F435500

General Info

Members Datasets Scaffolds Average Seq Length
403 175 333 232

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0000022|Ga0495673_0000022_223326_224072
Length 248
Sequence VNFRSLINYFMGLSNVSERYFVTGTDTEVGKTVASSALLQAARMQGFMTAGYKPVASGSEMTAEGLRNSDALALQRNSTLPLAYEEVNPYTFAEPTSPHIISADEQRPIEFPVLSAGLKALEQQAEWVLVEGAGGWFTPLSDNQTFADWVQDEQLPVILVVGVKLGCINHAMLTAQAIQQAGLRFAGWIANDVVAPGKRHQEYLATLQRVLPAPFLGEIPWLAEGAEHAETGQYLDLSALHPATSSAR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
3 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
4 2547132181 Kosakonia sacchari SP1 Isolate Stem
5 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
6 2561511199 Enterobacter sp. R4-368 Isolate Nodule
7 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
8 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
9 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
10 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
11 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
12 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
13 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
14 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
15 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
16 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
17 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
18 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
19 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
20 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
21 2751185917 Enterobacter sp. HK169 Isolate Unclassified
22 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
23 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
24 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
25 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
26 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
27 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
28 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
29 2821118458 Enterobacter asburiae 609 Isolate Unclassified
30 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
31 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
32 2847085930 Erwinia persicina B64 Isolate Bulb
33 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
34 2876601092 Pantoea endophytica 596 Isolate Unclassified
35 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
36 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
37 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
38 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
39 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
40 2904504865 Serratia marcescens 1822 Isolate Unclassified
41 2919150387 Rahnella aceris 1817 Isolate Unclassified
42 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
43 2927143783 Rahnella sp. 2050 Isolate Unclassified
44 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
45 2932406140 Serratia sp. 2723 Isolate Rhizosphere
46 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
47 2937539931 Pantoea sp. LS15 Isolate Unclassified
48 2937967321 Serratia sp. YC16 Isolate Unclassified
49 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
50 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
51 2939577877 Serratia sp. 509 Isolate Rhizosphere
52 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
53 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
54 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
55 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
56 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
57 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
58 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
59 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
60 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
61 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
62 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
63 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
64 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
65 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
66 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
67 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
68 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
69 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
71 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
90 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
91 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
92 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
93 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
112 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
115 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
120 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
121 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 8004592986 Serratia sp. S119 Isolate Unclassified
164 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
165 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
166 8018221730 Enterobacter sp. CM29 Isolate Unclassified
167 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
168 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
169 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
170 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
171 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
172 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
173 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
174 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
175 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.63
Metatranscriptomes 0
Isolates 17.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.25
Endosphere 6.7
Nodule 4.47
Rhizoplane 4.96
Rhizosphere 46.9
Stem 0.25
Stem Tuber 0
Unclassified 36.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1636881 2162886007 Bacteria 7628
2 SwRhRL2b_contig_2400003 2162886007 Bacteria 2741
3 SwRhRL2b_contig_334081 2162886007 Bacteria 2527
4 SwRhRL2b_contig_608038 2162886007 Bacteria 3961
5 JGI25162J39368_1000003 3300002737 Bacteria 575218
6 JGI25163J39215_1000193 3300002771 Bacteria 23709
7 JGI25164J39214_1000014 3300002772 Bacteria 219691
8 JGI25152J39213_1000744 3300002773 Bacteria 16643
9 rootH2_10066337 3300003320 Bacteria 7381
10 rootL2_10278897 3300003322 Bacteria 1068
11 Ga0055538_1000005 3300003751 Bacteria 575218
12 Ga0055539_1000007 3300003752 Bacteria 575218
13 Ga0055533_1000009 3300003756 Bacteria 575218
14 Ga0055525_1000010 3300003759 Bacteria 575218
15 Ga0055541_1000005 3300003841 Bacteria 575218
16 Ga0058692_1001096 3300003856 Bacteria 10511
17 Ga0058692_1001098 3300003856 Bacteria 10507
18 Ga0058692_1007102 3300003856 Bacteria 3004
19 Ga0058692_1008149 3300003856 Bacteria 2716
20 Ga0065704_10000313 3300005289 Bacteria 61667
21 Ga0065704_10000426 3300005289 Bacteria 29816
22 Ga0065704_10000763 3300005289 Bacteria 34745
23 Ga0065704_10077548 3300005289 Bacteria 4675
24 Ga0065704_10212272 3300005289 Bacteria 1104
25 Ga0070659_100036515 3300005366 Bacteria 3831
26 Ga0070665_100000199 3300005548 Bacteria 105924
27 Ga0070665_100097064 3300005548 Bacteria 2952
28 Ga0068857_100000621 3300005577 Bacteria 26089
29 Ga0075364_10008285 3300006051 Bacteria 6209
30 Ga0075364_10085407 3300006051 Bacteria 2090
31 Ga0075364_10120841 3300006051 Bacteria 1753
32 Ga0079104_1000080 3300006946 Bacteria 140677
33 Ga0079104_1000087 3300006946 Bacteria 135647
34 Ga0079104_1000922 3300006946 Bacteria 23582
35 Ga0079104_1001070 3300006946 Bacteria 20622
36 Ga0079104_1001460 3300006946 Bacteria 15768
37 Ga0079104_1003427 3300006946 Bacteria 7384
38 Ga0079104_1004264 3300006946 Bacteria 6211
39 Ga0079104_1011698 3300006946 Bacteria 2804
40 Ga0105251_10000337 3300009011 Bacteria 47023
41 Ga0105251_10000374 3300009011 Bacteria 43851
42 Ga0105251_10000511 3300009011 Bacteria 36723
43 Ga0105251_10000642 3300009011 Bacteria 32113
44 Ga0105251_10015615 3300009011 Bacteria 4141
45 Ga0105251_10020571 3300009011 Bacteria 3464
46 Ga0105251_10075102 3300009011 Bacteria 1570
47 Ga0105244_10000006 3300009036 Bacteria 357997
48 Ga0105244_10000183 3300009036 Bacteria 63415
49 Ga0105244_10000221 3300009036 Bacteria 59112
50 Ga0105244_10001185 3300009036 Bacteria 21548
51 Ga0105244_10002054 3300009036 Bacteria 15517
52 Ga0105244_10003003 3300009036 Bacteria 12373
53 Ga0105244_10006403 3300009036 Bacteria 7637
54 Ga0105244_10008959 3300009036 Bacteria 6194
55 Ga0105244_10015189 3300009036 Bacteria 4422
56 Ga0105244_10024196 3300009036 Bacteria 3317
57 Ga0105244_10042481 3300009036 Bacteria 2350
58 Ga0105244_10069032 3300009036 Bacteria 1765
59 Ga0105244_10279945 3300009036 Bacteria 774
60 Ga0105250_10000003 3300009092 Bacteria 547770
61 Ga0105250_10000026 3300009092 Bacteria 213233
62 Ga0105250_10001511 3300009092 Bacteria 12560
63 Ga0105250_10011203 3300009092 Bacteria 3721
64 Ga0105250_10061728 3300009092 Bacteria 1507
65 Ga0105241_10000004 3300009174 Bacteria 803007
66 Ga0105246_10010727 3300011119 Bacteria 5678
67 Ga0105246_10016397 3300011119 Bacteria 4692
68 Ga0157373_10000335 3300013100 Bacteria 38199
69 Ga0157373_10007494 3300013100 Bacteria 8118
70 Ga0157373_10106781 3300013100 Bacteria 1968
71 Ga0157373_10528077 3300013100 Bacteria 854
72 Ga0157371_10000101 3300013102 Bacteria 129981
73 Ga0157371_10000459 3300013102 Bacteria 49971
74 Ga0157371_10000462 3300013102 Bacteria 49728
75 Ga0157371_10043132 3300013102 Bacteria 3214
76 Ga0157371_10049789 3300013102 Bacteria 2976
77 Ga0157370_10000963 3300013104 Bacteria 36517
78 Ga0157369_10002223 3300013105 Bacteria 23363
79 Ga0163162_10022134 3300013306 Bacteria 6265
80 Ga0157372_10073861 3300013307 Bacteria 3844
81 Ga0157372_10834037 3300013307 Bacteria 1070
82 Ga0182006_1000063 3300015261 Bacteria 154042
83 Ga0183366_1001 3300015679 Bacteria 2743932
84 Ga0183370_1001 3300015680 Bacteria 2743932
85 Ga0183369_1001 3300015685 Bacteria 2743932
86 Ga0183368_1001 3300015687 Bacteria 2743932
87 Ga0209760_100001 3300025207 Bacteria 348781
88 Ga0209784_100001 3300025224 Bacteria 3600592
89 Ga0209566_100001 3300025225 Bacteria 3600765
90 Ga0209674_100002 3300025226 Bacteria 3600592
91 Ga0209563_100008 3300025230 Bacteria 1554545
92 Ga0207427_100002 3300025231 Bacteria 1355321
93 Ga0209437_100007 3300025233 Bacteria 938377
94 Ga0207425_1015235 3300025245 Bacteria 1730
95 Ga0209677_100004 3300025253 Bacteria 1554545
96 Ga0209129_1000015 3300025258 Bacteria 487967
97 Ga0209233_1002042 3300025261 Bacteria 7648
98 Ga0207696_1000003 3300025711 Bacteria 860639
99 Ga0207696_1000004 3300025711 Bacteria 671626
100 Ga0207696_1000059 3300025711 Bacteria 245763
101 Ga0207696_1000312 3300025711 Bacteria 54441
102 Ga0207696_1002512 3300025711 Bacteria 8955
103 Ga0207696_1005276 3300025711 Bacteria 5384
104 Ga0207696_1030517 3300025711 Bacteria 1637
105 Ga0207655_1000001 3300025728 Bacteria 1866413
106 Ga0207655_1000011 3300025728 Bacteria 643321
107 Ga0207655_1000032 3300025728 Bacteria 391253
108 Ga0207655_1000149 3300025728 Bacteria 129937
109 Ga0207655_1000157 3300025728 Bacteria 124885
110 Ga0207655_1000260 3300025728 Bacteria 83214
111 Ga0207655_1000334 3300025728 Bacteria 68683
112 Ga0207655_1000370 3300025728 Bacteria 63426
113 Ga0207655_1013233 3300025728 Bacteria 4751
114 Ga0207713_1000005 3300025735 Bacteria 649958
115 Ga0207713_1000059 3300025735 Bacteria 214031
116 Ga0207713_1000316 3300025735 Bacteria 54767
117 Ga0207713_1001682 3300025735 Bacteria 17103
118 Ga0207713_1004677 3300025735 Bacteria 8829
119 Ga0207713_1016251 3300025735 Bacteria 3784
120 Ga0207713_1019515 3300025735 Bacteria 3312
121 Ga0207713_1021360 3300025735 Bacteria 3105
122 Ga0207713_1036401 3300025735 Bacteria 2111
123 Ga0207713_1037195 3300025735 Bacteria 2079
124 Ga0207654_10000006 3300025911 Bacteria 815027
125 Ga0207690_10065007 3300025932 Bacteria 2493
126 Ga0207709_10115666 3300025935 Bacteria 1802
127 Ga0207674_10002565 3300026116 Bacteria 22875
128 Ga0209281_1000008 3300027111 Bacteria 867470
129 Ga0209281_1000021 3300027111 Bacteria 541033
130 Ga0209281_1000101 3300027111 Bacteria 222707
131 Ga0209281_1000148 3300027111 Bacteria 168332
132 Ga0209281_1000201 3300027111 Bacteria 135580
133 Ga0209281_1000780 3300027111 Bacteria 30266
134 Ga0209281_1000799 3300027111 Bacteria 29348
135 Ga0209281_1002063 3300027111 Bacteria 9042
136 Ga0209281_1002420 3300027111 Bacteria 7539
137 Ga0209371_1000001 3300027312 Bacteria 2771503
138 Ga0209371_1000056 3300027312 Bacteria 242255
139 Ga0209371_1000677 3300027312 Bacteria 29460
140 Ga0209371_1001103 3300027312 Bacteria 20030
141 Ga0209371_1003972 3300027312 Bacteria 6754
142 Ga0209371_1006468 3300027312 Bacteria 4333
143 Ga0209371_1008166 3300027312 Bacteria 3523
144 Ga0268266_10000571 3300028379 Bacteria 50834
145 Ga0268256_1000001 3300030500 Bacteria 2771065
146 Ga0268256_1000003 3300030500 Bacteria 1289401
147 Ga0268256_1000071 3300030500 Bacteria 187591
148 Ga0268256_1000494 3300030500 Bacteria 33549
149 Ga0268256_1000939 3300030500 Bacteria 20030
150 Ga0268256_1003972 3300030500 Bacteria 6370
151 Ga0268256_1005748 3300030500 Bacteria 4777
152 Ga0268256_1007015 3300030500 Bacteria 4091
153 Ga0439438_000001 3300041405 Bacteria 1263568
154 Ga0439438_000584 3300041405 Bacteria 16565
155 Ga0451853_2037034 3300041512 Bacteria 9919
156 Ga0439432_003664 3300042006 Bacteria 5681
157 Ga0439432_018485 3300042006 Bacteria 2328
158 Ga0439432_021264 3300042006 Bacteria 2153
159 Ga0439452_000003 3300042010 Bacteria 942815
160 Ga0439452_000029 3300042010 Bacteria 197977
161 Ga0439452_000030 3300042010 Bacteria 197288
162 Ga0439452_000220 3300042010 Bacteria 40289
163 Ga0450902_002113 3300042137 Bacteria 2793
164 Ga0466981_0000023 3300044669 Bacteria 78984
165 Ga0495617_010457 3300046452 Bacteria 3179
166 Ga0495627_020120 3300046453 Bacteria 2228
167 Ga0495591_000080 3300046458 Bacteria 107876
168 Ga0495591_000380 3300046458 Bacteria 37698
169 Ga0495591_001777 3300046458 Bacteria 12765
170 Ga0495638_0005192 3300046460 Bacteria 9737
171 Ga0495650_0000016 3300046471 Bacteria 554693
172 Ga0495650_0000021 3300046471 Bacteria 531242
173 Ga0495616_0046783 3300046513 Bacteria 2182
174 Ga0495620_0002852 3300046515 Bacteria 9931
175 Ga0495632_0027865 3300046519 Bacteria 2953
176 Ga0495643_0094186 3300046522 Bacteria 1542
177 Ga0495643_0136030 3300046522 Bacteria 1229
178 Ga0495654_0000125 3300046530 Bacteria 85809
179 Ga0495654_0000358 3300046530 Bacteria 39515
180 Ga0495654_0049741 3300046530 Bacteria 2052
181 Ga0495654_0090507 3300046530 Bacteria 1420
182 Ga0495609_0157205 3300046538 Bacteria 965
183 Ga0495597_0001802 3300046542 Bacteria 14693
184 Ga0495668_0031319 3300046616 Bacteria 2998
185 Ga0495625_0005394 3300046660 Bacteria 11686
186 Ga0495588_0002478 3300046674 Bacteria 7910
187 Ga0495649_0000984 3300046694 Bacteria 22473
188 Ga0495649_0001470 3300046694 Bacteria 17710
189 Ga0495589_0000002 3300046794 Bacteria 758846
190 Ga0495660_0000007 3300046810 Bacteria 485295
191 Ga0495672_0000070 3300047320 Bacteria 184471
192 Ga0495679_000021 3300047446 Bacteria 226183
193 Ga0495679_000932 3300047446 Bacteria 18195
194 Ga0495679_068159 3300047446 Bacteria 1030
195 Ga0495673_0000022 3300047469 Bacteria 544086
196 Ga0495681_0017706 3300047470 Bacteria 3947
197 Ga0496100_0037917 3300048903 Bacteria 3051
198 Ga0496101_0000098 3300048904 Bacteria 90945
199 Ga0496101_0023096 3300048904 Bacteria 4291
200 Ga0496101_0036452 3300048904 Bacteria 3484
201 Ga0496101_0652508 3300048904 Bacteria 831
202 Ga0496104_0000256 3300048907 Bacteria 47237
203 Ga0496104_0000747 3300048907 Bacteria 27762
204 Ga0496116_0000127 3300048919 Bacteria 158773
205 Ga0496116_0000666 3300048919 Bacteria 44752
206 Ga0496116_0004710 3300048919 Bacteria 12883
207 Ga0496116_0035700 3300048919 Bacteria 3488
208 Ga0496116_0037028 3300048919 Bacteria 3407
209 Ga0496116_0055877 3300048919 Bacteria 2591
210 Ga0496116_0072827 3300048919 Bacteria 2169
211 Ga0496116_0083651 3300048919 Bacteria 1968
212 Ga0496116_0093994 3300048919 Bacteria 1813
213 Ga0496116_0156563 3300048919 Bacteria 1256
214 Ga0496117_0000511 3300048920 Bacteria 64216
215 Ga0496117_0001660 3300048920 Bacteria 31182
216 Ga0496117_0001907 3300048920 Bacteria 27984
217 Ga0496117_0007050 3300048920 Bacteria 11118
218 Ga0496117_0016643 3300048920 Bacteria 6189
219 Ga0496117_0018205 3300048920 Bacteria 5832
220 Ga0496117_0019826 3300048920 Bacteria 5507
221 Ga0496117_0031216 3300048920 Bacteria 4072
222 Ga0496117_0032607 3300048920 Bacteria 3954
223 Ga0496117_0054259 3300048920 Bacteria 2808
224 Ga0496117_0102728 3300048920 Bacteria 1803
225 Ga0496117_0281316 3300048920 Bacteria 890
226 Ga0496118_0001275 3300048921 Bacteria 38632
227 Ga0496118_0001494 3300048921 Bacteria 34916
228 Ga0496118_0002095 3300048921 Bacteria 28029
229 Ga0496118_0040668 3300048921 Bacteria 3693
230 Ga0496118_0060477 3300048921 Bacteria 2812
231 Ga0496118_0074428 3300048921 Bacteria 2427
232 Ga0496118_0105273 3300048921 Bacteria 1891
233 Ga0496118_0190395 3300048921 Bacteria 1227
234 Ga0496118_0365235 3300048921 Bacteria 763
235 Ga0496119_0000461 3300048922 Bacteria 55643
236 Ga0496119_0001020 3300048922 Bacteria 35864
237 Ga0496119_0001617 3300048922 Bacteria 26682
238 Ga0496119_0005704 3300048922 Bacteria 11806
239 Ga0496119_0018170 3300048922 Bacteria 5251
240 Ga0496119_0028846 3300048922 Bacteria 3777
241 Ga0496119_0033889 3300048922 Bacteria 3375
242 Ga0496119_0045365 3300048922 Bacteria 2755
243 Ga0496119_0052524 3300048922 Bacteria 2495
244 Ga0496119_0087122 3300048922 Bacteria 1782
245 Ga0496119_0106710 3300048922 Bacteria 1562
246 Ga0496119_0185537 3300048922 Bacteria 1087
247 Ga0496119_0220310 3300048922 Bacteria 971
248 Ga0496120_0000290 3300048923 Bacteria 84735
249 Ga0496120_0000859 3300048923 Bacteria 42978
250 Ga0496120_0002087 3300048923 Bacteria 21428
251 Ga0496120_0002991 3300048923 Bacteria 16062
252 Ga0496120_0009054 3300048923 Bacteria 7113
253 Ga0496120_0015009 3300048923 Bacteria 5129
254 Ga0496120_0015385 3300048923 Bacteria 5049
255 Ga0496120_0068316 3300048923 Bacteria 1960
256 Ga0496120_0104911 3300048923 Bacteria 1486
257 Ga0496121_0002539 3300048924 Bacteria 27664
258 Ga0496121_0005439 3300048924 Bacteria 16327
259 Ga0496121_0005522 3300048924 Bacteria 16156
260 Ga0496121_0008581 3300048924 Bacteria 11969
261 Ga0496121_0016817 3300048924 Bacteria 7522
262 Ga0496121_0028706 3300048924 Bacteria 5172
263 Ga0496121_0031862 3300048924 Bacteria 4807
264 Ga0496121_0064395 3300048924 Bacteria 2989
265 Ga0496121_0068846 3300048924 Bacteria 2860
266 Ga0496121_0081080 3300048924 Bacteria 2569
267 Ga0496122_0000013 3300048925 Bacteria 501039
268 Ga0496122_0000099 3300048925 Bacteria 198412
269 Ga0496122_0001159 3300048925 Bacteria 45121
270 Ga0496122_0005476 3300048925 Bacteria 15107
271 Ga0496122_0014669 3300048925 Bacteria 7556
272 Ga0496122_0019810 3300048925 Bacteria 6124
273 Ga0496122_0034160 3300048925 Bacteria 4167
274 Ga0496122_0055994 3300048925 Bacteria 2944
275 Ga0496122_0056385 3300048925 Bacteria 2929
276 Ga0496122_0185916 3300048925 Bacteria 1232
277 Ga0496122_0195936 3300048925 Bacteria 1186
278 Ga0496123_0000005 3300048926 Bacteria 658131
279 Ga0496123_0000010 3300048926 Bacteria 501039
280 Ga0496123_0000808 3300048926 Bacteria 50515
281 Ga0496123_0002176 3300048926 Bacteria 25005
282 Ga0496123_0007003 3300048926 Bacteria 10752
283 Ga0496123_0011081 3300048926 Bacteria 7869
284 Ga0496123_0028373 3300048926 Bacteria 4145
285 Ga0496123_0029927 3300048926 Bacteria 3996
286 Ga0496123_0069471 3300048926 Bacteria 2211
287 Ga0496123_0129597 3300048926 Bacteria 1400
288 Ga0496123_0224035 3300048926 Bacteria 946
289 Ga0496124_0000039 3300048927 Bacteria 307831
290 Ga0496124_0000515 3300048927 Bacteria 66726
291 Ga0496124_0001415 3300048927 Bacteria 35637
292 Ga0496124_0002100 3300048927 Bacteria 26896
293 Ga0496124_0002960 3300048927 Bacteria 21327
294 Ga0496124_0005528 3300048927 Bacteria 14170
295 Ga0496124_0011988 3300048927 Bacteria 8619
296 Ga0496124_0026486 3300048927 Bacteria 5227
297 Ga0496124_0029743 3300048927 Bacteria 4859
298 Ga0496124_0042398 3300048927 Bacteria 3919
299 Ga0496124_0049096 3300048927 Bacteria 3601
300 Ga0496124_0104819 3300048927 Bacteria 2286
301 Ga0496124_0111029 3300048927 Bacteria 2206
302 Ga0496124_0325528 3300048927 Bacteria 1098
303 Ga0496124_0345476 3300048927 Bacteria 1054
304 Ga0496125_0000016 3300048928 Bacteria 512512
305 Ga0496125_0000019 3300048928 Bacteria 474989
306 Ga0496125_0017193 3300048928 Bacteria 6912
307 Ga0496125_0042335 3300048928 Bacteria 3880
308 Ga0496125_0043859 3300048928 Bacteria 3790
309 Ga0496125_0045531 3300048928 Bacteria 3690
310 Ga0496125_0050111 3300048928 Bacteria 3461
311 Ga0496125_0059507 3300048928 Bacteria 3077
312 Ga0496125_0113070 3300048928 Bacteria 1959
313 Ga0496125_0158818 3300048928 Bacteria 1539
314 Ga0496126_0000346 3300048929 Bacteria 96927
315 Ga0496126_0006283 3300048929 Bacteria 13263
316 Ga0496126_0016243 3300048929 Bacteria 7453
317 Ga0496126_0034511 3300048929 Bacteria 4751
318 Ga0496126_0063084 3300048929 Bacteria 3322
319 Ga0496126_0081839 3300048929 Bacteria 2853
320 Ga0496126_0081841 3300048929 Bacteria 2853
321 Ga0496126_0163549 3300048929 Bacteria 1900
322 Ga0496126_0206105 3300048929 Bacteria 1657
323 Ga0496126_0308052 3300048929 Bacteria 1304
324 Ga0496126_0441721 3300048929 Bacteria 1048
325 Ga0496126_0702802 3300048929 Bacteria 785
326 Ga0501047_0020001 3300049581 Bacteria 6427
327 Ga0501080_0082193 3300049742 Bacteria 2992
328 Ga0501035_0047246 3300049822 Bacteria 3865
329 Ga0501044_0511436 3300049823 Bacteria 1101
330 nmdc:mga00v17_15993_c1 3300050491 Bacteria 4223
331 nmdc:mga00v17_3108_c1 3300050491 Bacteria 8534
332 nmdc:mga00v17_43879_c1 3300050491 Bacteria 2694
333 nmdc:mga0k408_21382_c1 3300050493 Bacteria 3633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0049741 Ga0495654_0049741_1404_2021 205
2 3300009092 Ga0105250_10000003 Ga0105250_10000003244 215
3 3300025711 Ga0207696_1000004 Ga0207696_1000004389 215
4 3300005289 Ga0065704_10077548 Ga0065704_100775482 217
5 3300027111 Ga0209281_1000799 Ga0209281_10007992 217
6 iso_pu_bacteria 2847085930 2847088409 218
7 iso_pu_bacteria 2511231025 2511378791 219
8 iso_pu_bacteria 2876601092 2876602668 219
9 iso_pu_bacteria 2939602548 2939602830 219
10 iso_pu_bacteria 8016733728 8016736657 219
11 iso_pu_bacteria 8019499862 8019501893 219
12 3300048921 Ga0496118_0190395 Ga0496118_0190395_553_1215 220
13 iso_pu_bacteria 2888366609 2888367841 220
14 iso_pu_bacteria 2888373701 2888374482 220
15 iso_pu_bacteria 2937967321 2937969576 220
16 iso_pu_bacteria 8004592986 8004594947 220
17 iso_pu_bacteria 8015394850 8015399498 220
18 3300013102 Ga0157371_10000101 Ga0157371_100001019 221
19 iso_pu_bacteria 2852103415 2852103853 221
20 iso_pu_bacteria 2884086401 2884089780 221
21 iso_pu_bacteria 2508501071 2508851273 222
22 iso_pu_bacteria 2585427591 2585829945 222
23 iso_pu_bacteria 2585427592 2585831054 222
24 iso_pu_bacteria 2667528173 2671108165 222
25 iso_pu_bacteria 2772190666 2772437847 222
26 iso_pu_bacteria 2904474040 2904475163 222
27 iso_pu_bacteria 2904504865 2904505440 222
28 iso_pu_bacteria 2919150387 2919151509 222
29 iso_pu_bacteria 2927143783 2927146383 222
30 iso_pu_bacteria 2932406140 2932408625 222
31 iso_pu_bacteria 2939577877 2939579017 222
32 3300009036 Ga0105244_10069032 Ga0105244_100690322 223
33 3300011119 Ga0105246_10010727 Ga0105246_100107274 223
34 3300011119 Ga0105246_10016397 Ga0105246_100163975 223
35 3300013100 Ga0157373_10000335 Ga0157373_1000033533 223
36 3300013102 Ga0157371_10000459 Ga0157371_1000045938 223
37 3300025711 Ga0207696_1000312 Ga0207696_100031227 223
38 3300046452 Ga0495617_010457 Ga0495617_010457_1301_1972 223
39 3300046458 Ga0495591_000080 Ga0495591_000080_47108_47779 223
40 3300046530 Ga0495654_0000125 Ga0495654_0000125_47105_47776 223
41 3300046616 Ga0495668_0031319 Ga0495668_0031319_1526_2197 223
42 3300048904 Ga0496101_0000098 Ga0496101_0000098_35211_35882 223
43 3300048904 Ga0496101_0652508 Ga0496101_0652508_127_798 223
44 3300048919 Ga0496116_0037028 Ga0496116_0037028_438_1109 223
45 3300048920 Ga0496117_0031216 Ga0496117_0031216_914_1585 223
46 3300048922 Ga0496119_0033889 Ga0496119_0033889_1586_2257 223
47 3300048923 Ga0496120_0000859 Ga0496120_0000859_25710_26381 223
48 3300048925 Ga0496122_0005476 Ga0496122_0005476_2524_3195 223
49 3300048926 Ga0496123_0002176 Ga0496123_0002176_23639_24310 223
50 3300048927 Ga0496124_0011988 Ga0496124_0011988_2120_2791 223
51 3300048927 Ga0496124_0026486 Ga0496124_0026486_1712_2383 223
52 3300048929 Ga0496126_0034511 Ga0496126_0034511_14_685 223
53 3300050491 nmdc:mga00v17_43879_c1 nmdc:mga00v17_43879_c1_1684_2355 223
54 iso_pu_bacteria 2891670763 2891673608 223
55 iso_pu_bacteria 3000376612 3000379876 223
56 iso_pu_bacteria 8054844752 8054847037 223
57 iso_pu_bacteria 8054849141 8054854040 223
58 3300009011 Ga0105251_10000511 Ga0105251_1000051129 224
59 3300009036 Ga0105244_10001185 Ga0105244_1000118515 224
60 3300013100 Ga0157373_10007494 Ga0157373_100074946 224
61 3300025728 Ga0207655_1000011 Ga0207655_1000011364 224
62 3300025735 Ga0207713_1019515 Ga0207713_10195153 224
63 3300027111 Ga0209281_1000008 Ga0209281_1000008328 224
64 3300048922 Ga0496119_0000461 Ga0496119_0000461_53031_53705 224
65 3300048922 Ga0496119_0005704 Ga0496119_0005704_1939_2613 224
66 3300048923 Ga0496120_0000290 Ga0496120_0000290_1939_2613 224
67 3300048923 Ga0496120_0015385 Ga0496120_0015385_1939_2613 224
68 3300048927 Ga0496124_0000039 Ga0496124_0000039_20453_21127 224
69 3300009036 Ga0105244_10000183 Ga0105244_1000018344 225
70 3300013306 Ga0163162_10022134 Ga0163162_100221346 225
71 3300025728 Ga0207655_1000370 Ga0207655_100037044 225
72 iso_pu_bacteria 8057304971 8057305850 225
73 2162886007 SwRhRL2b_contig_2400003 SwRhRL2b_0087.00003150 226
74 2162886007 SwRhRL2b_contig_334081 SwRhRL2b_0457.00002980 226
75 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003499 226
76 3300002771 JGI25163J39215_1000193 JGI25163J39215_10001939 226
77 3300002772 JGI25164J39214_1000014 JGI25164J39214_10000149 226
78 3300003751 Ga0055538_1000005 Ga0055538_1000005499 226
79 3300003752 Ga0055539_1000007 Ga0055539_1000007499 226
80 3300003756 Ga0055533_1000009 Ga0055533_1000009499 226
81 3300003759 Ga0055525_1000010 Ga0055525_1000010499 226
82 3300003841 Ga0055541_1000005 Ga0055541_100000566 226
83 3300005289 Ga0065704_10000763 Ga0065704_100007633 226
84 3300006946 Ga0079104_1004264 Ga0079104_10042643 226
85 3300009011 Ga0105251_10000374 Ga0105251_1000037419 226
86 3300009036 Ga0105244_10000006 Ga0105244_10000006339 226
87 3300009174 Ga0105241_10000004 Ga0105241_10000004451 226
88 3300013100 Ga0157373_10528077 Ga0157373_105280771 226
89 3300013102 Ga0157371_10000462 Ga0157371_1000046229 226
90 3300013307 Ga0157372_10834037 Ga0157372_108340371 226
91 3300025207 Ga0209760_100001 Ga0209760_100001235 226
92 3300025224 Ga0209784_100001 Ga0209784_1000011041 226
93 3300025225 Ga0209566_100001 Ga0209566_1000011041 226
94 3300025226 Ga0209674_100002 Ga0209674_1000021041 226
95 3300025230 Ga0209563_100008 Ga0209563_1000081043 226
96 3300025231 Ga0207427_100002 Ga0207427_100002235 226
97 3300025233 Ga0209437_100007 Ga0209437_100007495 226
98 3300025253 Ga0209677_100004 Ga0209677_1000041043 226
99 3300025261 Ga0209233_1002042 Ga0209233_10020423 226
100 3300025728 Ga0207655_1000149 Ga0207655_100014986 226
101 3300025728 Ga0207655_1000157 Ga0207655_100015754 226
102 3300025735 Ga0207713_1000316 Ga0207713_100031642 226
103 3300025911 Ga0207654_10000006 Ga0207654_10000006468 226
104 3300027312 Ga0209371_1001103 Ga0209371_100110320 226
105 3300030500 Ga0268256_1000939 Ga0268256_100093920 226
106 3300041405 Ga0439438_000001 Ga0439438_000001_166687_167367 226
107 3300042006 Ga0439432_003664 Ga0439432_003664_2323_3003 226
108 3300046471 Ga0495650_0000016 Ga0495650_0000016_148217_148897 226
109 3300046530 Ga0495654_0000358 Ga0495654_0000358_20435_21115 226
110 3300046538 Ga0495609_0157205 Ga0495609_0157205_96_776 226
111 3300046794 Ga0495589_0000002 Ga0495589_0000002_539538_540218 226
112 3300046810 Ga0495660_0000007 Ga0495660_0000007_104584_105264 226
113 3300048907 Ga0496104_0000747 Ga0496104_0000747_10455_11135 226
114 3300048919 Ga0496116_0000127 Ga0496116_0000127_104436_105116 226
115 3300048920 Ga0496117_0054259 Ga0496117_0054259_12_692 226
116 3300048920 Ga0496117_0102728 Ga0496117_0102728_1087_1767 226
117 3300048921 Ga0496118_0001275 Ga0496118_0001275_19355_20035 226
118 3300048922 Ga0496119_0028846 Ga0496119_0028846_2614_3294 226
119 3300048925 Ga0496122_0000013 Ga0496122_0000013_152515_153195 226
120 3300048926 Ga0496123_0000010 Ga0496123_0000010_347845_348525 226
121 3300048927 Ga0496124_0000515 Ga0496124_0000515_27586_28266 226
122 3300048928 Ga0496125_0000019 Ga0496125_0000019_94237_94917 226
123 3300003856 Ga0058692_1001098 Ga0058692_10010988 227
124 3300006051 Ga0075364_10085407 Ga0075364_100854072 227
125 3300009011 Ga0105251_10015615 Ga0105251_100156153 227
126 3300009036 Ga0105244_10003003 Ga0105244_100030036 227
127 3300009036 Ga0105244_10015189 Ga0105244_100151897 227
128 3300009036 Ga0105244_10024196 Ga0105244_100241964 227
129 3300009092 Ga0105250_10001511 Ga0105250_100015119 227
130 3300025711 Ga0207696_1002512 Ga0207696_10025125 227
131 3300025728 Ga0207655_1013233 Ga0207655_10132335 227
132 3300025735 Ga0207713_1036401 Ga0207713_10364013 227
133 3300027312 Ga0209371_1000677 Ga0209371_100067726 227
134 3300027312 Ga0209371_1003972 Ga0209371_10039723 227
135 3300030500 Ga0268256_1000494 Ga0268256_100049433 227
136 3300030500 Ga0268256_1003972 Ga0268256_10039724 227
137 3300046542 Ga0495597_0001802 Ga0495597_0001802_3210_3893 227
138 3300046674 Ga0495588_0002478 Ga0495588_0002478_4863_5546 227
139 3300047470 Ga0495681_0017706 Ga0495681_0017706_1233_1916 227
140 3300009092 Ga0105250_10061728 Ga0105250_100617282 228
141 3300015261 Ga0182006_1000063 Ga0182006_100006359 228
142 3300042137 Ga0450902_002113 Ga0450902_002113_468_1187 228
143 3300048903 Ga0496100_0037917 Ga0496100_0037917_1111_1830 228
144 3300048904 Ga0496101_0023096 Ga0496101_0023096_1652_2371 228
145 iso_pu_bacteria 2939573065 2939574536 228
146 3300006946 Ga0079104_1001070 Ga0079104_100107013 229
147 3300009036 Ga0105244_10000221 Ga0105244_1000022146 229
148 3300025728 Ga0207655_1000260 Ga0207655_100026036 229
149 3300025735 Ga0207713_1000059 Ga0207713_100005933 229
150 3300027111 Ga0209281_1002063 Ga0209281_10020638 229
151 3300042006 Ga0439432_021264 Ga0439432_021264_561_1250 229
152 3300046513 Ga0495616_0046783 Ga0495616_0046783_1100_1789 229
153 3300046530 Ga0495654_0090507 Ga0495654_0090507_603_1292 229
154 3300046660 Ga0495625_0005394 Ga0495625_0005394_5750_6439 229
155 3300047446 Ga0495679_000021 Ga0495679_000021_159336_160025 229
156 3300048920 Ga0496117_0001660 Ga0496117_0001660_8076_8792 229
157 3300048924 Ga0496121_0005522 Ga0496121_0005522_8260_8976 229
158 3300048927 Ga0496124_0002100 Ga0496124_0002100_11840_12529 229
159 iso_pu_bacteria 2547132181 2547694564 229
160 iso_pu_bacteria 2561511199 2562466638 229
161 iso_pu_bacteria 2600255256 2601532153 229
162 iso_pu_bacteria 2600255257 2601537523 229
163 iso_pu_bacteria 2600255310 2601755870 229
164 iso_pu_bacteria 2600255311 2601761239 229
165 iso_pu_bacteria 2602042046 2603638736 229
166 iso_pu_bacteria 2602042047 2603643270 229
167 iso_pu_bacteria 2602042067 2603703845 229
168 iso_pu_bacteria 2681812866 2681995605 229
169 iso_pu_bacteria 2751185917 2753855213 229
170 iso_pu_bacteria 2791355010 2792312444 229
171 iso_pu_bacteria 2791355275 2793406191 229
172 iso_pu_bacteria 2811995292 2813729795 229
173 iso_pu_bacteria 2814123068 2814697290 229
174 iso_pu_bacteria 2821118458 2821118989 229
175 iso_pu_bacteria 2823373977 2823376761 229
176 iso_pu_bacteria 2844425489 2844426747 229
177 iso_pu_bacteria 2923634449 2923638640 229
178 iso_pu_bacteria 2927833300 2927834862 229
179 iso_pu_bacteria 2935625433 2935627411 229
180 iso_pu_bacteria 2937539931 2937543507 229
181 iso_pu_bacteria 2939617950 2939621429 229
182 iso_pu_bacteria 2974310843 2974312928 229
183 iso_pu_bacteria 2974435778 2974437666 229
184 iso_pu_bacteria 8019504834 8019508429 229
185 3300042010 Ga0439452_000003 Ga0439452_000003_428393_429100 230
186 3300046453 Ga0495627_020120 Ga0495627_020120_605_1300 231
187 3300046458 Ga0495591_001777 Ga0495591_001777_2309_3004 231
188 3300046460 Ga0495638_0005192 Ga0495638_0005192_6809_7504 231
189 3300046515 Ga0495620_0002852 Ga0495620_0002852_5709_6404 231
190 3300046519 Ga0495632_0027865 Ga0495632_0027865_1442_2152 231
191 3300046522 Ga0495643_0136030 Ga0495643_0136030_209_904 231
192 3300046694 Ga0495649_0000984 Ga0495649_0000984_14965_15660 231
193 3300046694 Ga0495649_0001470 Ga0495649_0001470_7019_7714 231
194 3300047446 Ga0495679_000932 Ga0495679_000932_12849_13544 231
195 3300047446 Ga0495679_068159 Ga0495679_068159_275_970 231
196 3300025711 Ga0207696_1000003 Ga0207696_1000003679 232
197 3300047320 Ga0495672_0000070 Ga0495672_0000070_44662_45360 232
198 3300048926 Ga0496123_0224035 Ga0496123_0224035_238_936 232
199 3300048927 Ga0496124_0104819 Ga0496124_0104819_37_735 232
200 3300048928 Ga0496125_0000016 Ga0496125_0000016_118003_118701 232
201 3300048929 Ga0496126_0441721 Ga0496126_0441721_282_980 232
202 3300002773 JGI25152J39213_1000744 JGI25152J39213_10007445 233
203 3300003320 rootH2_10066337 rootH2_100663375 233
204 3300003322 rootL2_10278897 rootL2_102788972 233
205 3300003856 Ga0058692_1007102 Ga0058692_10071021 233
206 3300003856 Ga0058692_1008149 Ga0058692_10081493 233
207 3300005289 Ga0065704_10000313 Ga0065704_1000031332 233
208 3300005289 Ga0065704_10000426 Ga0065704_1000042620 233
209 3300005289 Ga0065704_10212272 Ga0065704_102122722 233
210 3300005548 Ga0070665_100000199 Ga0070665_10000019992 233
211 3300005577 Ga0068857_100000621 Ga0068857_1000006216 233
212 3300006051 Ga0075364_10008285 Ga0075364_100082854 233
213 3300006946 Ga0079104_1000080 Ga0079104_1000080110 233
214 3300006946 Ga0079104_1000087 Ga0079104_100008732 233
215 3300006946 Ga0079104_1000922 Ga0079104_10009229 233
216 3300006946 Ga0079104_1001460 Ga0079104_100146013 233
217 3300006946 Ga0079104_1003427 Ga0079104_10034274 233
218 3300006946 Ga0079104_1011698 Ga0079104_10116982 233
219 3300009011 Ga0105251_10000337 Ga0105251_1000033738 233
220 3300009011 Ga0105251_10020571 Ga0105251_100205712 233
221 3300009036 Ga0105244_10002054 Ga0105244_100020543 233
222 3300009036 Ga0105244_10008959 Ga0105244_100089592 233
223 3300009036 Ga0105244_10042481 Ga0105244_100424812 233
224 3300009092 Ga0105250_10000026 Ga0105250_10000026150 233
225 3300013102 Ga0157371_10043132 Ga0157371_100431324 233
226 3300013105 Ga0157369_10002223 Ga0157369_1000222319 233
227 3300013307 Ga0157372_10073861 Ga0157372_100738615 233
228 3300015679 Ga0183366_1001 Ga0183366_1001519 233
229 3300015680 Ga0183370_1001 Ga0183370_1001519 233
230 3300015685 Ga0183369_1001 Ga0183369_1001519 233
231 3300015687 Ga0183368_1001 Ga0183368_1001519 233
232 3300025245 Ga0207425_1015235 Ga0207425_10152352 233
233 3300025258 Ga0209129_1000015 Ga0209129_1000015455 233
234 3300025711 Ga0207696_1000059 Ga0207696_100005982 233
235 3300025711 Ga0207696_1005276 Ga0207696_10052763 233
236 3300025728 Ga0207655_1000001 Ga0207655_1000001578 233
237 3300025728 Ga0207655_1000032 Ga0207655_1000032310 233
238 3300025735 Ga0207713_1000005 Ga0207713_100000580 233
239 3300025735 Ga0207713_1001682 Ga0207713_10016829 233
240 3300025735 Ga0207713_1004677 Ga0207713_10046773 233
241 3300025735 Ga0207713_1016251 Ga0207713_10162513 233
242 3300025735 Ga0207713_1021360 Ga0207713_10213602 233
243 3300025935 Ga0207709_10115666 Ga0207709_101156663 233
244 3300026116 Ga0207674_10002565 Ga0207674_1000256521 233
245 3300027111 Ga0209281_1000021 Ga0209281_100002146 233
246 3300027111 Ga0209281_1000101 Ga0209281_1000101176 233
247 3300027111 Ga0209281_1000148 Ga0209281_1000148139 233
248 3300027111 Ga0209281_1000201 Ga0209281_100020132 233
249 3300027111 Ga0209281_1000780 Ga0209281_10007809 233
250 3300027111 Ga0209281_1002420 Ga0209281_10024206 233
251 3300027312 Ga0209371_1000056 Ga0209371_100005686 233
252 3300027312 Ga0209371_1006468 Ga0209371_10064683 233
253 3300027312 Ga0209371_1008166 Ga0209371_10081664 233
254 3300028379 Ga0268266_10000571 Ga0268266_1000057141 233
255 3300030500 Ga0268256_1000003 Ga0268256_1000003496 233
256 3300030500 Ga0268256_1000071 Ga0268256_1000071147 233
257 3300030500 Ga0268256_1005748 Ga0268256_10057484 233
258 3300030500 Ga0268256_1007015 Ga0268256_10070152 233
259 3300042010 Ga0439452_000029 Ga0439452_000029_184090_184812 233
260 3300048919 Ga0496116_0055877 Ga0496116_0055877_709_1431 233
261 3300048920 Ga0496117_0001907 Ga0496117_0001907_11231_11953 233
262 3300048920 Ga0496117_0018205 Ga0496117_0018205_2938_3660 233
263 3300048921 Ga0496118_0002095 Ga0496118_0002095_14126_14848 233
264 3300048922 Ga0496119_0001020 Ga0496119_0001020_24520_25242 233
265 3300048925 Ga0496122_0056385 Ga0496122_0056385_53_775 233
266 3300048925 Ga0496122_0185916 Ga0496122_0185916_472_1194 233
267 3300048926 Ga0496123_0000808 Ga0496123_0000808_23597_24319 233
268 3300048926 Ga0496123_0007003 Ga0496123_0007003_5572_6294 233
269 3300048927 Ga0496124_0001415 Ga0496124_0001415_25712_26434 233
270 3300048928 Ga0496125_0050111 Ga0496125_0050111_1665_2387 233
271 3300048928 Ga0496125_0113070 Ga0496125_0113070_493_1215 233
272 3300049581 Ga0501047_0020001 Ga0501047_0020001_4835_5569 233
273 3300049742 Ga0501080_0082193 Ga0501080_0082193_1302_2036 233
274 3300049822 Ga0501035_0047246 Ga0501035_0047246_1271_2005 233
275 3300049823 Ga0501044_0511436 Ga0501044_0511436_147_881 233
276 3300009011 Ga0105251_10000642 Ga0105251_1000064235 234
277 iso_pu_bacteria 2547132416 2548647886 234
278 iso_pu_bacteria 2602042066 2603699868 234
279 iso_pu_bacteria 2667528172 2671102574 234
280 iso_pu_bacteria 2681812869 2682007399 234
281 iso_pu_bacteria 2765235842 2765588150 234
282 iso_pu_bacteria 2775506706 2775541526 234
283 iso_pu_bacteria 2939568625 2939570414 234
284 iso_pu_bacteria 2939607340 2939608288 234
285 iso_pu_bacteria 2939642701 2939644508 234
286 iso_pu_bacteria 8018221730 8018225351 234
287 iso_pu_bacteria 8018405270 8018408062 234
288 iso_pu_bacteria 8055087960 8055088898 234
289 iso_pu_bacteria 8055092621 8055093854 234
290 iso_pu_bacteria 8055097453 8055099299 234
291 3300048904 Ga0496101_0036452 Ga0496101_0036452_34_762 235
292 3300048929 Ga0496126_0016243 Ga0496126_0016243_167_895 235
293 2162886007 SwRhRL2b_contig_1636881 SwRhRL2b_0025.00000290 238
294 2162886007 SwRhRL2b_contig_608038 SwRhRL2b_0804.00002550 238
295 3300003856 Ga0058692_1001096 Ga0058692_10010967 238
296 3300005366 Ga0070659_100036515 Ga0070659_1000365153 238
297 3300005548 Ga0070665_100097064 Ga0070665_1000970642 238
298 3300006051 Ga0075364_10120841 Ga0075364_101208412 238
299 3300009011 Ga0105251_10075102 Ga0105251_100751022 238
300 3300009036 Ga0105244_10006403 Ga0105244_100064034 238
301 3300009036 Ga0105244_10279945 Ga0105244_102799451 238
302 3300009092 Ga0105250_10011203 Ga0105250_100112033 238
303 3300013100 Ga0157373_10106781 Ga0157373_101067812 238
304 3300013102 Ga0157371_10049789 Ga0157371_100497892 238
305 3300013104 Ga0157370_10000963 Ga0157370_1000096334 238
306 3300025711 Ga0207696_1030517 Ga0207696_10305172 238
307 3300025728 Ga0207655_1000334 Ga0207655_100033431 238
308 3300025735 Ga0207713_1037195 Ga0207713_10371952 238
309 3300025932 Ga0207690_10065007 Ga0207690_100650072 238
310 3300027312 Ga0209371_1000001 Ga0209371_1000001478 238
311 3300030500 Ga0268256_1000001 Ga0268256_10000012163 238
312 3300041405 Ga0439438_000584 Ga0439438_000584_13578_14318 238
313 3300041512 Ga0451853_2037034 Ga0451853_2037034_1361_2077 238
314 3300042006 Ga0439432_018485 Ga0439432_018485_1002_1718 238
315 3300042010 Ga0439452_000030 Ga0439452_000030_161418_162134 238
316 3300042010 Ga0439452_000220 Ga0439452_000220_14379_15095 238
317 3300044669 Ga0466981_0000023 Ga0466981_0000023_52869_53585 238
318 3300046458 Ga0495591_000380 Ga0495591_000380_24945_25661 238
319 3300046471 Ga0495650_0000021 Ga0495650_0000021_505440_506156 238
320 3300046522 Ga0495643_0094186 Ga0495643_0094186_146_862 238
321 3300047469 Ga0495673_0000022 Ga0495673_0000022_223326_224072 238
322 3300048907 Ga0496104_0000256 Ga0496104_0000256_10722_11438 238
323 3300048919 Ga0496116_0000666 Ga0496116_0000666_30250_30966 238
324 3300048919 Ga0496116_0004710 Ga0496116_0004710_11043_11759 238
325 3300048919 Ga0496116_0035700 Ga0496116_0035700_2229_2945 238
326 3300048919 Ga0496116_0072827 Ga0496116_0072827_181_897 238
327 3300048919 Ga0496116_0083651 Ga0496116_0083651_226_942 238
328 3300048919 Ga0496116_0093994 Ga0496116_0093994_71_787 238
329 3300048919 Ga0496116_0156563 Ga0496116_0156563_270_986 238
330 3300048920 Ga0496117_0000511 Ga0496117_0000511_15245_15961 238
331 3300048920 Ga0496117_0007050 Ga0496117_0007050_7747_8463 238
332 3300048920 Ga0496117_0016643 Ga0496117_0016643_1118_1834 238
333 3300048920 Ga0496117_0019826 Ga0496117_0019826_4437_5153 238
334 3300048920 Ga0496117_0032607 Ga0496117_0032607_553_1269 238
335 3300048920 Ga0496117_0281316 Ga0496117_0281316_104_820 238
336 3300048921 Ga0496118_0001494 Ga0496118_0001494_19819_20535 238
337 3300048921 Ga0496118_0040668 Ga0496118_0040668_2962_3678 238
338 3300048921 Ga0496118_0060477 Ga0496118_0060477_1790_2506 238
339 3300048921 Ga0496118_0074428 Ga0496118_0074428_528_1244 238
340 3300048921 Ga0496118_0105273 Ga0496118_0105273_241_957 238
341 3300048921 Ga0496118_0365235 Ga0496118_0365235_32_748 238
342 3300048922 Ga0496119_0001617 Ga0496119_0001617_13398_14114 238
343 3300048922 Ga0496119_0018170 Ga0496119_0018170_1027_1743 238
344 3300048922 Ga0496119_0045365 Ga0496119_0045365_31_747 238
345 3300048922 Ga0496119_0052524 Ga0496119_0052524_616_1332 238
346 3300048922 Ga0496119_0087122 Ga0496119_0087122_382_1098 238
347 3300048922 Ga0496119_0106710 Ga0496119_0106710_271_987 238
348 3300048922 Ga0496119_0185537 Ga0496119_0185537_319_1035 238
349 3300048922 Ga0496119_0220310 Ga0496119_0220310_74_790 238
350 3300048923 Ga0496120_0002087 Ga0496120_0002087_18101_18817 238
351 3300048923 Ga0496120_0002991 Ga0496120_0002991_14320_15036 238
352 3300048923 Ga0496120_0009054 Ga0496120_0009054_2876_3592 238
353 3300048923 Ga0496120_0015009 Ga0496120_0015009_2077_2793 238
354 3300048923 Ga0496120_0068316 Ga0496120_0068316_1027_1743 238
355 3300048923 Ga0496120_0104911 Ga0496120_0104911_218_955 238
356 3300048924 Ga0496121_0002539 Ga0496121_0002539_10092_10808 238
357 3300048924 Ga0496121_0005439 Ga0496121_0005439_2947_3663 238
358 3300048924 Ga0496121_0008581 Ga0496121_0008581_697_1413 238
359 3300048924 Ga0496121_0016817 Ga0496121_0016817_1103_1819 238
360 3300048924 Ga0496121_0028706 Ga0496121_0028706_2989_3705 238
361 3300048924 Ga0496121_0031862 Ga0496121_0031862_2989_3705 238
362 3300048924 Ga0496121_0064395 Ga0496121_0064395_1793_2509 238
363 3300048924 Ga0496121_0068846 Ga0496121_0068846_1664_2380 238
364 3300048924 Ga0496121_0081080 Ga0496121_0081080_724_1440 238
365 3300048925 Ga0496122_0000099 Ga0496122_0000099_36195_36911 238
366 3300048925 Ga0496122_0001159 Ga0496122_0001159_43806_44522 238
367 3300048925 Ga0496122_0014669 Ga0496122_0014669_1543_2259 238
368 3300048925 Ga0496122_0019810 Ga0496122_0019810_2554_3270 238
369 3300048925 Ga0496122_0034160 Ga0496122_0034160_1985_2701 238
370 3300048925 Ga0496122_0055994 Ga0496122_0055994_2150_2866 238
371 3300048925 Ga0496122_0195936 Ga0496122_0195936_442_1158 238
372 3300048926 Ga0496123_0000005 Ga0496123_0000005_263532_264248 238
373 3300048926 Ga0496123_0011081 Ga0496123_0011081_1493_2209 238
374 3300048926 Ga0496123_0028373 Ga0496123_0028373_2959_3675 238
375 3300048926 Ga0496123_0029927 Ga0496123_0029927_1297_2013 238
376 3300048926 Ga0496123_0069471 Ga0496123_0069471_1467_2183 238
377 3300048926 Ga0496123_0129597 Ga0496123_0129597_93_809 238
378 3300048927 Ga0496124_0002960 Ga0496124_0002960_17335_18051 238
379 3300048927 Ga0496124_0005528 Ga0496124_0005528_1930_2670 238
380 3300048927 Ga0496124_0029743 Ga0496124_0029743_1247_1963 238
381 3300048927 Ga0496124_0042398 Ga0496124_0042398_2630_3346 238
382 3300048927 Ga0496124_0049096 Ga0496124_0049096_2162_2878 238
383 3300048927 Ga0496124_0111029 Ga0496124_0111029_1273_1989 238
384 3300048927 Ga0496124_0325528 Ga0496124_0325528_261_977 238
385 3300048927 Ga0496124_0345476 Ga0496124_0345476_271_987 238
386 3300048928 Ga0496125_0017193 Ga0496125_0017193_4532_5248 238
387 3300048928 Ga0496125_0042335 Ga0496125_0042335_1130_1846 238
388 3300048928 Ga0496125_0043859 Ga0496125_0043859_2609_3325 238
389 3300048928 Ga0496125_0045531 Ga0496125_0045531_1910_2626 238
390 3300048928 Ga0496125_0059507 Ga0496125_0059507_1910_2626 238
391 3300048928 Ga0496125_0158818 Ga0496125_0158818_768_1484 238
392 3300048929 Ga0496126_0000346 Ga0496126_0000346_65857_66573 238
393 3300048929 Ga0496126_0006283 Ga0496126_0006283_2250_2966 238
394 3300048929 Ga0496126_0063084 Ga0496126_0063084_2003_2719 238
395 3300048929 Ga0496126_0081839 Ga0496126_0081839_1531_2247 238
396 3300048929 Ga0496126_0081841 Ga0496126_0081841_1531_2247 238
397 3300048929 Ga0496126_0163549 Ga0496126_0163549_609_1325 238
398 3300048929 Ga0496126_0206105 Ga0496126_0206105_332_1048 238
399 3300048929 Ga0496126_0308052 Ga0496126_0308052_544_1260 238
400 3300048929 Ga0496126_0702802 Ga0496126_0702802_25_741 238
401 3300050491 nmdc:mga00v17_15993_c1 nmdc:mga00v17_15993_c1_1788_2504 238
402 3300050491 nmdc:mga00v17_3108_c1 nmdc:mga00v17_3108_c1_2592_3308 238
403 3300050493 nmdc:mga0k408_21382_c1 nmdc:mga0k408_21382_c1_534_1250 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

20

235

0.97

PF13500

AAA_26

AAA domain

18

229

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dae-assembly1.cif.gz_A dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid 0.9966 7 230
1a82-assembly1.cif.gz_A dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid 0.9958 7 230
1dts-assembly1.cif.gz_A-2 crystal structure of an atp dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution 0.9938 7 230
1dae-assembly1.cif.gz_A dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid 0.9921 7 230
1a82-assembly1.cif.gz_A dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid 0.9914 7 230
ID Description Score Start End Superfamily
af_P0A6E9_2_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9625 9 230 3.40.50.300
af_P0A6E9_2_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9496 9 230 3.40.50.300
af_Q58695_1_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8888 10 218 3.40.50.300
3of5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8841 8 223 3.40.50.300
3of5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8647 8 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6N8NRA6-F1-model_v4 Dethiobiotin synthase (EC 6.3.3.3) 1.001 7 139 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A379VUB6-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9988 7 228 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A418GGB0-F1-model_v4 Dethiobiotin synthase (EC 6.3.3.3) 0.9984 7 169 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A377F702-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9982 27 230 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A379WX10-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9981 7 204 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102

Feature Viewer

pLDDT pTM Quality
92.01 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map