F435618

General Info

Members Datasets Scaffolds Average Seq Length
404 171 808 198

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100000415|Ga0070696_10000041517
Length 209
Sequence MHEHETPRRPSTSLGWRLAQTAILALVAAWLLSLVLVVVWERLDTGKPASAIVVLGAAQYDGKPSPVLRARVDHAIKLWRRGLAPKLIVTGGRGQGDTTTEAAVERRYALAHGIPDSAIFLEPESRSTSESLRNVAEMLTPETRDVILVSDPFHMLRLSILARRFGLRPRTSPTRTSPISANRAEFWRYTLHESWKAPVAFFFEFSDRH

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.98
Rhizosphere 98.02
Stem 0
Stem Tuber 0
Unclassified 20.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100000415 3300005546 Bacteria 26640
2 Ga0070658_10016258 3300005327 Bacteria 5953
3 Ga0070658_10027824 3300005327 Bacteria 4537
4 Ga0070658_10116366 3300005327 Bacteria 2218
5 Ga0070658_10139694 3300005327 Unclassified 2023
6 Ga0070658_10300061 3300005327 Bacteria 1370
7 Ga0070683_100000794 3300005329 Bacteria 23311
8 Ga0070683_100115343 3300005329 Bacteria 2536
9 Ga0070683_100279235 3300005329 Bacteria 1589
10 Ga0070683_100309907 3300005329 Bacteria 1502
11 Ga0070683_100660545 3300005329 Unclassified 1001
12 Ga0070670_100193639 3300005331 Bacteria 1766
13 Ga0070677_10318106 3300005333 Unclassified 796
14 Ga0070680_100001650 3300005336 Bacteria 16305
15 Ga0070680_100007966 3300005336 Bacteria 8088
16 Ga0070680_100013640 3300005336 Bacteria 6334
17 Ga0070680_100020401 3300005336 Bacteria 5260
18 Ga0070680_100027796 3300005336 Bacteria 4532
19 Ga0070680_100043744 3300005336 Bacteria 3638
20 Ga0070680_100047623 3300005336 Bacteria 3491
21 Ga0070680_100361677 3300005336 Bacteria 1234
22 Ga0070680_100441129 3300005336 Bacteria 1112
23 Ga0070682_100054091 3300005337 Bacteria 2517
24 Ga0070660_100003249 3300005339 Bacteria 11156
25 Ga0070660_100011769 3300005339 Bacteria 6230
26 Ga0070660_100135631 3300005339 Bacteria 1972
27 Ga0070660_100171948 3300005339 Unclassified 1750
28 Ga0070660_100365575 3300005339 Unclassified 1189
29 Ga0070691_10053336 3300005341 Bacteria 1934
30 Ga0070691_10067798 3300005341 Unclassified 1727
31 Ga0070661_100001557 3300005344 Bacteria 15952
32 Ga0070661_100026594 3300005344 Bacteria 4162
33 Ga0070661_100045344 3300005344 Unclassified 3214
34 Ga0070661_100074633 3300005344 Bacteria 2498
35 Ga0070661_100167398 3300005344 Bacteria 1668
36 Ga0070661_100517399 3300005344 Bacteria 957
37 Ga0070661_100757557 3300005344 Bacteria 794
38 Ga0070692_10656396 3300005345 Unclassified 701
39 Ga0070668_100010798 3300005347 Bacteria 6794
40 Ga0070671_100164675 3300005355 Bacteria 1875
41 Ga0070659_100001368 3300005366 Bacteria 17544
42 Ga0070659_100104409 3300005366 Bacteria 2283
43 Ga0070659_100262160 3300005366 Bacteria 1434
44 Ga0070667_100285106 3300005367 Bacteria 1484
45 Ga0070714_100006128 3300005435 Bacteria 9244
46 Ga0070714_100009451 3300005435 Bacteria 7666
47 Ga0070714_100009912 3300005435 Bacteria 7514
48 Ga0070714_100019756 3300005435 Bacteria 5494
49 Ga0070714_100136542 3300005435 Unclassified 2197
50 Ga0070713_100014249 3300005436 Bacteria 5895
51 Ga0070713_100034027 3300005436 Bacteria 4089
52 Ga0070711_100034912 3300005439 Bacteria 3358
53 Ga0070711_100036110 3300005439 Bacteria 3310
54 Ga0070711_100158636 3300005439 Archaea 1713
55 Ga0070708_100000019 3300005445 Bacteria 118191
56 Ga0070663_100040188 3300005455 Unclassified 3273
57 Ga0070663_100196029 3300005455 Bacteria 1574
58 Ga0070681_10001475 3300005458 Bacteria 20757
59 Ga0070681_10007006 3300005458 Bacteria 10972
60 Ga0070681_10011578 3300005458 Bacteria 8730
61 Ga0070681_10039000 3300005458 Bacteria 4763
62 Ga0070681_10075031 3300005458 Bacteria 3342
63 Ga0070681_10078150 3300005458 Bacteria 3266
64 Ga0070681_10120648 3300005458 Bacteria 2557
65 Ga0070681_10149243 3300005458 Bacteria 2265
66 Ga0070681_10209023 3300005458 Bacteria 1868
67 Ga0070681_10253123 3300005458 Bacteria 1673
68 Ga0070699_100001778 3300005518 Bacteria 19630
69 Ga0070679_100000080 3300005530 Bacteria 72275
70 Ga0070679_100001644 3300005530 Bacteria 20131
71 Ga0070679_100005218 3300005530 Bacteria 12024
72 Ga0070679_100009402 3300005530 Bacteria 9244
73 Ga0070679_100018954 3300005530 Bacteria 6682
74 Ga0070679_100068614 3300005530 Bacteria 3536
75 Ga0070679_100082579 3300005530 Bacteria 3203
76 Ga0070679_100093886 3300005530 Bacteria 2987
77 Ga0070679_100107636 3300005530 Bacteria 2773
78 Ga0070679_100287553 3300005530 Unclassified 1596
79 Ga0070679_100295815 3300005530 Unclassified 1570
80 Ga0070679_100518622 3300005530 Unclassified 1136
81 Ga0070684_100002359 3300005535 Bacteria 13923
82 Ga0070684_100005352 3300005535 Bacteria 9834
83 Ga0070684_100039774 3300005535 Bacteria 4046
84 Ga0070684_100061558 3300005535 Bacteria 3285
85 Ga0070684_100069132 3300005535 Bacteria 3105
86 Ga0070684_100197895 3300005535 Unclassified 1830
87 Ga0070684_100314585 3300005535 Bacteria 1438
88 Ga0070684_100490059 3300005535 Unclassified 1138
89 Ga0068853_100009314 3300005539 Bacteria 7919
90 Ga0068853_100028813 3300005539 Bacteria 4673
91 Ga0068853_100043635 3300005539 Bacteria 3836
92 Ga0068853_100086661 3300005539 Bacteria 2746
93 Ga0068853_100102882 3300005539 Bacteria 2528
94 Ga0068853_100363157 3300005539 Unclassified 1349
95 Ga0070696_100001346 3300005546 Bacteria 16031
96 Ga0070696_100561202 3300005546 Unclassified 916
97 Ga0068855_100013079 3300005563 Bacteria 10009
98 Ga0068855_100077753 3300005563 Bacteria 3850
99 Ga0068855_100263037 3300005563 Bacteria 1921
100 Ga0068855_100315227 3300005563 Unclassified 1730
101 Ga0068855_101224517 3300005563 Unclassified 780
102 Ga0068857_100047159 3300005577 Bacteria 3825
103 Ga0068854_100001864 3300005578 Bacteria 12845
104 Ga0068854_100912966 3300005578 Unclassified 772
105 Ga0068856_100049015 3300005614 Bacteria 4163
106 Ga0068856_100096515 3300005614 Bacteria 2944
107 Ga0068856_100225722 3300005614 Bacteria 1888
108 Ga0068856_100229541 3300005614 Bacteria 1871
109 Ga0068856_100244470 3300005614 Bacteria 1810
110 Ga0068856_100365358 3300005614 Bacteria 1462
111 Ga0068852_100001155 3300005616 Bacteria 17477
112 Ga0068852_100004613 3300005616 Bacteria 9763
113 Ga0068852_100039165 3300005616 Bacteria 3989
114 Ga0068852_100102158 3300005616 Bacteria 2590
115 Ga0068852_100141809 3300005616 Bacteria 2225
116 Ga0068864_100238416 3300005618 Bacteria 1685
117 Ga0068863_100778932 3300005841 Unclassified 953
118 Ga0070717_10074663 3300006028 Bacteria 2834
119 Ga0070716_100027586 3300006173 Bacteria 3052
120 Ga0070716_100520480 3300006173 Unclassified 881
121 Ga0070712_100069124 3300006175 Bacteria 2519
122 Ga0075430_100014265 3300006846 Bacteria 6775
123 Ga0075431_100019886 3300006847 Bacteria 6855
124 Ga0075431_100033717 3300006847 Bacteria 5276
125 Ga0075434_100004721 3300006871 Bacteria 12320
126 Ga0075429_100043710 3300006880 Bacteria 3898
127 Ga0075436_100229520 3300006914 Unclassified 1318
128 Ga0105240_10006034 3300009093 Bacteria 17913
129 Ga0105240_10029025 3300009093 Bacteria 7214
130 Ga0105240_10042983 3300009093 Bacteria 5755
131 Ga0105240_10138655 3300009093 Bacteria 2910
132 Ga0105240_10280006 3300009093 Bacteria 1916
133 Ga0105240_10312904 3300009093 Unclassified 1792
134 Ga0105245_10008745 3300009098 Bacteria 8830
135 Ga0105247_10264327 3300009101 Bacteria 1181
136 Ga0114129_11047181 3300009147 Bacteria 1025
137 Ga0105241_10226863 3300009174 Bacteria 1573
138 Ga0105241_10252348 3300009174 Bacteria 1496
139 Ga0105241_10629851 3300009174 Bacteria 972
140 Ga0105242_10086085 3300009176 Bacteria 2637
141 Ga0105248_10068630 3300009177 Unclassified 3980
142 Ga0105237_10878971 3300009545 Unclassified 903
143 Ga0105238_10019226 3300009551 Bacteria 6959
144 Ga0105238_10079579 3300009551 Unclassified 3267
145 Ga0105238_10475185 3300009551 Bacteria 1249
146 Ga0105238_10755854 3300009551 Unclassified 986
147 Ga0105249_10000009 3300009553 Bacteria 313866
148 Ga0105239_10676693 3300010375 Bacteria 1179
149 Ga0157373_10005237 3300013100 Bacteria 9734
150 Ga0157373_10008718 3300013100 Bacteria 7520
151 Ga0157373_10062430 3300013100 Bacteria 2639
152 Ga0157373_10087273 3300013100 Bacteria 2198
153 Ga0157373_10277411 3300013100 Unclassified 1187
154 Ga0157371_10021401 3300013102 Bacteria 4748
155 Ga0157370_10003684 3300013104 Bacteria 17901
156 Ga0157370_10004034 3300013104 Bacteria 17061
157 Ga0157370_10042196 3300013104 Unclassified 4398
158 Ga0157370_10123242 3300013104 Bacteria 2420
159 Ga0157370_10405026 3300013104 Bacteria 1255
160 Ga0157369_10004535 3300013105 Bacteria 16345
161 Ga0157369_10011361 3300013105 Bacteria 10113
162 Ga0157369_10015195 3300013105 Bacteria 8688
163 Ga0157369_10025542 3300013105 Bacteria 6557
164 Ga0157369_10114772 3300013105 Bacteria 2860
165 Ga0157372_10003112 3300013307 Bacteria 17887
166 Ga0157372_10006423 3300013307 Bacteria 12513
167 Ga0157372_10007420 3300013307 Bacteria 11661
168 Ga0157372_10008809 3300013307 Bacteria 10716
169 Ga0157372_10016540 3300013307 Bacteria 7916
170 Ga0157372_10017351 3300013307 Bacteria 7729
171 Ga0157372_10021795 3300013307 Bacteria 6925
172 Ga0157372_10062484 3300013307 Bacteria 4173
173 Ga0157372_10070438 3300013307 Unclassified 3934
174 Ga0157372_10415969 3300013307 Unclassified 1567
175 Ga0157372_10673973 3300013307 Bacteria 1204
176 Ga0157375_10654193 3300013308 Bacteria 1207
177 Ga0163163_10154524 3300014325 Bacteria 2338
178 Ga0163163_10187844 3300014325 Bacteria 2114
179 Ga0182008_10013843 3300014497 Bacteria 4236
180 Ga0157376_10014229 3300014969 Bacteria 5966
181 Ga0206354_10510431 3300020081 Bacteria 898
182 Ga0206353_10631420 3300020082 Bacteria 1268
183 Ga0206353_12034572 3300020082 Bacteria 1039
184 Ga0207699_10006399 3300025906 Bacteria 5698
185 Ga0207699_10049544 3300025906 Bacteria 2473
186 Ga0207699_10176205 3300025906 Unclassified 1434
187 Ga0207643_10199978 3300025908 Bacteria 1216
188 Ga0207705_10003493 3300025909 Bacteria 11962
189 Ga0207705_10004247 3300025909 Bacteria 10849
190 Ga0207705_10190348 3300025909 Bacteria 1551
191 Ga0207705_10202513 3300025909 Bacteria 1504
192 Ga0207705_10216229 3300025909 Unclassified 1454
193 Ga0207654_10200606 3300025911 Bacteria 1313
194 Ga0207707_10000145 3300025912 Bacteria 73692
195 Ga0207707_10002210 3300025912 Bacteria 17608
196 Ga0207707_10002379 3300025912 Bacteria 16954
197 Ga0207707_10002927 3300025912 Bacteria 15223
198 Ga0207707_10016230 3300025912 Bacteria 6497
199 Ga0207707_10027540 3300025912 Bacteria 4969
200 Ga0207707_10028947 3300025912 Bacteria 4841
201 Ga0207707_10147083 3300025912 Bacteria 2060
202 Ga0207707_10246796 3300025912 Unclassified 1551
203 Ga0207707_10450694 3300025912 Bacteria 1101
204 Ga0207707_10837718 3300025912 Bacteria 764
205 Ga0207695_10001133 3300025913 Bacteria 46228
206 Ga0207695_10002961 3300025913 Bacteria 24497
207 Ga0207695_10014963 3300025913 Bacteria 9157
208 Ga0207695_10026392 3300025913 Bacteria 6484
209 Ga0207695_10075032 3300025913 Bacteria 3442
210 Ga0207693_10038100 3300025915 Bacteria 3787
211 Ga0207663_10064548 3300025916 Bacteria 2337
212 Ga0207663_10067189 3300025916 Bacteria 2298
213 Ga0207663_10105246 3300025916 Unclassified 1904
214 Ga0207663_10192941 3300025916 Bacteria 1464
215 Ga0207663_10235837 3300025916 Bacteria 1339
216 Ga0207660_10000149 3300025917 Bacteria 42831
217 Ga0207660_10001539 3300025917 Bacteria 15442
218 Ga0207660_10013447 3300025917 Bacteria 5364
219 Ga0207660_10015557 3300025917 Bacteria 5023
220 Ga0207660_10030400 3300025917 Bacteria 3712
221 Ga0207660_10078441 3300025917 Unclassified 2420
222 Ga0207660_10134671 3300025917 Bacteria 1884
223 Ga0207660_10148738 3300025917 Bacteria 1798
224 Ga0207660_10224629 3300025917 Unclassified 1475
225 Ga0207660_10484787 3300025917 Unclassified 1002
226 Ga0207660_10908729 3300025917 Unclassified 718
227 Ga0207657_10001816 3300025919 Bacteria 23033
228 Ga0207657_10042098 3300025919 Unclassified 4032
229 Ga0207657_10290744 3300025919 Unclassified 1296
230 Ga0207657_10404377 3300025919 Unclassified 1074
231 Ga0207649_10013803 3300025920 Unclassified 4517
232 Ga0207649_10019931 3300025920 Unclassified 3839
233 Ga0207649_10063436 3300025920 Bacteria 2333
234 Ga0207649_10515495 3300025920 Bacteria 911
235 Ga0207652_10000424 3300025921 Bacteria 43863
236 Ga0207652_10001502 3300025921 Bacteria 20594
237 Ga0207652_10003663 3300025921 Bacteria 12646
238 Ga0207652_10004136 3300025921 Bacteria 11841
239 Ga0207652_10004734 3300025921 Bacteria 11033
240 Ga0207652_10008236 3300025921 Bacteria 8373
241 Ga0207652_10019155 3300025921 Bacteria 5624
242 Ga0207652_10087370 3300025921 Bacteria 2734
243 Ga0207652_10110241 3300025921 Bacteria 2440
244 Ga0207652_10209176 3300025921 Bacteria 1756
245 Ga0207652_10301419 3300025921 Bacteria 1446
246 Ga0207652_10967396 3300025921 Unclassified 749
247 Ga0207694_10002329 3300025924 Bacteria 15529
248 Ga0207694_10490786 3300025924 Bacteria 1028
249 Ga0207650_10170045 3300025925 Bacteria 1732
250 Ga0207700_10000678 3300025928 Bacteria 19808
251 Ga0207700_10111405 3300025928 Bacteria 2203
252 Ga0207664_10001961 3300025929 Bacteria 13556
253 Ga0207664_10025095 3300025929 Bacteria 4484
254 Ga0207664_10056768 3300025929 Bacteria 3110
255 Ga0207664_10123439 3300025929 Bacteria 2171
256 Ga0207664_10345387 3300025929 Bacteria 1316
257 Ga0207664_10460475 3300025929 Bacteria 1136
258 Ga0207644_10283846 3300025931 Unclassified 1330
259 Ga0207690_10019079 3300025932 Bacteria 4214
260 Ga0207690_10150217 3300025932 Bacteria 1726
261 Ga0207690_10441910 3300025932 Unclassified 1044
262 Ga0207686_10119634 3300025934 Bacteria 1790
263 Ga0207665_10066480 3300025939 Bacteria 2454
264 Ga0207711_10639728 3300025941 Unclassified 992
265 Ga0207661_10000439 3300025944 Bacteria 26816
266 Ga0207661_10002998 3300025944 Bacteria 11676
267 Ga0207661_10026239 3300025944 Bacteria 4436
268 Ga0207661_10078404 3300025944 Bacteria 2719
269 Ga0207661_10150039 3300025944 Bacteria 2014
270 Ga0207661_10591137 3300025944 Unclassified 1018
271 Ga0207661_10595242 3300025944 Unclassified 1015
272 Ga0207667_10013793 3300025949 Bacteria 9233
273 Ga0207667_10097561 3300025949 Bacteria 3033
274 Ga0207667_10157633 3300025949 Bacteria 2336
275 Ga0207667_10178805 3300025949 Bacteria 2179
276 Ga0207667_10615739 3300025949 Bacteria 1094
277 Ga0207712_10000080 3300025961 Bacteria 114486
278 Ga0207668_10012100 3300025972 Bacteria 5271
279 Ga0207640_10000130 3300025981 Bacteria 56556
280 Ga0207640_10016946 3300025981 Bacteria 4251
281 Ga0207639_10026725 3300026041 Bacteria 4195
282 Ga0207639_10065468 3300026041 Unclassified 2821
283 Ga0207639_10071836 3300026041 Bacteria 2708
284 Ga0207639_10323532 3300026041 Unclassified 1370
285 Ga0207639_11111213 3300026041 Unclassified 741
286 Ga0207678_10035715 3300026067 Bacteria 4327
287 Ga0207678_10044319 3300026067 Unclassified 3848
288 Ga0207678_10080964 3300026067 Bacteria 2779
289 Ga0207702_10029196 3300026078 Bacteria 4587
290 Ga0207702_10373394 3300026078 Bacteria 1370
291 Ga0207702_11096000 3300026078 Unclassified 790
292 Ga0207641_10595670 3300026088 Bacteria 1082
293 Ga0207674_10096857 3300026116 Bacteria 2935
294 Ga0207675_100736135 3300026118 Bacteria 997
295 Ga0207698_10006228 3300026142 Bacteria 7428
296 Ga0207698_10037093 3300026142 Unclassified 3586
297 Ga0207698_10098801 3300026142 Bacteria 2413
298 Ga0207698_10102243 3300026142 Bacteria 2378
299 Ga0207698_10162241 3300026142 Unclassified 1956
300 Ga0207698_11109588 3300026142 Unclassified 804
301 Ga0307408_100030142 3300031548 Bacteria 3765
302 Ga0307405_10006428 3300031731 Bacteria 5779
303 Ga0307405_10134952 3300031731 Bacteria 1712
304 Ga0307413_10009940 3300031824 Bacteria 4583
305 Ga0307413_10480517 3300031824 Bacteria 993
306 Ga0307410_10000736 3300031852 Bacteria 13706
307 Ga0307410_10883510 3300031852 Unclassified 765
308 Ga0307406_10008213 3300031901 Bacteria 5818
309 Ga0307407_10261814 3300031903 Unclassified 1190
310 Ga0307412_10020191 3300031911 Bacteria 4051
311 Ga0307409_100001540 3300031995 Bacteria 11444
312 Ga0307409_100056363 3300031995 Bacteria 3039
313 Ga0307416_100001033 3300032002 Bacteria 14788
314 Ga0307416_101374420 3300032002 Unclassified 812
315 Ga0307414_10091507 3300032004 Bacteria 2261
316 Ga0307415_100009805 3300032126 Bacteria 5392
317 Ga0373926_0014916 3300035083 Unclassified 2647
318 Ga0373943_0023374 3300035170 Bacteria 2874
319 Ga0373946_0028907 3300035171 Unclassified 2202
320 Ga0373935_0358966 3300035692 Bacteria 1040
321 Ga0373935_0905665 3300035692 Unclassified 653
322 Ga0373927_0065911 3300035695 Bacteria 2342
323 Ga0373927_0105703 3300035695 Unclassified 1833
324 Ga0373927_0214816 3300035695 Bacteria 1263
325 Ga0373947_0033308 3300035725 Bacteria 3041
326 Ga0373947_0040436 3300035725 Bacteria 2777
327 Ga0373937_0926823 3300036401 Unclassified 820
328 Ga0373925_0037055 3300037068 Bacteria 3599
329 Ga0373925_0070718 3300037068 Bacteria 2638
330 Ga0466966_0059083 3300044684 Bacteria 2422
331 Ga0466961_0521456 3300044693 Bacteria 717
332 Ga0466971_0130406 3300044719 Unclassified 1167
333 Ga0466959_0035991 3300045049 Bacteria 3658
334 Ga0451576_0067832 3300045051 Bacteria 3713
335 Ga0451576_0166182 3300045051 Bacteria 2303
336 Ga0466958_0043447 3300045836 Unclassified 2707
337 Ga0466958_0116574 3300045836 Bacteria 1669
338 Ga0466967_0420397 3300045976 Bacteria 1303
339 Ga0466967_0464086 3300045976 Unclassified 1239
340 Ga0495629_0016108 3300046459 Bacteria 5368
341 Ga0495580_0004965 3300046472 Bacteria 11112
342 Ga0495580_0045529 3300046472 Bacteria 3116
343 Ga0495594_0026394 3300046499 Bacteria 3125
344 Ga0495594_0032136 3300046499 Bacteria 2848
345 Ga0495594_0040658 3300046499 Unclassified 2545
346 Ga0495594_0048097 3300046499 Bacteria 2343
347 Ga0495666_0025981 3300046526 Bacteria 2890
348 Ga0495665_0012268 3300046531 Bacteria 4637
349 Ga0495665_0072965 3300046531 Unclassified 1807
350 Ga0495635_0177355 3300046663 Bacteria 1449
351 Ga0495647_0392817 3300046681 Bacteria 636
352 Ga0495658_0013209 3300046683 Unclassified 4202
353 Ga0495658_0117135 3300046683 Bacteria 1607
354 Ga0495581_0007292 3300047315 Bacteria 6398
355 Ga0495581_0061874 3300047315 Bacteria 2163
356 Ga0495581_0132769 3300047315 Bacteria 1451
357 Ga0495581_0340786 3300047315 Unclassified 875
358 Ga0495674_0203156 3300047319 Unclassified 1643
359 Ga0496101_0226237 3300048904 Unclassified 1453
360 Ga0496104_0823295 3300048907 Unclassified 834
361 Ga0496105_0228320 3300048908 Bacteria 1513
362 Ga0496108_0042004 3300048911 Bacteria 3816
363 Ga0496109_0621861 3300048912 Bacteria 1016
364 Ga0496112_0000919 3300048915 Bacteria 21274
365 Ga0496113_0135869 3300048916 Bacteria 1932
366 Ga0496114_0161180 3300048917 Unclassified 1950
367 Ga0501032_0037293 3300049569 Bacteria 3315
368 Ga0501034_0184174 3300049571 Unclassified 2052
369 Ga0501037_0031793 3300049573 Bacteria 3897
370 Ga0501038_0056915 3300049574 Bacteria 3358
371 Ga0501040_0039901 3300049576 Bacteria 3194
372 Ga0501040_0154182 3300049576 Bacteria 1622
373 Ga0501042_0008068 3300049578 Bacteria 6931
374 Ga0501043_0052210 3300049579 Bacteria 3212
375 Ga0501046_0719970 3300049580 Unclassified 702
376 Ga0501047_0003200 3300049581 Bacteria 15519
377 Ga0501048_0291372 3300049582 Unclassified 1161
378 Ga0501048_0391859 3300049582 Bacteria 992
379 Ga0501070_0014159 3300049586 Bacteria 6712
380 Ga0501072_0099458 3300049588 Bacteria 2312
381 Ga0501073_0047441 3300049589 Bacteria 3019
382 Ga0501074_0233480 3300049590 Bacteria 1309
383 Ga0501075_0150416 3300049591 Unclassified 1774
384 Ga0501076_0005829 3300049592 Bacteria 8886
385 Ga0501076_0025552 3300049592 Bacteria 4572
386 Ga0501079_0002609 3300049741 Bacteria 13100
387 Ga0501080_0032574 3300049742 Bacteria 4862
388 Ga0501080_0173880 3300049742 Bacteria 1985
389 Ga0501081_0048566 3300049743 Bacteria 2921
390 Ga0501268_022914 3300049765 Bacteria 1081
391 Ga0501035_0073171 3300049822 Bacteria 3032
392 Ga0501044_0319939 3300049823 Bacteria 1476
393 Ga0501045_0004349 3300049824 Bacteria 9765
394 nmdc:mga0qj67_28202_c1 3300050509 Bacteria 4357
395 nmdc:mga06r32_13755_c1 3300050510 Bacteria 7341
396 nmdc:mga06r32_269068_c1 3300050510 Bacteria 1692
397 nmdc:mga0n895_130001_c1 3300050512 Bacteria 2543
398 nmdc:mga0rr50_327770_c1 3300050513 Bacteria 1285
399 nmdc:mga08x19_110036_c1 3300050514 Bacteria 1837
400 Ga0501084_0073969 3300054114 Bacteria 2853
401 Ga0501084_0528964 3300054114 Bacteria 997
402 Ga0501082_0083027 3300060353 Bacteria 2764
403 Ga0466962_0475635 3300061719 Unclassified 631
404 Ga0530510_0295274 3300061734 Bacteria 1212
405 Ga0070696_100000415
406 Ga0070658_10016258
407 Ga0070658_10027824
408 Ga0070658_10116366
409 Ga0070658_10139694
410 Ga0070658_10300061
411 Ga0070683_100000794
412 Ga0070683_100115343
413 Ga0070683_100279235
414 Ga0070683_100309907
415 Ga0070683_100660545
416 Ga0070670_100193639
417 Ga0070677_10318106
418 Ga0070680_100001650
419 Ga0070680_100007966
420 Ga0070680_100013640
421 Ga0070680_100020401
422 Ga0070680_100027796
423 Ga0070680_100043744
424 Ga0070680_100047623
425 Ga0070680_100361677
426 Ga0070680_100441129
427 Ga0070682_100054091
428 Ga0070660_100003249
429 Ga0070660_100011769
430 Ga0070660_100135631
431 Ga0070660_100171948
432 Ga0070660_100365575
433 Ga0070691_10053336
434 Ga0070691_10067798
435 Ga0070661_100001557
436 Ga0070661_100026594
437 Ga0070661_100045344
438 Ga0070661_100074633
439 Ga0070661_100167398
440 Ga0070661_100517399
441 Ga0070661_100757557
442 Ga0070692_10656396
443 Ga0070668_100010798
444 Ga0070671_100164675
445 Ga0070659_100001368
446 Ga0070659_100104409
447 Ga0070659_100262160
448 Ga0070667_100285106
449 Ga0070714_100006128
450 Ga0070714_100009451
451 Ga0070714_100009912
452 Ga0070714_100019756
453 Ga0070714_100136542
454 Ga0070713_100014249
455 Ga0070713_100034027
456 Ga0070711_100034912
457 Ga0070711_100036110
458 Ga0070711_100158636
459 Ga0070708_100000019
460 Ga0070663_100040188
461 Ga0070663_100196029
462 Ga0070681_10001475
463 Ga0070681_10007006
464 Ga0070681_10011578
465 Ga0070681_10039000
466 Ga0070681_10075031
467 Ga0070681_10078150
468 Ga0070681_10120648
469 Ga0070681_10149243
470 Ga0070681_10209023
471 Ga0070681_10253123
472 Ga0070699_100001778
473 Ga0070679_100000080
474 Ga0070679_100001644
475 Ga0070679_100005218
476 Ga0070679_100009402
477 Ga0070679_100018954
478 Ga0070679_100068614
479 Ga0070679_100082579
480 Ga0070679_100093886
481 Ga0070679_100107636
482 Ga0070679_100287553
483 Ga0070679_100295815
484 Ga0070679_100518622
485 Ga0070684_100002359
486 Ga0070684_100005352
487 Ga0070684_100039774
488 Ga0070684_100061558
489 Ga0070684_100069132
490 Ga0070684_100197895
491 Ga0070684_100314585
492 Ga0070684_100490059
493 Ga0068853_100009314
494 Ga0068853_100028813
495 Ga0068853_100043635
496 Ga0068853_100086661
497 Ga0068853_100102882
498 Ga0068853_100363157
499 Ga0070696_100001346
500 Ga0070696_100561202
501 Ga0068855_100013079
502 Ga0068855_100077753
503 Ga0068855_100263037
504 Ga0068855_100315227
505 Ga0068855_101224517
506 Ga0068857_100047159
507 Ga0068854_100001864
508 Ga0068854_100912966
509 Ga0068856_100049015
510 Ga0068856_100096515
511 Ga0068856_100225722
512 Ga0068856_100229541
513 Ga0068856_100244470
514 Ga0068856_100365358
515 Ga0068852_100001155
516 Ga0068852_100004613
517 Ga0068852_100039165
518 Ga0068852_100102158
519 Ga0068852_100141809
520 Ga0068864_100238416
521 Ga0068863_100778932
522 Ga0070717_10074663
523 Ga0070716_100027586
524 Ga0070716_100520480
525 Ga0070712_100069124
526 Ga0075430_100014265
527 Ga0075431_100019886
528 Ga0075431_100033717
529 Ga0075434_100004721
530 Ga0075429_100043710
531 Ga0075436_100229520
532 Ga0105240_10006034
533 Ga0105240_10029025
534 Ga0105240_10042983
535 Ga0105240_10138655
536 Ga0105240_10280006
537 Ga0105240_10312904
538 Ga0105245_10008745
539 Ga0105247_10264327
540 Ga0114129_11047181
541 Ga0105241_10226863
542 Ga0105241_10252348
543 Ga0105241_10629851
544 Ga0105242_10086085
545 Ga0105248_10068630
546 Ga0105237_10878971
547 Ga0105238_10019226
548 Ga0105238_10079579
549 Ga0105238_10475185
550 Ga0105238_10755854
551 Ga0105249_10000009
552 Ga0105239_10676693
553 Ga0157373_10005237
554 Ga0157373_10008718
555 Ga0157373_10062430
556 Ga0157373_10087273
557 Ga0157373_10277411
558 Ga0157371_10021401
559 Ga0157370_10003684
560 Ga0157370_10004034
561 Ga0157370_10042196
562 Ga0157370_10123242
563 Ga0157370_10405026
564 Ga0157369_10004535
565 Ga0157369_10011361
566 Ga0157369_10015195
567 Ga0157369_10025542
568 Ga0157369_10114772
569 Ga0157372_10003112
570 Ga0157372_10006423
571 Ga0157372_10007420
572 Ga0157372_10008809
573 Ga0157372_10016540
574 Ga0157372_10017351
575 Ga0157372_10021795
576 Ga0157372_10062484
577 Ga0157372_10070438
578 Ga0157372_10415969
579 Ga0157372_10673973
580 Ga0157375_10654193
581 Ga0163163_10154524
582 Ga0163163_10187844
583 Ga0182008_10013843
584 Ga0157376_10014229
585 Ga0206354_10510431
586 Ga0206353_10631420
587 Ga0206353_12034572
588 Ga0207699_10006399
589 Ga0207699_10049544
590 Ga0207699_10176205
591 Ga0207643_10199978
592 Ga0207705_10003493
593 Ga0207705_10004247
594 Ga0207705_10190348
595 Ga0207705_10202513
596 Ga0207705_10216229
597 Ga0207654_10200606
598 Ga0207707_10000145
599 Ga0207707_10002210
600 Ga0207707_10002379
601 Ga0207707_10002927
602 Ga0207707_10016230
603 Ga0207707_10027540
604 Ga0207707_10028947
605 Ga0207707_10147083
606 Ga0207707_10246796
607 Ga0207707_10450694
608 Ga0207707_10837718
609 Ga0207695_10001133
610 Ga0207695_10002961
611 Ga0207695_10014963
612 Ga0207695_10026392
613 Ga0207695_10075032
614 Ga0207693_10038100
615 Ga0207663_10064548
616 Ga0207663_10067189
617 Ga0207663_10105246
618 Ga0207663_10192941
619 Ga0207663_10235837
620 Ga0207660_10000149
621 Ga0207660_10001539
622 Ga0207660_10013447
623 Ga0207660_10015557
624 Ga0207660_10030400
625 Ga0207660_10078441
626 Ga0207660_10134671
627 Ga0207660_10148738
628 Ga0207660_10224629
629 Ga0207660_10484787
630 Ga0207660_10908729
631 Ga0207657_10001816
632 Ga0207657_10042098
633 Ga0207657_10290744
634 Ga0207657_10404377
635 Ga0207649_10013803
636 Ga0207649_10019931
637 Ga0207649_10063436
638 Ga0207649_10515495
639 Ga0207652_10000424
640 Ga0207652_10001502
641 Ga0207652_10003663
642 Ga0207652_10004136
643 Ga0207652_10004734
644 Ga0207652_10008236
645 Ga0207652_10019155
646 Ga0207652_10087370
647 Ga0207652_10110241
648 Ga0207652_10209176
649 Ga0207652_10301419
650 Ga0207652_10967396
651 Ga0207694_10002329
652 Ga0207694_10490786
653 Ga0207650_10170045
654 Ga0207700_10000678
655 Ga0207700_10111405
656 Ga0207664_10001961
657 Ga0207664_10025095
658 Ga0207664_10056768
659 Ga0207664_10123439
660 Ga0207664_10345387
661 Ga0207664_10460475
662 Ga0207644_10283846
663 Ga0207690_10019079
664 Ga0207690_10150217
665 Ga0207690_10441910
666 Ga0207686_10119634
667 Ga0207665_10066480
668 Ga0207711_10639728
669 Ga0207661_10000439
670 Ga0207661_10002998
671 Ga0207661_10026239
672 Ga0207661_10078404
673 Ga0207661_10150039
674 Ga0207661_10591137
675 Ga0207661_10595242
676 Ga0207667_10013793
677 Ga0207667_10097561
678 Ga0207667_10157633
679 Ga0207667_10178805
680 Ga0207667_10615739
681 Ga0207712_10000080
682 Ga0207668_10012100
683 Ga0207640_10000130
684 Ga0207640_10016946
685 Ga0207639_10026725
686 Ga0207639_10065468
687 Ga0207639_10071836
688 Ga0207639_10323532
689 Ga0207639_11111213
690 Ga0207678_10035715
691 Ga0207678_10044319
692 Ga0207678_10080964
693 Ga0207702_10029196
694 Ga0207702_10373394
695 Ga0207702_11096000
696 Ga0207641_10595670
697 Ga0207674_10096857
698 Ga0207675_100736135
699 Ga0207698_10006228
700 Ga0207698_10037093
701 Ga0207698_10098801
702 Ga0207698_10102243
703 Ga0207698_10162241
704 Ga0207698_11109588
705 Ga0307408_100030142
706 Ga0307405_10006428
707 Ga0307405_10134952
708 Ga0307413_10009940
709 Ga0307413_10480517
710 Ga0307410_10000736
711 Ga0307410_10883510
712 Ga0307406_10008213
713 Ga0307407_10261814
714 Ga0307412_10020191
715 Ga0307409_100001540
716 Ga0307409_100056363
717 Ga0307416_100001033
718 Ga0307416_101374420
719 Ga0307414_10091507
720 Ga0307415_100009805
721 Ga0373926_0014916
722 Ga0373943_0023374
723 Ga0373946_0028907
724 Ga0373935_0358966
725 Ga0373935_0905665
726 Ga0373927_0065911
727 Ga0373927_0105703
728 Ga0373927_0214816
729 Ga0373947_0033308
730 Ga0373947_0040436
731 Ga0373937_0926823
732 Ga0373925_0037055
733 Ga0373925_0070718
734 Ga0466966_0059083
735 Ga0466961_0521456
736 Ga0466971_0130406
737 Ga0466959_0035991
738 Ga0451576_0067832
739 Ga0451576_0166182
740 Ga0466958_0043447
741 Ga0466958_0116574
742 Ga0466967_0420397
743 Ga0466967_0464086
744 Ga0495629_0016108
745 Ga0495580_0004965
746 Ga0495580_0045529
747 Ga0495594_0026394
748 Ga0495594_0032136
749 Ga0495594_0040658
750 Ga0495594_0048097
751 Ga0495666_0025981
752 Ga0495665_0012268
753 Ga0495665_0072965
754 Ga0495635_0177355
755 Ga0495647_0392817
756 Ga0495658_0013209
757 Ga0495658_0117135
758 Ga0495581_0007292
759 Ga0495581_0061874
760 Ga0495581_0132769
761 Ga0495581_0340786
762 Ga0495674_0203156
763 Ga0496101_0226237
764 Ga0496104_0823295
765 Ga0496105_0228320
766 Ga0496108_0042004
767 Ga0496109_0621861
768 Ga0496112_0000919
769 Ga0496113_0135869
770 Ga0496114_0161180
771 Ga0501032_0037293
772 Ga0501034_0184174
773 Ga0501037_0031793
774 Ga0501038_0056915
775 Ga0501040_0039901
776 Ga0501040_0154182
777 Ga0501042_0008068
778 Ga0501043_0052210
779 Ga0501046_0719970
780 Ga0501047_0003200
781 Ga0501048_0291372
782 Ga0501048_0391859
783 Ga0501070_0014159
784 Ga0501072_0099458
785 Ga0501073_0047441
786 Ga0501074_0233480
787 Ga0501075_0150416
788 Ga0501076_0005829
789 Ga0501076_0025552
790 Ga0501079_0002609
791 Ga0501080_0032574
792 Ga0501080_0173880
793 Ga0501081_0048566
794 Ga0501268_022914
795 Ga0501035_0073171
796 Ga0501044_0319939
797 Ga0501045_0004349
798 nmdc:mga0qj67_28202_c1
799 nmdc:mga06r32_13755_c1
800 nmdc:mga06r32_269068_c1
801 nmdc:mga0n895_130001_c1
802 nmdc:mga0rr50_327770_c1
803 nmdc:mga08x19_110036_c1
804 Ga0501084_0073969
805 Ga0501084_0528964
806 Ga0501082_0083027
807 Ga0466962_0475635
808 Ga0530510_0295274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02698

DUF218

DUF218 domain

50

196

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ca8-assembly2.cif.gz_B crystal structure of escherichia coli ydcf, an s-adenosyl-l-methionine utilizing enzyme 0.7282 24 166
4kt7-assembly1.cif.gz_B the crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritolsynthase from anaerococcus prevotii dsm 20548 0.6765 39 135
4pyq-assembly1.cif.gz_A humanized rat apo-comt in complex with a ureido-benzamidine 0.6264 41 159
6kua-assembly1.cif.gz_B crystal structure of the nicotinamidase sapnca from staphylococcus aureus 0.6234 40 163
8h50-assembly2.cif.gz_C-2 crystal structure of carboxyspermidine dehydrogenase from helicobacter pylori in space group c2221 0.6176 40 164
ID Description Score Start End Superfamily
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8986 33 159 3.40.50.620
af_Q54FL1_98_236_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8736 41 162 3.40.50.620
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8539 33 159 3.40.50.620
af_P0AB01_80_243_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.798 42 187 3.40.50.620
af_P0AFY2_46_199_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7969 41 197 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1Q7J895-F1-model_v4 DUF218 domain-containing protein 0.9864 8 197 GO:0005886
AF-A0A1Q6W7X8-F1-model_v4 DUF218 domain-containing protein 0.9859 4 197 GO:0005886
AF-A0A7Y5TLY8-F1-model_v4 YdcF family protein 0.9819 2 200 GO:0005886
AF-A0A1Q7J895-F1-model_v4 DUF218 domain-containing protein 0.9762 8 197 GO:0005886
AF-A0A7V8VUY3-F1-model_v4 YdcF family protein 0.9734 2 194 GO:0005886

Map