069
639 Ga0207681_10017882
640 Ga0207681_10240648
641 Ga0207650_10029238
642 Ga0207650_10045638
643 Ga0207650_10129289
644 Ga0207650_10139892
645 Ga0207650_10249465
646 Ga0207650_10299642
647 Ga0207650_10678203
648 Ga0207659_10015264
649 Ga0207659_10028748
650 Ga0207659_10081219
651 Ga0207659_10737034
652 Ga0207644_10150440
653 Ga0207644_10219637
654 Ga0207644_10273325
655 Ga0207706_10008412
656 Ga0207706_10043975
657 Ga0207670_10012229
658 Ga0207670_10582722
659 Ga0207669_10000231
660 Ga0207669_10017555
661 Ga0207669_10242140
662 Ga0207669_10517838
663 Ga0207704_10039617
664 Ga0207704_10115506
665 Ga0207691_10007105
666 Ga0207691_10022802
667 Ga0207691_10025499
668 Ga0207691_10396958
669 Ga0207711_10143180
670 Ga0207689_10007752
671 Ga0207689_10025874
672 Ga0207689_10055891
673 Ga0207689_10471046
674 Ga0207661_10566738
675 Ga0207679_10028806
676 Ga0207679_10078022
677 Ga0207679_10151199
678 Ga0207679_10640558
679 Ga0207651_10017816
680 Ga0207651_10103409
681 Ga0207651_10169339
682 Ga0207651_10264662
683 Ga0207651_10292172
684 Ga0207712_10032917
685 Ga0207712_10316141
686 Ga0207668_10076008
687 Ga0207668_10366960
688 Ga0207677_10244268
689 Ga0207703_10014387
690 Ga0207703_10191222
691 Ga0207703_10324325
692 Ga0207708_10006005
693 Ga0207708_10038269
694 Ga0207708_10192049
695 Ga0207641_10154987
696 Ga0207648_10285373
697 Ga0207648_10604342
698 Ga0207676_10014828
699 Ga0207676_10032474
700 Ga0207676_10044621
701 Ga0207676_11247415
702 Ga0207674_10078319
703 Ga0207674_10112181
704 Ga0207674_10150906
705 Ga0207674_10556451
706 Ga0207674_11040081
707 Ga0207675_100005425
708 Ga0207675_100189682
709 Ga0207675_100451812
710 Ga0207683_10091942
711 Ga0207683_10147040
712 Ga0207683_10626346
713 Ga0207683_11254384
714 Ga0207428_10013264
715 Ga0207428_10017976
716 Ga0207428_10034986
717 Ga0207428_10481774
718 Ga0268266_10255022
719 Ga0268265_10189077
720 Ga0268265_10246083
721 Ga0268265_10704424
722 Ga0268265_10719536
723 Ga0268264_10160139
724 Ga0307405_10027230
725 Ga0307405_10072482
726 Ga0307413_10005418
727 Ga0307410_10004471
728 Ga0307410_10331564
729 Ga0307410_10611756
730 Ga0307406_10306665
731 Ga0307412_10022865
732 Ga0307412_10093465
733 Ga0307409_100031378
734 Ga0307409_100091512
735 Ga0307416_100112629
736 Ga0307416_100187646
737 Ga0307416_100447257
738 Ga0307416_100458228
739 Ga0307416_101106963
740 Ga0307411_10003340
741 Ga0307411_10525611
742 Ga0307415_100155266
743 Ga0373934_0151396
744 Ga0373941_0031601
745 Ga0373943_0454290
746 Ga0373955_0080126
747 Ga0373961_0076851
748 Ga0373931_0296466
749 Ga0373935_0058484
750 Ga0373937_0054067
751 Ga0373925_0394084
752 Ga0439457_027773
753 Ga0450890_010407
754 Ga0450898_030162
755 Ga0439446_0058524
756 Ga0439440_0037597
757 Ga0495603_0274862
758 Ga0495629_0318494
759 Ga0495580_0104083
760 Ga0495628_0353521
761 Ga0495663_0069975
762 Ga0495663_0202396
763 Ga0495652_0256893
764 Ga0495621_0041335
765 Ga0495633_0183177
766 Ga0495613_0410015
767 Ga0495624_0359929
768 Ga0496101_0424790
769 Ga0496107_0407486
770 Ga0501298_042260
771 Ga0501202_042363
772 Ga0501235_040191
773 Ga0501259_024277
774 Ga0501283_002155
775 Ga0501045_0008240
776 nmdc:mga05p37_101137_c1
777 nmdc:mga05p37_112248_c1
778 nmdc:mga05p37_19453_c1
779 nmdc:mga05p37_86443_c1
780 nmdc:mga09592_224367_c1
781 nmdc:mga09592_2353_c1
782 nmdc:mga09592_45650_c1
783 nmdc:mga09592_45825_c1
784 nmdc:mga09592_54347_c2
785 nmdc:mga0qj67_29349_c1
786 nmdc:mga0qj67_305262_c1
787 nmdc:mga0qj67_42798_c1
788 nmdc:mga0qj67_465690_c1
789 nmdc:mga0qj67_68827_c1
790 nmdc:mga06r32_285941_c1
791 nmdc:mga06r32_41204_c1
792 nmdc:mga06r32_99163_c1
793 nmdc:mga08y16_134360_c2
794 nmdc:mga08y16_177952_c1
795 nmdc:mga08y16_1910_c1
796 nmdc:mga08y16_30872_c1
797 nmdc:mga08y16_556634_c1
798 nmdc:mga0n895_10008_c1
799 nmdc:mga0n895_1885455_c1
800 nmdc:mga0n895_46370_c1
801 nmdc:mga0n895_83761_c1
802 nmdc:mga0rr50_341603_c1
803 nmdc:mga0rr50_3825_c1
804 nmdc:mga08x19_101722_c1
805 nmdc:mga0a205_11071_c1
806 nmdc:mga0a205_151_c1
807 nmdc:mga0a205_6986_c1
808 Ga0530510_0031917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azw-assembly1.cif.gz_B crystal structure of p24beta1 gold domain 0.8201 91 183
5azw-assembly1.cif.gz_B crystal structure of p24beta1 gold domain 0.8043 91 183
5gu5-assembly1.cif.gz_A crystal structure of p24gamma2 gold domain determined by sulfur-sad 0.7828 87 184
7rrm-assembly2.cif.gz_B-2 structure of the human tmed1 (p24gamma1) golgi dynamics domain 0.7689 85 184
1o6u-assembly3.cif.gz_E the crystal structure of human supernatant protein factor 0.7578 81 184
ID Description Score Start End Superfamily
af_A4I7U4_659_759_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.8512 87 183 2.60.120.680
af_A0A0R4IIH4_1374_1487_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.8295 90 182 2.60.120.680
af_Q8IDZ5_23_205_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8257 91 184 2.60.120.10
af_F1RAM9_28_205_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.8133 91 184 2.60.120.680
af_A4I7U4_659_759_2.60.120.680 Mainly Beta;Sandwich;Jelly Rolls;GOLD domain 0.8131 87 183 2.60.120.680
ID Description Score Start End GO Terms
AF-A0A317HMD4-F1-model_v4 Uncharacterized protein 0.9935 103 202
AF-A0A6B0YDA0-F1-model_v4 deleted 0.9695 102 202
AF-A0A349E7C7-F1-model_v4 Uncharacterized protein 0.9661 91 202
AF-A0A317HMD4-F1-model_v4 Uncharacterized protein 0.9647 103 202
AF-A0A7Y4SPD3-F1-model_v4 Uncharacterized protein 0.9567 77 202

Map