F435626

General Info

Members Datasets Scaffolds Average Seq Length
404 212 808 333

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10013625|Ga0081538_100136251
Length 357
Sequence VTGLVQQSPALTREWLDISQVGLLRLGYKASAEQFGPTQLLEFASLAENLGFDTVAVSDHFQPWRHHGGHAPASFPLLGAMGERLETARFGTSVLTPTMRYHPSVVAQAFATLGSLSPGRVFLGVGTGEAMNETPATALEWPGAKERRLRLAEAIELIRRLWTEERVSFEGDYYRTETATIYDRPEEPVPILVAAGAPLAAKLAGRVGDGFICTSGKRKELYDELLSAVEEGARAAERDPGTIERFIEVKVSYDQDLDRARNECGWWAALALSADEKSGIEDPLELERLADENIERAPSRFIVADDPDVCAERIAEYWRMGFSTLVFHAPGNDQPRFLKSFARDVMPRLRELASVAA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 18.32
Rhizosphere 81.19
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10013625 3300005981 Bacteria 6429
2 Ga0070658_10014741 3300005327 Bacteria 6269
3 Ga0070658_10056444 3300005327 Bacteria 3192
4 Ga0070683_100001589 3300005329 Bacteria 17580
5 Ga0070683_100003455 3300005329 Bacteria 12836
6 Ga0070683_100004135 3300005329 Bacteria 11891
7 Ga0070683_100020054 3300005329 Bacteria 5946
8 Ga0070683_100144696 3300005329 Bacteria 2252
9 Ga0070690_100253235 3300005330 Bacteria 1246
10 Ga0070680_100000987 3300005336 Bacteria 20189
11 Ga0070680_100011675 3300005336 Bacteria 6807
12 Ga0070680_100051083 3300005336 Bacteria 3373
13 Ga0070682_100025527 3300005337 Bacteria 3527
14 Ga0068868_100010910 3300005338 Bacteria 6595
15 Ga0068868_100019878 3300005338 Bacteria 5037
16 Ga0070660_100006318 3300005339 Bacteria 8207
17 Ga0070689_100216585 3300005340 Bacteria 1569
18 Ga0070687_100024672 3300005343 Bacteria 2875
19 Ga0070661_100299284 3300005344 Bacteria 1252
20 Ga0070659_100017804 3300005366 Bacteria 5352
21 Ga0070709_10094015 3300005434 Bacteria 1983
22 Ga0070713_100131479 3300005436 Bacteria 2208
23 Ga0070710_10032543 3300005437 Bacteria 2825
24 Ga0070710_10156524 3300005437 Unclassified 1409
25 Ga0070711_100012748 3300005439 Bacteria 5262
26 Ga0070711_100067732 3300005439 Bacteria 2506
27 Ga0070700_100004701 3300005441 Bacteria 7158
28 Ga0070700_100105565 3300005441 Bacteria 1863
29 Ga0070678_100052191 3300005456 Bacteria 2968
30 Ga0070662_100046286 3300005457 Bacteria 3126
31 Ga0070662_100202220 3300005457 Bacteria 1577
32 Ga0070681_10000665 3300005458 Bacteria 28410
33 Ga0070681_10060682 3300005458 Bacteria 3757
34 Ga0070681_10225265 3300005458 Bacteria 1790
35 Ga0070679_100000711 3300005530 Bacteria 28612
36 Ga0070679_100013131 3300005530 Bacteria 7929
37 Ga0070684_100000098 3300005535 Bacteria 56167
38 Ga0070684_100016941 3300005535 Bacteria 5970
39 Ga0070684_100022407 3300005535 Bacteria 5268
40 Ga0070684_100095543 3300005535 Bacteria 2648
41 Ga0070684_100103510 3300005535 Bacteria 2546
42 Ga0070684_100238115 3300005535 Bacteria 1662
43 Ga0070684_100436225 3300005535 Bacteria 1210
44 Ga0068853_100031105 3300005539 Bacteria 4513
45 Ga0068853_100041382 3300005539 Bacteria 3936
46 Ga0070672_100262826 3300005543 Bacteria 1456
47 Ga0070686_100085292 3300005544 Bacteria 2101
48 Ga0070693_100012383 3300005547 Bacteria 4315
49 Ga0070693_100146709 3300005547 Bacteria 1491
50 Ga0070665_100133235 3300005548 Bacteria 2487
51 Ga0068855_100055058 3300005563 Bacteria 4673
52 Ga0068855_100073163 3300005563 Bacteria 3982
53 Ga0068855_100578140 3300005563 Bacteria 1214
54 Ga0070664_100043709 3300005564 Bacteria 3781
55 Ga0068857_100359346 3300005577 Bacteria 1350
56 Ga0068854_100009669 3300005578 Bacteria 6229
57 Ga0068854_100071816 3300005578 Bacteria 2533
58 Ga0068856_100002813 3300005614 Bacteria 17816
59 Ga0068856_100004787 3300005614 Bacteria 13413
60 Ga0068856_100011484 3300005614 Bacteria 8598
61 Ga0068856_100046038 3300005614 Bacteria 4296
62 Ga0068856_100049301 3300005614 Bacteria 4151
63 Ga0068856_100130087 3300005614 Bacteria 2522
64 Ga0068852_100000923 3300005616 Bacteria 19445
65 Ga0068852_100034590 3300005616 Bacteria 4206
66 Ga0068852_100061497 3300005616 Bacteria 3264
67 Ga0068852_100142411 3300005616 Bacteria 2220
68 Ga0068852_100374272 3300005616 Bacteria 1396
69 Ga0068866_10063543 3300005718 Bacteria 1925
70 Ga0068861_100274528 3300005719 Bacteria 1449
71 Ga0068858_100083964 3300005842 Bacteria 2962
72 Ga0068860_100034240 3300005843 Bacteria 4871
73 Ga0081455_10032993 3300005937 Bacteria 4657
74 Ga0081538_10078469 3300005981 Bacteria 1772
75 Ga0070717_10025681 3300006028 Bacteria 4689
76 Ga0070717_10037637 3300006028 Bacteria 3929
77 Ga0070717_10180122 3300006028 Bacteria 1841
78 Ga0070717_10527295 3300006028 Bacteria 1069
79 Ga0070712_100026935 3300006175 Bacteria 3834
80 Ga0070712_100036605 3300006175 Bacteria 3341
81 Ga0070712_100138671 3300006175 Bacteria 1853
82 Ga0075428_100043957 3300006844 Bacteria 4911
83 Ga0075433_10163204 3300006852 Bacteria 1983
84 Ga0075434_100002516 3300006871 Bacteria 16163
85 Ga0075434_100011807 3300006871 Bacteria 8252
86 Ga0068865_100231435 3300006881 Bacteria 1450
87 Ga0075436_100046871 3300006914 Bacteria 2981
88 Ga0075435_100000778 3300007076 Bacteria 19802
89 Ga0075435_100073612 3300007076 Bacteria 2793
90 Ga0105240_10060184 3300009093 Bacteria 4735
91 Ga0105240_10420252 3300009093 Bacteria 1502
92 Ga0111539_10045745 3300009094 Bacteria 5238
93 Ga0111539_10167761 3300009094 Bacteria 2565
94 Ga0105245_10020566 3300009098 Bacteria 5788
95 Ga0105245_10021166 3300009098 Bacteria 5703
96 Ga0105245_10035914 3300009098 Bacteria 4400
97 Ga0105245_10048050 3300009098 Bacteria 3817
98 Ga0105245_10260533 3300009098 Bacteria 1687
99 Ga0105245_10373728 3300009098 Bacteria 1418
100 Ga0105247_10026124 3300009101 Bacteria 3525
101 Ga0105243_10187776 3300009148 Bacteria 1803
102 Ga0105242_10089692 3300009176 Bacteria 2585
103 Ga0105242_10096380 3300009176 Bacteria 2499
104 Ga0105248_10178410 3300009177 Bacteria 2394
105 Ga0105237_10091518 3300009545 Bacteria 3031
106 Ga0105238_10501928 3300009551 Bacteria 1214
107 Ga0105249_10088352 3300009553 Bacteria 2895
108 Ga0105239_10066619 3300010375 Bacteria 3956
109 Ga0105239_10165862 3300010375 Bacteria 2470
110 Ga0105239_10592561 3300010375 Unclassified 1264
111 Ga0105246_10213933 3300011119 Bacteria 1506
112 Ga0157370_10024796 3300013104 Bacteria 5938
113 Ga0157369_10003229 3300013105 Bacteria 19439
114 Ga0157369_10051278 3300013105 Bacteria 4465
115 Ga0157369_10107668 3300013105 Bacteria 2965
116 Ga0157369_10139732 3300013105 Bacteria 2563
117 Ga0157374_10046807 3300013296 Bacteria 4007
118 Ga0157374_10174946 3300013296 Bacteria 2095
119 Ga0157374_10404761 3300013296 Bacteria 1362
120 Ga0157378_10497239 3300013297 Bacteria 1217
121 Ga0163162_10020476 3300013306 Bacteria 6502
122 Ga0157372_10110584 3300013307 Bacteria 3148
123 Ga0157372_10154992 3300013307 Bacteria 2646
124 Ga0157372_10333006 3300013307 Bacteria 1768
125 Ga0157372_10388501 3300013307 Bacteria 1626
126 Ga0157375_10192232 3300013308 Bacteria 2196
127 Ga0163163_10008824 3300014325 Bacteria 8975
128 Ga0163163_10134113 3300014325 Bacteria 2516
129 Ga0157377_10007805 3300014745 Bacteria 5184
130 Ga0157379_10314595 3300014968 Bacteria 1429
131 Ga0163161_10327026 3300017792 Bacteria 1213
132 Ga0206353_10316042 3300020082 Bacteria 6167
133 Ga0206353_10860013 3300020082 Bacteria 8134
134 Ga0206353_11173225 3300020082 Bacteria 1711
135 Ga0207692_10106066 3300025898 Bacteria 1551
136 Ga0207692_10118268 3300025898 Bacteria 1480
137 Ga0207688_10008162 3300025901 Bacteria 5691
138 Ga0207688_10092707 3300025901 Bacteria 1736
139 Ga0207680_10098812 3300025903 Bacteria 1871
140 Ga0207705_10044240 3300025909 Bacteria 3200
141 Ga0207684_10356424 3300025910 Bacteria 1259
142 Ga0207707_10000989 3300025912 Bacteria 27328
143 Ga0207707_10006426 3300025912 Bacteria 10267
144 Ga0207707_10183279 3300025912 Bacteria 1827
145 Ga0207707_10268155 3300025912 Bacteria 1480
146 Ga0207695_10068481 3300025913 Bacteria 3637
147 Ga0207671_10041592 3300025914 Bacteria 3402
148 Ga0207693_10073827 3300025915 Bacteria 2671
149 Ga0207663_10067756 3300025916 Bacteria 2290
150 Ga0207663_10305733 3300025916 Bacteria 1190
151 Ga0207660_10001301 3300025917 Bacteria 16660
152 Ga0207660_10172016 3300025917 Bacteria 1677
153 Ga0207662_10008694 3300025918 Bacteria 5570
154 Ga0207657_10001341 3300025919 Bacteria 26174
155 Ga0207657_10004711 3300025919 Bacteria 14393
156 Ga0207649_10010709 3300025920 Bacteria 5042
157 Ga0207652_10001475 3300025921 Bacteria 20833
158 Ga0207652_10013484 3300025921 Bacteria 6612
159 Ga0207652_10068076 3300025921 Bacteria 3088
160 Ga0207694_10058808 3300025924 Bacteria 2990
161 Ga0207694_10111067 3300025924 Bacteria 2181
162 Ga0207659_10009037 3300025926 Bacteria 6214
163 Ga0207687_10000308 3300025927 Bacteria 33182
164 Ga0207687_10014171 3300025927 Bacteria 5215
165 Ga0207687_10030667 3300025927 Bacteria 3626
166 Ga0207687_10049332 3300025927 Bacteria 2927
167 Ga0207664_10012302 3300025929 Bacteria 6114
168 Ga0207664_10092759 3300025929 Bacteria 2479
169 Ga0207664_10153756 3300025929 Bacteria 1957
170 Ga0207690_10004701 3300025932 Bacteria 8062
171 Ga0207706_10012601 3300025933 Bacteria 7699
172 Ga0207686_10069836 3300025934 Bacteria 2255
173 Ga0207709_10125753 3300025935 Bacteria 1739
174 Ga0207670_10168607 3300025936 Bacteria 1640
175 Ga0207669_10109623 3300025937 Bacteria 1847
176 Ga0207704_10092216 3300025938 Bacteria 1993
177 Ga0207704_10126118 3300025938 Bacteria 1763
178 Ga0207661_10000200 3300025944 Bacteria 38832
179 Ga0207661_10004713 3300025944 Bacteria 9549
180 Ga0207661_10007479 3300025944 Bacteria 7772
181 Ga0207661_10012921 3300025944 Bacteria 6090
182 Ga0207661_10038048 3300025944 Bacteria 3768
183 Ga0207661_10052539 3300025944 Bacteria 3256
184 Ga0207679_10030728 3300025945 Bacteria 3754
185 Ga0207667_10061247 3300025949 Bacteria 3937
186 Ga0207651_10311240 3300025960 Bacteria 1313
187 Ga0207640_10157433 3300025981 Bacteria 1676
188 Ga0207677_10004549 3300026023 Bacteria 7459
189 Ga0207677_10040909 3300026023 Bacteria 3061
190 Ga0207703_10341044 3300026035 Bacteria 1377
191 Ga0207639_10082874 3300026041 Bacteria 2543
192 Ga0207639_10269266 3300026041 Bacteria 1493
193 Ga0207678_10095197 3300026067 Bacteria 2545
194 Ga0207678_10130280 3300026067 Bacteria 2145
195 Ga0207678_10255706 3300026067 Bacteria 1501
196 Ga0207702_10001821 3300026078 Bacteria 20975
197 Ga0207702_10010795 3300026078 Bacteria 7621
198 Ga0207702_10019057 3300026078 Bacteria 5679
199 Ga0207702_10053933 3300026078 Bacteria 3405
200 Ga0207702_10203483 3300026078 Bacteria 1836
201 Ga0207648_10184332 3300026089 Bacteria 1848
202 Ga0207676_10340271 3300026095 Bacteria 1384
203 Ga0207674_10006367 3300026116 Bacteria 13894
204 Ga0207674_10061744 3300026116 Bacteria 3785
205 Ga0207674_10423534 3300026116 Bacteria 1286
206 Ga0207675_100003658 3300026118 Bacteria 14990
207 Ga0207698_10028849 3300026142 Bacteria 3964
208 Ga0207698_10039225 3300026142 Bacteria 3507
209 Ga0207698_10172047 3300026142 Bacteria 1908
210 Ga0207698_10183593 3300026142 Bacteria 1856
211 Ga0207428_10126337 3300027907 Bacteria 1958
212 Ga0268266_10201048 3300028379 Bacteria 1824
213 Ga0265318_10019161 3300028577 Bacteria 2779
214 Ga0265338_10036838 3300028800 Bacteria 4672
215 Ga0265338_10091420 3300028800 Bacteria 2514
216 Ga0265762_1009020 3300030760 Bacteria 1777
217 Ga0307413_10247571 3300031824 Bacteria 1320
218 Ga0307406_10058862 3300031901 Bacteria 2471
219 Ga0307407_10065956 3300031903 Bacteria 2133
220 Ga0307416_100067628 3300032002 Bacteria 2948
221 Ga0307414_10025338 3300032004 Bacteria 3798
222 Ga0373923_0043548 3300035111 Bacteria 1858
223 Ga0373953_0060159 3300035117 Bacteria 1552
224 Ga0373943_0056198 3300035170 Bacteria 1952
225 Ga0373927_0031593 3300035695 Bacteria 3450
226 Ga0373937_0108705 3300036401 Bacteria 2578
227 Ga0373937_0124035 3300036401 Bacteria 2409
228 Ga0373925_0013269 3300037068 Bacteria 5963
229 Ga0395900_0335870 3300037418 Bacteria 1488
230 Ga0395898_0002226 3300037466 Bacteria 23614
231 Ga0451853_0660092 3300041512 Bacteria 1212
232 Ga0466963_0000667 3300044694 Bacteria 16603
233 Ga0466963_0001252 3300044694 Bacteria 13451
234 Ga0466963_0002874 3300044694 Bacteria 9728
235 Ga0466963_0009788 3300044694 Bacteria 5783
236 Ga0466963_0011218 3300044694 Bacteria 5454
237 Ga0466963_0022655 3300044694 Bacteria 3981
238 Ga0466963_0111212 3300044694 Bacteria 1881
239 Ga0466964_0070383 3300044706 Bacteria 1478
240 Ga0466971_0020601 3300044719 Bacteria 2932
241 Ga0466968_0071137 3300044735 Bacteria 1515
242 Ga0466968_0146235 3300044735 Bacteria 1084
243 Ga0466957_0016255 3300044842 Bacteria 4352
244 Ga0466958_0014167 3300045836 Bacteria 4551
245 Ga0466958_0041025 3300045836 Bacteria 2783
246 Ga0466958_0044818 3300045836 Bacteria 2666
247 Ga0466958_0058293 3300045836 Bacteria 2348
248 Ga0466967_0001662 3300045976 Bacteria 13178
249 Ga0466967_0004253 3300045976 Bacteria 9614
250 Ga0466967_0010088 3300045976 Bacteria 7061
251 Ga0466967_0015716 3300045976 Bacteria 5944
252 Ga0466967_0125499 3300045976 Bacteria 2377
253 Ga0466967_0182023 3300045976 Bacteria 1983
254 Ga0466967_0385553 3300045976 Bacteria 1361
255 Ga0466967_0646490 3300045976 Bacteria 1045
256 Ga0495603_0067811 3300046455 Bacteria 2099
257 Ga0495603_0224563 3300046455 Bacteria 1083
258 Ga0495629_0015767 3300046459 Bacteria 5427
259 Ga0495641_0070550 3300046461 Bacteria 1569
260 Ga0495653_0010001 3300046463 Bacteria 7760
261 Ga0495650_0000012 3300046471 Bacteria 613144
262 Ga0495582_0034906 3300046473 Bacteria 2764
263 Ga0495639_0055157 3300046475 Bacteria 1812
264 Ga0495594_0017376 3300046499 Bacteria 3800
265 Ga0495608_0005748 3300046511 Bacteria 8847
266 Ga0495618_0058972 3300046514 Bacteria 2432
267 Ga0495652_0250501 3300046529 Bacteria 1313
268 Ga0495586_0120257 3300046535 Bacteria 1467
269 Ga0495586_0171377 3300046535 Bacteria 1226
270 Ga0495645_0127783 3300046543 Bacteria 1785
271 Ga0495667_0049292 3300046559 Bacteria 2780
272 Ga0495634_0022324 3300046642 Bacteria 4460
273 Ga0495634_0066109 3300046642 Bacteria 2394
274 Ga0495588_0017550 3300046674 Bacteria 3479
275 Ga0495657_0225617 3300046675 Bacteria 1134
276 Ga0495623_0080179 3300046679 Bacteria 2021
277 Ga0495647_0003470 3300046681 Bacteria 5042
278 Ga0495647_0005354 3300046681 Bacteria 4203
279 Ga0495647_0054354 3300046681 Bacteria 1564
280 Ga0495613_0078838 3300046689 Bacteria 2395
281 Ga0495624_0055005 3300046690 Bacteria 2508
282 Ga0495581_0013272 3300047315 Bacteria 4776
283 Ga0495581_0030075 3300047315 Bacteria 3148
284 Ga0495674_0117870 3300047319 Bacteria 2245
285 Ga0495676_0177798 3300047321 Bacteria 1493
286 Ga0495675_0104839 3300047444 Bacteria 1767
287 Ga0495614_0010076 3300048089 Bacteria 4172
288 Ga0496100_0007417 3300048903 Bacteria 6050
289 Ga0496100_0007976 3300048903 Bacteria 5882
290 Ga0496100_0079857 3300048903 Bacteria 2205
291 Ga0496100_0181521 3300048903 Bacteria 1522
292 Ga0496101_0022023 3300048904 Bacteria 4383
293 Ga0496101_0033257 3300048904 Bacteria 3635
294 Ga0496101_0062945 3300048904 Bacteria 2699
295 Ga0496101_0137308 3300048904 Bacteria 1862
296 Ga0496101_0244154 3300048904 Bacteria 1398
297 Ga0496101_0259163 3300048904 Bacteria 1356
298 Ga0496102_0053887 3300048905 Bacteria 3666
299 Ga0496102_0063199 3300048905 Bacteria 3389
300 Ga0496102_0194853 3300048905 Bacteria 1909
301 Ga0496102_0209438 3300048905 Bacteria 1838
302 Ga0496102_0394768 3300048905 Bacteria 1301
303 Ga0496103_0008807 3300048906 Bacteria 5986
304 Ga0496104_0000750 3300048907 Bacteria 27736
305 Ga0496104_0022536 3300048907 Bacteria 5785
306 Ga0496104_0022891 3300048907 Bacteria 5740
307 Ga0496104_0126125 3300048907 Bacteria 2458
308 Ga0496104_0170602 3300048907 Bacteria 2086
309 Ga0496105_0000125 3300048908 Bacteria 51796
310 Ga0496105_0057240 3300048908 Bacteria 3219
311 Ga0496105_0090368 3300048908 Bacteria 2529
312 Ga0496105_0121839 3300048908 Bacteria 2150
313 Ga0496106_0016124 3300048909 Bacteria 5526
314 Ga0496106_0020160 3300048909 Bacteria 4946
315 Ga0496106_0063118 3300048909 Bacteria 2814
316 Ga0496106_0074488 3300048909 Bacteria 2599
317 Ga0496106_0304068 3300048909 Bacteria 1279
318 Ga0496107_0005293 3300048910 Bacteria 8814
319 Ga0496107_0055690 3300048910 Bacteria 2856
320 Ga0496107_0070235 3300048910 Bacteria 2542
321 Ga0496107_0102274 3300048910 Bacteria 2101
322 Ga0496107_0338976 3300048910 Bacteria 1119
323 Ga0496108_0007354 3300048911 Bacteria 8927
324 Ga0496108_0008225 3300048911 Bacteria 8466
325 Ga0496108_0012445 3300048911 Bacteria 6925
326 Ga0496108_0060149 3300048911 Bacteria 3196
327 Ga0496108_0191148 3300048911 Bacteria 1774
328 Ga0496109_0001529 3300048912 Bacteria 19241
329 Ga0496109_0001636 3300048912 Bacteria 18718
330 Ga0496109_0045929 3300048912 Bacteria 3965
331 Ga0496109_0101645 3300048912 Bacteria 2668
332 Ga0496109_0113843 3300048912 Bacteria 2516
333 Ga0496109_0164420 3300048912 Bacteria 2080
334 Ga0496109_0219560 3300048912 Bacteria 1788
335 Ga0496109_0370009 3300048912 Bacteria 1354
336 Ga0496110_0000772 3300048913 Bacteria 22233
337 Ga0496110_0001186 3300048913 Bacteria 18546
338 Ga0496110_0009094 3300048913 Bacteria 8017
339 Ga0496110_0009292 3300048913 Bacteria 7953
340 Ga0496110_0043650 3300048913 Bacteria 3915
341 Ga0496111_0000465 3300048914 Bacteria 20624
342 Ga0496111_0000589 3300048914 Bacteria 19074
343 Ga0496111_0004285 3300048914 Bacteria 8990
344 Ga0496111_0042039 3300048914 Bacteria 3281
345 Ga0496111_0048695 3300048914 Bacteria 3053
346 Ga0496111_0068321 3300048914 Bacteria 2582
347 Ga0496111_0154859 3300048914 Bacteria 1701
348 Ga0496112_0000154 3300048915 Bacteria 43098
349 Ga0496112_0022274 3300048915 Bacteria 6036
350 Ga0496112_0193057 3300048915 Bacteria 1997
351 Ga0496113_0000551 3300048916 Bacteria 18572
352 Ga0496113_0037323 3300048916 Bacteria 3564
353 Ga0496114_0005868 3300048917 Bacteria 9648
354 Ga0496114_0011328 3300048917 Bacteria 7123
355 Ga0496114_0026787 3300048917 Bacteria 4722
356 Ga0496114_0064796 3300048917 Bacteria 3061
357 Ga0496114_0065649 3300048917 Bacteria 3041
358 Ga0496115_0018880 3300048918 Bacteria 5301
359 Ga0496115_0050931 3300048918 Bacteria 3320
360 Ga0496115_0066834 3300048918 Bacteria 2906
361 Ga0496115_0069790 3300048918 Bacteria 2847
362 Ga0496122_0177754 3300048925 Bacteria 1274
363 Ga0501031_0069034 3300049568 Bacteria 2302
364 Ga0501033_0279250 3300049570 Bacteria 1179
365 Ga0501034_0032611 3300049571 Bacteria 5289
366 Ga0501039_0075044 3300049575 Bacteria 2628
367 Ga0501048_0094574 3300049582 Bacteria 2108
368 Ga0501067_0012350 3300049583 Bacteria 4736
369 Ga0501068_0042327 3300049584 Bacteria 2739
370 Ga0501070_0010610 3300049586 Bacteria 7787
371 Ga0501070_0144300 3300049586 Bacteria 1965
372 Ga0501071_0106394 3300049587 Bacteria 2071
373 Ga0501072_0001985 3300049588 Bacteria 15247
374 Ga0501072_0113361 3300049588 Bacteria 2159
375 Ga0501073_0043386 3300049589 Bacteria 3171
376 Ga0501074_0037545 3300049590 Bacteria 3511
377 Ga0501076_0199615 3300049592 Bacteria 1633
378 Ga0501077_0103289 3300049593 Bacteria 1806
379 Ga0501080_0266229 3300049742 Bacteria 1561
380 Ga0501080_0287514 3300049742 Bacteria 1493
381 Ga0501081_0024030 3300049743 Bacteria 4090
382 Ga0501081_0029662 3300049743 Bacteria 3698
383 Ga0501083_0003252 3300049744 Bacteria 11340
384 Ga0501035_0070917 3300049822 Bacteria 3086
385 Ga0501044_0071876 3300049823 Bacteria 3518
386 Ga0501045_0402200 3300049824 Bacteria 1019
387 nmdc:mga05p37_664153_c1 3300050507 Bacteria 1165
388 nmdc:mga08y16_170538_c1 3300050511 Bacteria 2260
389 nmdc:mga08y16_54873_c1 3300050511 Bacteria 4164
390 nmdc:mga0n895_109617_c1 3300050512 Bacteria 2776
391 nmdc:mga0n895_51883_c1 3300050512 Bacteria 4025
392 nmdc:mga0rr50_28539_c1 3300050513 Bacteria 3924
393 nmdc:mga0rr50_336745_c1 3300050513 Bacteria 1267
394 nmdc:mga0rr50_68763_c1 3300050513 Bacteria 2694
395 nmdc:mga08x19_343413_c1 3300050514 Bacteria 1041
396 nmdc:mga0a205_199022_c1 3300050515 Bacteria 1894
397 Ga0495601_0049005 3300053077 Bacteria 2662
398 Ga0495619_0014909 3300053085 Bacteria 4909
399 Ga0495619_0028161 3300053085 Bacteria 3623
400 Ga0501084_0213459 3300054114 Bacteria 1628
401 Ga0501082_0015744 3300060353 Bacteria 6504
402 Ga0501082_0121399 3300060353 Bacteria 2265
403 Ga0466962_0136540 3300061719 Bacteria 1187
404 Ga0530510_0093304 3300061734 Bacteria 2198
405 Ga0081538_10013625
406 Ga0070658_10014741
407 Ga0070658_10056444
408 Ga0070683_100001589
409 Ga0070683_100003455
410 Ga0070683_100004135
411 Ga0070683_100020054
412 Ga0070683_100144696
413 Ga0070690_100253235
414 Ga0070680_100000987
415 Ga0070680_100011675
416 Ga0070680_100051083
417 Ga0070682_100025527
418 Ga0068868_100010910
419 Ga0068868_100019878
420 Ga0070660_100006318
421 Ga0070689_100216585
422 Ga0070687_100024672
423 Ga0070661_100299284
424 Ga0070659_100017804
425 Ga0070709_10094015
426 Ga0070713_100131479
427 Ga0070710_10032543
428 Ga0070710_10156524
429 Ga0070711_100012748
430 Ga0070711_100067732
431 Ga0070700_100004701
432 Ga0070700_100105565
433 Ga0070678_100052191
434 Ga0070662_100046286
435 Ga0070662_100202220
436 Ga0070681_10000665
437 Ga0070681_10060682
438 Ga0070681_10225265
439 Ga0070679_100000711
440 Ga0070679_100013131
441 Ga0070684_100000098
442 Ga0070684_100016941
443 Ga0070684_100022407
444 Ga0070684_100095543
445 Ga0070684_100103510
446 Ga0070684_100238115
447 Ga0070684_100436225
448 Ga0068853_100031105
449 Ga0068853_100041382
450 Ga0070672_100262826
451 Ga0070686_100085292
452 Ga0070693_100012383
453 Ga0070693_100146709
454 Ga0070665_100133235
455 Ga0068855_100055058
456 Ga0068855_100073163
457 Ga0068855_100578140
458 Ga0070664_100043709
459 Ga0068857_100359346
460 Ga0068854_100009669
461 Ga0068854_100071816
462 Ga0068856_100002813
463 Ga0068856_100004787
464 Ga0068856_100011484
465 Ga0068856_100046038
466 Ga0068856_100049301
467 Ga0068856_100130087
468 Ga0068852_100000923
469 Ga0068852_100034590
470 Ga0068852_100061497
471 Ga0068852_100142411
472 Ga0068852_100374272
473 Ga0068866_10063543
474 Ga0068861_100274528
475 Ga0068858_100083964
476 Ga0068860_100034240
477 Ga0081455_10032993
478 Ga0081538_10078469
479 Ga0070717_10025681
480 Ga0070717_10037637
481 Ga0070717_10180122
482 Ga0070717_10527295
483 Ga0070712_100026935
484 Ga0070712_100036605
485 Ga0070712_100138671
486 Ga0075428_100043957
487 Ga0075433_10163204
488 Ga0075434_100002516
489 Ga0075434_100011807
490 Ga0068865_100231435
491 Ga0075436_100046871
492 Ga0075435_100000778
493 Ga0075435_100073612
494 Ga0105240_10060184
495 Ga0105240_10420252
496 Ga0111539_10045745
497 Ga0111539_10167761
498 Ga0105245_10020566
499 Ga0105245_10021166
500 Ga0105245_10035914
501 Ga0105245_10048050
502 Ga0105245_10260533
503 Ga0105245_10373728
504 Ga0105247_10026124
505 Ga0105243_10187776
506 Ga0105242_10089692
507 Ga0105242_10096380
508 Ga0105248_10178410
509 Ga0105237_10091518
510 Ga0105238_10501928
511 Ga0105249_10088352
512 Ga0105239_10066619
513 Ga0105239_10165862
514 Ga0105239_10592561
515 Ga0105246_10213933
516 Ga0157370_10024796
517 Ga0157369_10003229
518 Ga0157369_10051278
519 Ga0157369_10107668
520 Ga0157369_10139732
521 Ga0157374_10046807
522 Ga0157374_10174946
523 Ga0157374_10404761
524 Ga0157378_10497239
525 Ga0163162_10020476
526 Ga0157372_10110584
527 Ga0157372_10154992
528 Ga0157372_10333006
529 Ga0157372_10388501
530 Ga0157375_10192232
531 Ga0163163_10008824
532 Ga0163163_10134113
533 Ga0157377_10007805
534 Ga0157379_10314595
535 Ga0163161_10327026
536 Ga0206353_10316042
537 Ga0206353_10860013
538 Ga0206353_11173225
539 Ga0207692_10106066
540 Ga0207692_10118268
541 Ga0207688_10008162
542 Ga0207688_10092707
543 Ga0207680_10098812
544 Ga0207705_10044240
545 Ga0207684_10356424
546 Ga0207707_10000989
547 Ga0207707_10006426
548 Ga0207707_10183279
549 Ga0207707_10268155
550 Ga0207695_10068481
551 Ga0207671_10041592
552 Ga0207693_10073827
553 Ga0207663_10067756
554 Ga0207663_10305733
555 Ga0207660_10001301
556 Ga0207660_10172016
557 Ga0207662_10008694
558 Ga0207657_10001341
559 Ga0207657_10004711
560 Ga0207649_10010709
561 Ga0207652_10001475
562 Ga0207652_10013484
563 Ga0207652_10068076
564 Ga0207694_10058808
565 Ga0207694_10111067
566 Ga0207659_10009037
567 Ga0207687_10000308
568 Ga0207687_10014171
569 Ga0207687_10030667
570 Ga0207687_10049332
571 Ga0207664_10012302
572 Ga0207664_10092759
573 Ga0207664_10153756
574 Ga0207690_10004701
575 Ga0207706_10012601
576 Ga0207686_10069836
577 Ga0207709_10125753
578 Ga0207670_10168607
579 Ga0207669_10109623
580 Ga0207704_10092216
581 Ga0207704_10126118
582 Ga0207661_10000200
583 Ga0207661_10004713
584 Ga0207661_10007479
585 Ga0207661_10012921
586 Ga0207661_10038048
587 Ga0207661_10052539
588 Ga0207679_10030728
589 Ga0207667_10061247
590 Ga0207651_10311240
591 Ga0207640_10157433
592 Ga0207677_10004549
593 Ga0207677_10040909
594 Ga0207703_10341044
595 Ga0207639_10082874
596 Ga0207639_10269266
597 Ga0207678_10095197
598 Ga0207678_10130280
599 Ga0207678_10255706
600 Ga0207702_10001821
601 Ga0207702_10010795
602 Ga0207702_10019057
603 Ga0207702_10053933
604 Ga0207702_10203483
605 Ga0207648_10184332
606 Ga0207676_10340271
607 Ga0207674_10006367
608 Ga0207674_10061744
609 Ga0207674_10423534
610 Ga0207675_100003658
611 Ga0207698_10028849
612 Ga0207698_10039225
613 Ga0207698_10172047
614 Ga0207698_10183593
615 Ga0207428_10126337
616 Ga0268266_10201048
617 Ga0265318_10019161
618 Ga0265338_10036838
619 Ga0265338_10091420
620 Ga0265762_1009020
621 Ga0307413_10247571
622 Ga0307406_10058862
623 Ga0307407_10065956
624 Ga0307416_100067628
625 Ga0307414_10025338
626 Ga0373923_0043548
627 Ga0373953_0060159
628 Ga0373943_0056198
629 Ga0373927_0031593
630 Ga0373937_0108705
631 Ga0373937_0124035
632 Ga0373925_0013269
633 Ga0395900_0335870
634 Ga0395898_0002226
635 Ga0451853_0660092
636 Ga0466963_0000667
637 Ga0466963_0001252
638 Ga0466963_0002874
639 Ga0466963_0009788
640 Ga0466963_0011218
641 Ga0466963_0022655
642 Ga0466963_0111212
643 Ga0466964_0070383
644 Ga0466971_0020601
645 Ga0466968_0071137
646 Ga0466968_0146235
647 Ga0466957_0016255
648 Ga0466958_0014167
649 Ga0466958_0041025
650 Ga0466958_0044818
651 Ga0466958_0058293
652 Ga0466967_0001662
653 Ga0466967_0004253
654 Ga0466967_0010088
655 Ga0466967_0015716
656 Ga0466967_0125499
657 Ga0466967_0182023
658 Ga0466967_0385553
659 Ga0466967_0646490
660 Ga0495603_0067811
661 Ga0495603_0224563
662 Ga0495629_0015767
663 Ga0495641_0070550
664 Ga0495653_0010001
665 Ga0495650_0000012
666 Ga0495582_0034906
667 Ga0495639_0055157
668 Ga0495594_0017376
669 Ga0495608_0005748
670 Ga0495618_0058972
671 Ga0495652_0250501
672 Ga0495586_0120257
673 Ga0495586_0171377
674 Ga0495645_0127783
675 Ga0495667_0049292
676 Ga0495634_0022324
677 Ga0495634_0066109
678 Ga0495588_0017550
679 Ga0495657_0225617
680 Ga0495623_0080179
681 Ga0495647_0003470
682 Ga0495647_0005354
683 Ga0495647_0054354
684 Ga0495613_0078838
685 Ga0495624_0055005
686 Ga0495581_0013272
687 Ga0495581_0030075
688 Ga0495674_0117870
689 Ga0495676_0177798
690 Ga0495675_0104839
691 Ga0495614_0010076
692 Ga0496100_0007417
693 Ga0496100_0007976
694 Ga0496100_0079857
695 Ga0496100_0181521
696 Ga0496101_0022023
697 Ga0496101_0033257
698 Ga0496101_0062945
699 Ga0496101_0137308
700 Ga0496101_0244154
701 Ga0496101_0259163
702 Ga0496102_0053887
703 Ga0496102_0063199
704 Ga0496102_0194853
705 Ga0496102_0209438
706 Ga0496102_0394768
707 Ga0496103_0008807
708 Ga0496104_0000750
709 Ga0496104_0022536
710 Ga0496104_0022891
711 Ga0496104_0126125
712 Ga0496104_0170602
713 Ga0496105_0000125
714 Ga0496105_0057240
715 Ga0496105_0090368
716 Ga0496105_0121839
717 Ga0496106_0016124
718 Ga0496106_0020160
719 Ga0496106_0063118
720 Ga0496106_0074488
721 Ga0496106_0304068
722 Ga0496107_0005293
723 Ga0496107_0055690
724 Ga0496107_0070235
725 Ga0496107_0102274
726 Ga0496107_0338976
727 Ga0496108_0007354
728 Ga0496108_0008225
729 Ga0496108_0012445
730 Ga0496108_0060149
731 Ga0496108_0191148
732 Ga0496109_0001529
733 Ga0496109_0001636
734 Ga0496109_0045929
735 Ga0496109_0101645
736 Ga0496109_0113843
737 Ga0496109_0164420
738 Ga0496109_0219560
739 Ga0496109_0370009
740 Ga0496110_0000772
741 Ga0496110_0001186
742 Ga0496110_0009094
743 Ga0496110_0009292
744 Ga0496110_0043650
745 Ga0496111_0000465
746 Ga0496111_0000589
747 Ga0496111_0004285
748 Ga0496111_0042039
749 Ga0496111_0048695
750 Ga0496111_0068321
751 Ga0496111_0154859
752 Ga0496112_0000154
753 Ga0496112_0022274
754 Ga0496112_0193057
755 Ga0496113_0000551
756 Ga0496113_0037323
757 Ga0496114_0005868
758 Ga0496114_0011328
759 Ga0496114_0026787
760 Ga0496114_0064796
761 Ga0496114_0065649
762 Ga0496115_0018880
763 Ga0496115_0050931
764 Ga0496115_0066834
765 Ga0496115_0069790
766 Ga0496122_0177754
767 Ga0501031_0069034
768 Ga0501033_0279250
769 Ga0501034_0032611
770 Ga0501039_0075044
771 Ga0501048_0094574
772 Ga0501067_0012350
773 Ga0501068_0042327
774 Ga0501070_0010610
775 Ga0501070_0144300
776 Ga0501071_0106394
777 Ga0501072_0001985
778 Ga0501072_0113361
779 Ga0501073_0043386
780 Ga0501074_0037545
781 Ga0501076_0199615
782 Ga0501077_0103289
783 Ga0501080_0266229
784 Ga0501080_0287514
785 Ga0501081_0024030
786 Ga0501081_0029662
787 Ga0501083_0003252
788 Ga0501035_0070917
789 Ga0501044_0071876
790 Ga0501045_0402200
791 nmdc:mga05p37_664153_c1
792 nmdc:mga08y16_170538_c1
793 nmdc:mga08y16_54873_c1
794 nmdc:mga0n895_109617_c1
795 nmdc:mga0n895_51883_c1
796 nmdc:mga0rr50_28539_c1
797 nmdc:mga0rr50_336745_c1
798 nmdc:mga0rr50_68763_c1
799 nmdc:mga08x19_343413_c1
800 nmdc:mga0a205_199022_c1
801 Ga0495601_0049005
802 Ga0495619_0014909
803 Ga0495619_0028161
804 Ga0501084_0213459
805 Ga0501082_0015744
806 Ga0501082_0121399
807 Ga0466962_0136540
808 Ga0530510_0093304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

21

324

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9622 3 305
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9612 3 305
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.9572 1 306
5lxe-assembly1.cif.gz_A f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.9562 1 306
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.9562 2 305
ID Description Score Start End Superfamily
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9409 3 305 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.932 1 304 3.20.20.30
af_P96809_35_360_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9131 2 304 3.20.20.30
3b4yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8975 3 305 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8923 1 304 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A535BA59-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.972 2 197 GO:0016705
AF-A0A6I2FDQ1-F1-model_v4 Glucose-6-phosphate dehydrogenase (Coenzyme-F420) (EC 1.1.98.2) 0.9685 2 309 GO:0016705
GO:0052749
AF-A0A535BA59-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9671 2 197 GO:0016705
AF-A0A536ALB7-F1-model_v4 TIGR03557 family F420-dependent LLM class oxidoreductase (EC 1.-.-.-) 0.9664 2 267 GO:0016705
AF-A0A5R8NF28-F1-model_v4 F420-dependent glucose-6-phosphate dehydrogenase (FGD) (G6PD) (EC 1.1.98.2) 0.9637 1 307 GO:0005975
GO:0016705
GO:0052749
GO:0070967

Map