F435228

General Info

Members Datasets Scaffolds Average Seq Length
402 220 402 330

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0139285|Ga0501044_0139285_1280_2311
Length 343
Sequence MTETTQKTELEAVADAIRAHDRFVVVSHENPDGDALGSLLATHLALFQLGKDSVMYLAGETPLPAEYRFLDLAGLRRALPGDHAERVLVAVDCAQESRLGPGWEELLAKAPLTVDIDHHHDNTRFGDVNLVVPEASSTGELLADVFRELGVRLTAELAEPLYTALVTDTGRFQYANTTPKALRLAADLVEAGADAHKVFQVVYESVEFAKLKLLARALQRAEIHEGGRVVVSYLVRDDFAEVGAAEPYSEGIIDYLRAVDGAALAALIREPPSAGGQLRKVSLRSSTDEVDVSSIARKSGGXGHRQAAGFSSERSVAEITEFIVREFRSVTGETERPAVGSGG

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20.15
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10010453 3300002244 Unclassified 1537
2 Ga0070683_100010660 3300005329 Bacteria 7902
3 Ga0070683_100033669 3300005329 Bacteria 4673
4 Ga0070690_100005734 3300005330 Bacteria 6994
5 Ga0070677_10076293 3300005333 Unclassified 1423
6 Ga0070680_100055640 3300005336 Bacteria 3233
7 Ga0070680_100103790 3300005336 Bacteria 2362
8 Ga0070680_100106635 3300005336 Bacteria 2330
9 Ga0070682_100011772 3300005337 Bacteria 5002
10 Ga0070682_100075668 3300005337 Bacteria 2166
11 Ga0068868_100026785 3300005338 Unclassified 4396
12 Ga0070660_100009902 3300005339 Bacteria 6722
13 Ga0070660_100127147 3300005339 Unclassified 2037
14 Ga0070689_100061734 3300005340 Unclassified 2915
15 Ga0070691_10110603 3300005341 Bacteria 1374
16 Ga0070661_100091534 3300005344 Bacteria 2253
17 Ga0070692_10020141 3300005345 Bacteria 3230
18 Ga0070668_100034276 3300005347 Bacteria 3869
19 Ga0070669_100311532 3300005353 Bacteria 1269
20 Ga0070675_100217355 3300005354 Unclassified 1663
21 Ga0070674_100126445 3300005356 Unclassified 1900
22 Ga0070673_100178181 3300005364 Unclassified 1818
23 Ga0070659_100054394 3300005366 Bacteria 3152
24 Ga0070709_10039647 3300005434 Unclassified 2891
25 Ga0070714_100202629 3300005435 Unclassified 1816
26 Ga0070710_10033882 3300005437 Unclassified 2775
27 Ga0070701_10005898 3300005438 Bacteria 5111
28 Ga0070711_100006848 3300005439 Bacteria 6899
29 Ga0070700_100007469 3300005441 Bacteria 5906
30 Ga0070694_100047499 3300005444 Unclassified 2885
31 Ga0070708_100041394 3300005445 Bacteria 4039
32 Ga0070663_100018281 3300005455 Bacteria 4591
33 Ga0070681_10010772 3300005458 Bacteria 9036
34 Ga0068867_100010996 3300005459 Bacteria 6381
35 Ga0068867_100168854 3300005459 Bacteria 1731
36 Ga0070685_10027118 3300005466 Bacteria 3164
37 Ga0070706_100260743 3300005467 Bacteria 1618
38 Ga0070707_100207313 3300005468 Bacteria 1911
39 Ga0070679_100027597 3300005530 Bacteria 5589
40 Ga0070679_100045082 3300005530 Bacteria 4394
41 Ga0070684_100187449 3300005535 Bacteria 1882
42 Ga0070697_100027408 3300005536 Bacteria 4558
43 Ga0070672_100004936 3300005543 Bacteria 8782
44 Ga0070686_100019522 3300005544 Bacteria 3996
45 Ga0070695_100067083 3300005545 Unclassified 2340
46 Ga0070696_100120902 3300005546 Unclassified 1895
47 Ga0070693_100103600 3300005547 Unclassified 1738
48 Ga0070665_100003419 3300005548 Bacteria 16959
49 Ga0070665_100220931 3300005548 Bacteria 1895
50 Ga0068855_100005352 3300005563 Bacteria 15656
51 Ga0068855_100115414 3300005563 Bacteria 3078
52 Ga0070664_100067600 3300005564 Bacteria 3054
53 Ga0068854_100321823 3300005578 Unclassified 1257
54 Ga0068856_100030805 3300005614 Bacteria 5246
55 Ga0068856_100244868 3300005614 Unclassified 1808
56 Ga0070702_100015435 3300005615 Unclassified 3900
57 Ga0068852_100008885 3300005616 Bacteria 7432
58 Ga0068859_100315498 3300005617 Unclassified 1657
59 Ga0068864_100183108 3300005618 Unclassified 1916
60 Ga0068866_10005511 3300005718 Bacteria 5228
61 Ga0068858_100086022 3300005842 Unclassified 2925
62 Ga0075432_10019857 3300006058 Bacteria 2297
63 Ga0070712_100175451 3300006175 Unclassified 1666
64 Ga0097621_100055999 3300006237 Bacteria 3220
65 Ga0097621_100154245 3300006237 Bacteria 1971
66 Ga0068871_100006377 3300006358 Bacteria 8339
67 Ga0075433_10017294 3300006852 Bacteria 5969
68 Ga0075433_10330519 3300006852 Bacteria 1348
69 Ga0075434_100013806 3300006871 Bacteria 7702
70 Ga0075434_100031031 3300006871 Bacteria 5267
71 Ga0068865_100065685 3300006881 Unclassified 2557
72 Ga0075436_100001566 3300006914 Bacteria 15598
73 Ga0097620_100315494 3300006931 Unclassified 1657
74 Ga0075435_100007518 3300007076 Bacteria 7776
75 Ga0105240_10058319 3300009093 Bacteria 4820
76 Ga0105240_10276291 3300009093 Bacteria 1932
77 Ga0105245_10023305 3300009098 Bacteria 5433
78 Ga0105245_10071082 3300009098 Unclassified 3160
79 Ga0105245_10134746 3300009098 Unclassified 2320
80 Ga0105247_10192412 3300009101 Unclassified 1366
81 Ga0114129_10013022 3300009147 Bacteria 11847
82 Ga0105243_10336536 3300009148 Unclassified 1381
83 Ga0105241_10101879 3300009174 Unclassified 2284
84 Ga0105242_10460473 3300009176 Unclassified 1201
85 Ga0105248_10034471 3300009177 Bacteria 5660
86 Ga0105248_10344773 3300009177 Bacteria 1677
87 Ga0105238_10193378 3300009551 Bacteria 2010
88 Ga0105249_10001347 3300009553 Bacteria 21460
89 Ga0105249_10140429 3300009553 Bacteria 2316
90 Ga0105239_10009547 3300010375 Bacteria 10917
91 Ga0105239_10086664 3300010375 Unclassified 3452
92 Ga0105246_10116534 3300011119 Bacteria 1972
93 Ga0157370_10016647 3300013104 Bacteria 7439
94 Ga0157370_10062047 3300013104 Bacteria 3546
95 Ga0157369_10015472 3300013105 Bacteria 8596
96 Ga0157369_10065773 3300013105 Bacteria 3901
97 Ga0157369_10191779 3300013105 Bacteria 2147
98 Ga0157369_10505708 3300013105 Bacteria 1250
99 Ga0157374_10007016 3300013296 Bacteria 9591
100 Ga0157374_10198782 3300013296 Unclassified 1963
101 Ga0157378_10006940 3300013297 Bacteria 9880
102 Ga0163162_10011880 3300013306 Bacteria 8494
103 Ga0163162_10399161 3300013306 Unclassified 1508
104 Ga0157372_10271022 3300013307 Bacteria 1972
105 Ga0157375_10111172 3300013308 Unclassified 2838
106 Ga0157375_10172625 3300013308 Bacteria 2310
107 Ga0157380_10186130 3300014326 Unclassified 1829
108 Ga0157377_10004788 3300014745 Bacteria 6276
109 Ga0157376_10043956 3300014969 Bacteria 3669
110 Ga0206356_10005950 3300020070 Bacteria 1682
111 Ga0206356_10625028 3300020070 Bacteria 4042
112 Ga0206354_10171663 3300020081 Bacteria 1594
113 Ga0206353_11427553 3300020082 Bacteria 2558
114 Ga0206353_11717398 3300020082 Bacteria 3542
115 Ga0206353_11788903 3300020082 Bacteria 6607
116 Ga0207688_10065715 3300025901 Unclassified 2050
117 Ga0207699_10015849 3300025906 Unclassified 3926
118 Ga0207705_10005937 3300025909 Bacteria 9083
119 Ga0207705_10076250 3300025909 Bacteria 2437
120 Ga0207654_10031320 3300025911 Bacteria 2928
121 Ga0207654_10040644 3300025911 Unclassified 2621
122 Ga0207707_10008921 3300025912 Bacteria 8709
123 Ga0207693_10001176 3300025915 Bacteria 23358
124 Ga0207693_10015488 3300025915 Bacteria 6117
125 Ga0207693_10062055 3300025915 Unclassified 2928
126 Ga0207663_10181615 3300025916 Unclassified 1503
127 Ga0207660_10013947 3300025917 Bacteria 5274
128 Ga0207660_10071979 3300025917 Bacteria 2517
129 Ga0207660_10092461 3300025917 Bacteria 2245
130 Ga0207657_10014652 3300025919 Bacteria 7640
131 Ga0207657_10033954 3300025919 Bacteria 4594
132 Ga0207649_10120283 3300025920 Bacteria 1769
133 Ga0207652_10008538 3300025921 Bacteria 8245
134 Ga0207652_10030697 3300025921 Bacteria 4503
135 Ga0207659_10155924 3300025926 Unclassified 1788
136 Ga0207687_10012584 3300025927 Bacteria 5526
137 Ga0207687_10210408 3300025927 Unclassified 1525
138 Ga0207687_10289457 3300025927 Bacteria 1316
139 Ga0207644_10032152 3300025931 Unclassified 3659
140 Ga0207644_10069118 3300025931 Bacteria 2578
141 Ga0207690_10208528 3300025932 Unclassified 1488
142 Ga0207686_10015963 3300025934 Bacteria 4208
143 Ga0207686_10277858 3300025934 Unclassified 1235
144 Ga0207709_10083424 3300025935 Bacteria 2066
145 Ga0207709_10152517 3300025935 Unclassified 1602
146 Ga0207709_10157180 3300025935 Unclassified 1582
147 Ga0207709_10157625 3300025935 Bacteria 1580
148 Ga0207669_10066596 3300025937 Unclassified 2240
149 Ga0207704_10005166 3300025938 Bacteria 6012
150 Ga0207691_10007187 3300025940 Bacteria 10741
151 Ga0207711_10151872 3300025941 Unclassified 2090
152 Ga0207661_10008982 3300025944 Bacteria 7160
153 Ga0207661_10088310 3300025944 Bacteria 2577
154 Ga0207661_10090825 3300025944 Bacteria 2544
155 Ga0207661_10154015 3300025944 Bacteria 1989
156 Ga0207661_10164059 3300025944 Bacteria 1929
157 Ga0207712_10148331 3300025961 Unclassified 1809
158 Ga0207677_10010112 3300026023 Bacteria 5327
159 Ga0207678_10004730 3300026067 Bacteria 12226
160 Ga0207678_10603079 3300026067 Bacteria 963
161 Ga0207708_10001288 3300026075 Bacteria 18839
162 Ga0207702_10049234 3300026078 Bacteria 3555
163 Ga0207702_10089693 3300026078 Bacteria 2689
164 Ga0207702_10234644 3300026078 Unclassified 1716
165 Ga0207648_10000136 3300026089 Bacteria 73368
166 Ga0207648_10093582 3300026089 Bacteria 2628
167 Ga0207683_10000371 3300026121 Bacteria 41225
168 Ga0207683_10011898 3300026121 Bacteria 7425
169 Ga0207698_10263168 3300026142 Bacteria 1585
170 Ga0265322_10005219 3300028654 Bacteria 3844
171 Ga0265338_10012446 3300028800 Bacteria 9698
172 Ga0265338_10051453 3300028800 Unclassified 3708
173 Ga0265338_10253960 3300028800 Bacteria 1296
174 Ga0265325_10016017 3300031241 Bacteria 4197
175 Ga0265329_10005422 3300031242 Bacteria 5155
176 Ga0265340_10049742 3300031247 Bacteria 2035
177 Ga0265339_10042291 3300031249 Bacteria 2523
178 Ga0265327_10014009 3300031251 Bacteria 5280
179 Ga0265327_10020347 3300031251 Bacteria 4047
180 Ga0265316_10006791 3300031344 Bacteria 10883
181 Ga0265313_10015119 3300031595 Bacteria 4517
182 Ga0265314_10070648 3300031711 Bacteria 2339
183 Ga0265342_10086899 3300031712 Bacteria 1797
184 Ga0373946_0091422 3300035171 Bacteria 1349
185 Ga0373937_0226578 3300036401 Unclassified 1760
186 Ga0395899_0020351 3300037312 Bacteria 5032
187 Ga0395899_0178675 3300037312 Unclassified 1491
188 Ga0395900_0018624 3300037418 Bacteria 7081
189 Ga0395900_0337745 3300037418 Bacteria 1483
190 Ga0395900_0441547 3300037418 Bacteria 1259
191 Ga0395898_0059698 3300037466 Bacteria 3709
192 Ga0395898_0059758 3300037466 Bacteria 3707
193 Ga0395898_0077501 3300037466 Bacteria 3209
194 Ga0395898_0117230 3300037466 Bacteria 2551
195 Ga0395898_0335006 3300037466 Unclassified 1443
196 Ga0395898_0575152 3300037466 Bacteria 1069
197 Ga0395905_0005221 3300037471 Bacteria 13294
198 Ga0395905_0017850 3300037471 Bacteria 6741
199 Ga0395905_0038167 3300037471 Bacteria 4506
200 Ga0395901_0001778 3300038443 Bacteria 22243
201 Ga0395901_0008954 3300038443 Bacteria 10136
202 Ga0395901_0078772 3300038443 Bacteria 3441
203 Ga0395901_0192310 3300038443 Bacteria 2140
204 Ga0395901_0240096 3300038443 Bacteria 1890
205 Ga0395901_0277822 3300038443 Bacteria 1741
206 Ga0439446_0050654 3300042156 Bacteria 1240
207 Ga0466963_0007736 3300044694 Bacteria 6422
208 Ga0466963_0048444 3300044694 Bacteria 2808
209 Ga0466963_0056356 3300044694 Bacteria 2615
210 Ga0466964_0010815 3300044706 Bacteria 3446
211 Ga0466964_0021424 3300044706 Bacteria 2500
212 Ga0451576_0194207 3300045051 Bacteria 2120
213 Ga0466958_0056802 3300045836 Bacteria 2379
214 Ga0466967_0036184 3300045976 Bacteria 4212
215 Ga0466967_0056270 3300045976 Bacteria 3467
216 Ga0466967_0059291 3300045976 Bacteria 3387
217 Ga0495592_0049898 3300046454 Bacteria 3110
218 Ga0495603_0017515 3300046455 Unclassified 4335
219 Ga0495603_0031071 3300046455 Bacteria 3215
220 Ga0495651_0192091 3300046462 Unclassified 1436
221 Ga0495653_0035458 3300046463 Bacteria 3937
222 Ga0495580_0050232 3300046472 Bacteria 2949
223 Ga0495582_0025840 3300046473 Unclassified 3217
224 Ga0495582_0043424 3300046473 Unclassified 2476
225 Ga0495582_0077921 3300046473 Bacteria 1838
226 Ga0495582_0134109 3300046473 Bacteria 1400
227 Ga0495662_0020998 3300046476 Bacteria 3158
228 Ga0495664_0154292 3300046477 Bacteria 1393
229 Ga0495584_0054772 3300046491 Unclassified 2007
230 Ga0495608_0136265 3300046511 Unclassified 1569
231 Ga0495618_0057284 3300046514 Bacteria 2467
232 Ga0495628_0027655 3300046516 Bacteria 4612
233 Ga0495652_0075984 3300046529 Bacteria 2788
234 Ga0495665_0178334 3300046531 Unclassified 1105
235 Ga0495640_0012742 3300046533 Bacteria 6419
236 Ga0495667_0046190 3300046559 Bacteria 2880
237 Ga0495634_0094367 3300046642 Bacteria 1939
238 Ga0495659_0065921 3300046664 Bacteria 1348
239 Ga0495623_0053086 3300046679 Bacteria 2560
240 Ga0495613_0017257 3300046689 Bacteria 5379
241 Ga0495613_0172845 3300046689 Bacteria 1533
242 Ga0495613_0246086 3300046689 Bacteria 1249
243 Ga0495600_0168296 3300046809 Bacteria 1415
244 Ga0495581_0009645 3300047315 Bacteria 5584
245 Ga0495581_0058465 3300047315 Bacteria 2227
246 Ga0495674_0000944 3300047319 Bacteria 27747
247 Ga0495674_0111624 3300047319 Bacteria 2317
248 Ga0495674_0392927 3300047319 Bacteria 1121
249 Ga0495676_0031375 3300047321 Bacteria 4496
250 Ga0495676_0036492 3300047321 Bacteria 4104
251 Ga0495680_0000491 3300047322 Bacteria 44586
252 Ga0495680_0097870 3300047322 Bacteria 2190
253 Ga0495684_0034251 3300047471 Bacteria 3897
254 Ga0496100_0011860 3300048903 Bacteria 4975
255 Ga0496100_0017110 3300048903 Bacteria 4274
256 Ga0496100_0019682 3300048903 Bacteria 4032
257 Ga0496100_0021953 3300048903 Bacteria 3854
258 Ga0496100_0106632 3300048903 Unclassified 1940
259 Ga0496100_0120490 3300048903 Unclassified 1835
260 Ga0496101_0004404 3300048904 Bacteria 8853
261 Ga0496101_0006382 3300048904 Bacteria 7588
262 Ga0496101_0023288 3300048904 Unclassified 4277
263 Ga0496101_0045709 3300048904 Bacteria 3137
264 Ga0496101_0154239 3300048904 Bacteria 1758
265 Ga0496101_0306446 3300048904 Unclassified 1245
266 Ga0496102_0026664 3300048905 Bacteria 5157
267 Ga0496102_0060363 3300048905 Bacteria 3468
268 Ga0496102_0107755 3300048905 Unclassified 2594
269 Ga0496103_0067736 3300048906 Bacteria 2230
270 Ga0496103_0144289 3300048906 Unclassified 1523
271 Ga0496104_0001034 3300048907 Bacteria 23804
272 Ga0496104_0002034 3300048907 Bacteria 17569
273 Ga0496104_0003577 3300048907 Bacteria 13415
274 Ga0496104_0020881 3300048907 Bacteria 6006
275 Ga0496104_0066013 3300048907 Unclassified 3435
276 Ga0496104_0067296 3300048907 Bacteria 3403
277 Ga0496104_0111647 3300048907 Unclassified 2621
278 Ga0496104_0505143 3300048907 Bacteria 1120
279 Ga0496105_0000050 3300048908 Bacteria 93402
280 Ga0496105_0010091 3300048908 Bacteria 7415
281 Ga0496105_0030063 3300048908 Unclassified 4450
282 Ga0496105_0039372 3300048908 Bacteria 3896
283 Ga0496105_0043140 3300048908 Bacteria 3720
284 Ga0496105_0049088 3300048908 Bacteria 3484
285 Ga0496105_0165494 3300048908 Unclassified 1814
286 Ga0496105_0169546 3300048908 Bacteria 1790
287 Ga0496106_0003308 3300048909 Bacteria 12017
288 Ga0496106_0028289 3300048909 Bacteria 4175
289 Ga0496106_0036254 3300048909 Bacteria 3689
290 Ga0496107_0002187 3300048910 Bacteria 12564
291 Ga0496107_0051476 3300048910 Bacteria 2970
292 Ga0496107_0126027 3300048910 Bacteria 1889
293 Ga0496108_0003667 3300048911 Bacteria 12319
294 Ga0496108_0005215 3300048911 Bacteria 10498
295 Ga0496108_0021220 3300048911 Bacteria 5337
296 Ga0496108_0030770 3300048911 Bacteria 4448
297 Ga0496108_0092424 3300048911 Bacteria 2573
298 Ga0496109_0001247 3300048912 Bacteria 21102
299 Ga0496109_0001424 3300048912 Bacteria 19854
300 Ga0496109_0002945 3300048912 Bacteria 14249
301 Ga0496109_0004651 3300048912 Bacteria 11458
302 Ga0496109_0006229 3300048912 Bacteria 10032
303 Ga0496109_0022108 3300048912 Bacteria 5629
304 Ga0496109_0214549 3300048912 Bacteria 1810
305 Ga0496110_0000090 3300048913 Bacteria 48256
306 Ga0496110_0002214 3300048913 Bacteria 14529
307 Ga0496110_0005481 3300048913 Bacteria 9950
308 Ga0496110_0031497 3300048913 Bacteria 4576
309 Ga0496110_0067811 3300048913 Bacteria 3157
310 Ga0496110_0621831 3300048913 Bacteria 979
311 Ga0496111_0000078 3300048914 Bacteria 40619
312 Ga0496111_0000240 3300048914 Bacteria 26236
313 Ga0496111_0010294 3300048914 Bacteria 6267
314 Ga0496111_0030334 3300048914 Bacteria 3845
315 Ga0496112_0015217 3300048915 Bacteria 7170
316 Ga0496112_0028350 3300048915 Bacteria 5404
317 Ga0496112_0098840 3300048915 Bacteria 2888
318 Ga0496112_0536341 3300048915 Bacteria 1104
319 Ga0496113_0015494 3300048916 Bacteria 5242
320 Ga0496113_0142280 3300048916 Unclassified 1888
321 Ga0496113_0144775 3300048916 Bacteria 1871
322 Ga0496114_0001055 3300048917 Bacteria 20710
323 Ga0496114_0002175 3300048917 Bacteria 14929
324 Ga0496114_0003237 3300048917 Bacteria 12491
325 Ga0496114_0085835 3300048917 Bacteria 2666
326 Ga0496114_0119045 3300048917 Bacteria 2270
327 Ga0496114_0149163 3300048917 Unclassified 2028
328 Ga0496114_0159139 3300048917 Unclassified 1962
329 Ga0496115_0001930 3300048918 Bacteria 14798
330 Ga0496115_0003007 3300048918 Bacteria 12105
331 Ga0496115_0003301 3300048918 Bacteria 11584
332 Ga0496115_0124846 3300048918 Bacteria 2120
333 Ga0496115_0130654 3300048918 Bacteria 2070
334 Ga0496115_0284518 3300048918 Bacteria 1357
335 Ga0501031_0011061 3300049568 Bacteria 5881
336 Ga0501033_0002606 3300049570 Bacteria 15195
337 Ga0501036_0085776 3300049572 Bacteria 2661
338 Ga0501036_0104809 3300049572 Bacteria 2391
339 Ga0501036_0385561 3300049572 Bacteria 1169
340 Ga0501037_0002116 3300049573 Bacteria 14379
341 Ga0501038_0001738 3300049574 Bacteria 20249
342 Ga0501039_0034121 3300049575 Bacteria 3927
343 Ga0501039_0067376 3300049575 Bacteria 2779
344 Ga0501040_0007206 3300049576 Bacteria 7200
345 Ga0501040_0047536 3300049576 Bacteria 2930
346 Ga0501041_0100198 3300049577 Bacteria 1793
347 Ga0501042_0009923 3300049578 Bacteria 6362
348 Ga0501042_0084466 3300049578 Bacteria 2276
349 Ga0501042_0183749 3300049578 Bacteria 1508
350 Ga0501043_0001426 3300049579 Bacteria 20883
351 Ga0501046_0009699 3300049580 Bacteria 8305
352 Ga0501047_0133362 3300049581 Bacteria 2364
353 Ga0501048_0008064 3300049582 Bacteria 7974
354 Ga0501067_0001229 3300049583 Bacteria 13920
355 Ga0501067_0040735 3300049583 Bacteria 2579
356 Ga0501068_0000470 3300049584 Bacteria 20365
357 Ga0501068_0087049 3300049584 Bacteria 1924
358 Ga0501069_0000321 3300049585 Bacteria 21720
359 Ga0501069_0003463 3300049585 Bacteria 8122
360 Ga0501069_0025367 3300049585 Bacteria 3239
361 Ga0501069_0034647 3300049585 Bacteria 2780
362 Ga0501070_0000190 3300049586 Bacteria 57730
363 Ga0501070_0001965 3300049586 Bacteria 18128
364 Ga0501072_0009029 3300049588 Bacteria 7576
365 Ga0501074_0007408 3300049590 Bacteria 7938
366 Ga0501074_0079818 3300049590 Bacteria 2348
367 Ga0501075_0009976 3300049591 Bacteria 6658
368 Ga0501075_0064987 3300049591 Bacteria 2752
369 Ga0501075_0112827 3300049591 Bacteria 2067
370 Ga0501075_0159805 3300049591 Bacteria 1719
371 Ga0501076_0010935 3300049592 Bacteria 6749
372 Ga0501076_0093540 3300049592 Bacteria 2419
373 Ga0501076_0216712 3300049592 Bacteria 1565
374 Ga0501077_0005513 3300049593 Bacteria 7696
375 Ga0501077_0006243 3300049593 Bacteria 7287
376 Ga0501077_0182291 3300049593 Bacteria 1334
377 Ga0501079_0038644 3300049741 Bacteria 3680
378 Ga0501079_0039326 3300049741 Bacteria 3648
379 Ga0501079_0102200 3300049741 Bacteria 2223
380 Ga0501080_0003557 3300049742 Bacteria 13706
381 Ga0501080_0184780 3300049742 Bacteria 1917
382 Ga0501080_0416452 3300049742 Bacteria 1207
383 Ga0501081_0111296 3300049743 Bacteria 1943
384 Ga0501083_0011363 3300049744 Bacteria 6245
385 Ga0501035_0017380 3300049822 Bacteria 6632
386 Ga0501035_0261804 3300049822 Bacteria 1466
387 Ga0501044_0139285 3300049823 Bacteria 2415
388 Ga0501045_0002560 3300049824 Bacteria 12395
389 nmdc:mga05p37_10836_c1 3300050507 Bacteria 10825
390 nmdc:mga0n895_179971_c1 3300050512 Bacteria 2145
391 nmdc:mga0n895_279604_c2 3300050512 Bacteria 1289
392 nmdc:mga08x19_403023_c1 3300050514 Bacteria 960
393 nmdc:mga0a205_65652_c1 3300050515 Bacteria 3506
394 nmdc:mga0a205_68354_c1 3300050515 Bacteria 3432
395 Ga0495601_0073587 3300053077 Bacteria 2185
396 Ga0495595_0195981 3300053084 Bacteria 1005
397 Ga0495619_0012401 3300053085 Bacteria 5367
398 Ga0501084_0020475 3300054114 Bacteria 5516
399 Ga0501084_0041532 3300054114 Bacteria 3848
400 Ga0501084_0221439 3300054114 Bacteria 1597
401 Ga0501082_0019734 3300060353 Bacteria 5812
402 Ga0501082_0047827 3300060353 Bacteria 3686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100311532 Ga0070669_1003115322 276
2 3300026067 Ga0207678_10603079 Ga0207678_106030792 277
3 3300047319 Ga0495674_0392927 Ga0495674_0392927_239_1105 277
4 3300048913 Ga0496110_0621831 Ga0496110_0621831_24_857 277
5 3300048918 Ga0496115_0284518 Ga0496115_0284518_52_885 277
6 3300050514 nmdc:mga08x19_403023_c1 nmdc:mga08x19_403023_c1_98_931 277
7 3300053084 Ga0495595_0195981 Ga0495595_0195981_154_993 277
8 3300054114 Ga0501084_0221439 Ga0501084_0221439_719_1585 277
9 3300037418 Ga0395900_0441547 Ga0395900_0441547_18_938 293
10 3300046473 Ga0495582_0043424 Ga0495582_0043424_34_915 293
11 3300046531 Ga0495665_0178334 Ga0495665_0178334_25_906 293
12 3300048906 Ga0496103_0144289 Ga0496103_0144289_620_1501 293
13 3300050512 nmdc:mga0n895_179971_c1 nmdc:mga0n895_179971_c1_597_1559 294
14 3300006852 Ga0075433_10330519 Ga0075433_103305192 300
15 3300013308 Ga0157375_10172625 Ga0157375_101726253 306
16 3300028800 Ga0265338_10253960 Ga0265338_102539601 307
17 3300005614 Ga0068856_100030805 Ga0068856_1000308053 309
18 3300006237 Ga0097621_100154245 Ga0097621_1001542454 309
19 3300009098 Ga0105245_10023305 Ga0105245_100233052 309
20 3300026078 Ga0207702_10089693 Ga0207702_100896933 309
21 3300048903 Ga0496100_0021953 Ga0496100_0021953_1734_2720 309
22 3300048907 Ga0496104_0001034 Ga0496104_0001034_9792_10778 309
23 3300048908 Ga0496105_0000050 Ga0496105_0000050_30954_31940 309
24 3300048911 Ga0496108_0003667 Ga0496108_0003667_6900_7886 309
25 3300048912 Ga0496109_0002945 Ga0496109_0002945_2898_3884 309
26 3300048913 Ga0496110_0000090 Ga0496110_0000090_13252_14238 309
27 3300048914 Ga0496111_0000078 Ga0496111_0000078_13379_14365 309
28 3300048917 Ga0496114_0003237 Ga0496114_0003237_2556_3542 309
29 3300044694 Ga0466963_0007736 Ga0466963_0007736_2551_3552 312
30 3300049593 Ga0501077_0005513 Ga0501077_0005513_1309_2313 314
31 3300005329 Ga0070683_100010660 Ga0070683_1000106605 316
32 3300005336 Ga0070680_100106635 Ga0070680_1001066353 316
33 3300005337 Ga0070682_100075668 Ga0070682_1000756683 316
34 3300005341 Ga0070691_10110603 Ga0070691_101106032 316
35 3300005458 Ga0070681_10010772 Ga0070681_100107727 316
36 3300005459 Ga0068867_100168854 Ga0068867_1001688541 316
37 3300005530 Ga0070679_100045082 Ga0070679_1000450823 316
38 3300005564 Ga0070664_100067600 Ga0070664_1000676002 316
39 3300009098 Ga0105245_10071082 Ga0105245_100710824 316
40 3300009148 Ga0105243_10336536 Ga0105243_103365362 316
41 3300010375 Ga0105239_10086664 Ga0105239_100866642 316
42 3300011119 Ga0105246_10116534 Ga0105246_101165341 316
43 3300013306 Ga0163162_10399161 Ga0163162_103991612 316
44 3300013307 Ga0157372_10271022 Ga0157372_102710222 316
45 3300025911 Ga0207654_10031320 Ga0207654_100313203 316
46 3300025912 Ga0207707_10008921 Ga0207707_100089215 316
47 3300025917 Ga0207660_10092461 Ga0207660_100924612 316
48 3300025921 Ga0207652_10030697 Ga0207652_100306973 316
49 3300025927 Ga0207687_10012584 Ga0207687_100125842 316
50 3300025927 Ga0207687_10289457 Ga0207687_102894572 316
51 3300025935 Ga0207709_10152517 Ga0207709_101525172 316
52 3300025944 Ga0207661_10008982 Ga0207661_100089825 316
53 3300026023 Ga0207677_10010112 Ga0207677_100101122 316
54 3300026078 Ga0207702_10049234 Ga0207702_100492344 316
55 3300026078 Ga0207702_10234644 Ga0207702_102346443 316
56 3300026089 Ga0207648_10093582 Ga0207648_100935824 316
57 3300026121 Ga0207683_10011898 Ga0207683_100118982 316
58 3300042156 Ga0439446_0050654 Ga0439446_0050654_109_1104 316
59 3300048903 Ga0496100_0017110 Ga0496100_0017110_2212_3198 316
60 3300048904 Ga0496101_0004404 Ga0496101_0004404_7715_8701 316
61 3300048904 Ga0496101_0023288 Ga0496101_0023288_2605_3591 316
62 3300048905 Ga0496102_0026664 Ga0496102_0026664_780_1766 316
63 3300048907 Ga0496104_0002034 Ga0496104_0002034_190_1176 316
64 3300048907 Ga0496104_0111647 Ga0496104_0111647_766_1752 316
65 3300048908 Ga0496105_0039372 Ga0496105_0039372_2360_3346 316
66 3300048912 Ga0496109_0022108 Ga0496109_0022108_1089_2075 316
67 3300048913 Ga0496110_0067811 Ga0496110_0067811_347_1333 316
68 3300048914 Ga0496111_0030334 Ga0496111_0030334_1892_2878 316
69 3300048917 Ga0496114_0002175 Ga0496114_0002175_7607_8593 316
70 3300048917 Ga0496114_0149163 Ga0496114_0149163_368_1354 316
71 3300048918 Ga0496115_0003301 Ga0496115_0003301_4537_5523 316
72 3300005535 Ga0070684_100187449 Ga0070684_1001874491 317
73 3300009551 Ga0105238_10193378 Ga0105238_101933782 317
74 3300009553 Ga0105249_10140429 Ga0105249_101404292 317
75 3300013105 Ga0157369_10191779 Ga0157369_101917793 317
76 3300046642 Ga0495634_0094367 Ga0495634_0094367_569_1552 317
77 3300048907 Ga0496104_0505143 Ga0496104_0505143_121_1107 317
78 3300048908 Ga0496105_0043140 Ga0496105_0043140_2038_3024 317
79 3300049576 Ga0501040_0047536 Ga0501040_0047536_436_1422 317
80 3300049583 Ga0501067_0040735 Ga0501067_0040735_265_1227 317
81 3300049585 Ga0501069_0025367 Ga0501069_0025367_890_1852 317
82 3300049741 Ga0501079_0102200 Ga0501079_0102200_535_1521 317
83 3300060353 Ga0501082_0047827 Ga0501082_0047827_1564_2550 317
84 3300009177 Ga0105248_10344773 Ga0105248_103447732 318
85 3300044706 Ga0466964_0010815 Ga0466964_0010815_527_1546 319
86 3300045836 Ga0466958_0056802 Ga0466958_0056802_1138_2157 319
87 3300009093 Ga0105240_10276291 Ga0105240_102762913 322
88 3300013104 Ga0157370_10062047 Ga0157370_100620473 322
89 3300013105 Ga0157369_10015472 Ga0157369_100154725 322
90 3300020081 Ga0206354_10171663 Ga0206354_101716632 322
91 3300020082 Ga0206353_11427553 Ga0206353_114275531 322
92 3300025909 Ga0207705_10076250 Ga0207705_100762502 322
93 3300025944 Ga0207661_10088310 Ga0207661_100883102 322
94 3300025944 Ga0207661_10090825 Ga0207661_100908252 322
95 3300044706 Ga0466964_0021424 Ga0466964_0021424_1406_2389 322
96 3300045976 Ga0466967_0056270 Ga0466967_0056270_869_1852 322
97 3300048904 Ga0496101_0154239 Ga0496101_0154239_108_1076 322
98 3300048915 Ga0496112_0536341 Ga0496112_0536341_104_1090 322
99 3300049568 Ga0501031_0011061 Ga0501031_0011061_4780_5784 322
100 3300049570 Ga0501033_0002606 Ga0501033_0002606_2773_3777 322
101 3300049572 Ga0501036_0085776 Ga0501036_0085776_1560_2564 322
102 3300049572 Ga0501036_0385561 Ga0501036_0385561_98_1099 322
103 3300049573 Ga0501037_0002116 Ga0501037_0002116_11971_12975 322
104 3300049574 Ga0501038_0001738 Ga0501038_0001738_18129_19133 322
105 3300049575 Ga0501039_0067376 Ga0501039_0067376_88_1092 322
106 3300049576 Ga0501040_0007206 Ga0501040_0007206_5244_6248 322
107 3300049578 Ga0501042_0009923 Ga0501042_0009923_308_1312 322
108 3300049579 Ga0501043_0001426 Ga0501043_0001426_9987_10991 322
109 3300049580 Ga0501046_0009699 Ga0501046_0009699_2645_3649 322
110 3300049582 Ga0501048_0008064 Ga0501048_0008064_2092_3096 322
111 3300049584 Ga0501068_0000470 Ga0501068_0000470_8186_9190 322
112 3300049585 Ga0501069_0000321 Ga0501069_0000321_12390_13394 322
113 3300049586 Ga0501070_0001965 Ga0501070_0001965_5018_6022 322
114 3300049588 Ga0501072_0009029 Ga0501072_0009029_4880_5884 322
115 3300049590 Ga0501074_0007408 Ga0501074_0007408_6512_7516 322
116 3300049591 Ga0501075_0009976 Ga0501075_0009976_1693_2697 322
117 3300049591 Ga0501075_0112827 Ga0501075_0112827_171_1172 322
118 3300049592 Ga0501076_0010935 Ga0501076_0010935_4629_5633 322
119 3300049592 Ga0501076_0093540 Ga0501076_0093540_120_1121 322
120 3300049593 Ga0501077_0006243 Ga0501077_0006243_4880_5884 322
121 3300049593 Ga0501077_0182291 Ga0501077_0182291_238_1233 322
122 3300049741 Ga0501079_0038644 Ga0501079_0038644_1117_2121 322
123 3300049742 Ga0501080_0003557 Ga0501080_0003557_12082_13086 322
124 3300049744 Ga0501083_0011363 Ga0501083_0011363_1456_2460 322
125 3300049822 Ga0501035_0017380 Ga0501035_0017380_1560_2564 322
126 3300049824 Ga0501045_0002560 Ga0501045_0002560_11293_12297 322
127 3300054114 Ga0501084_0020475 Ga0501084_0020475_4090_5094 322
128 3300060353 Ga0501082_0019734 Ga0501082_0019734_180_1184 322
129 3300005548 Ga0070665_100220931 Ga0070665_1002209312 323
130 3300044694 Ga0466963_0056356 Ga0466963_0056356_1234_2220 324
131 3300044694 Ga0466963_0048444 Ga0466963_0048444_1045_2034 325
132 3300045976 Ga0466967_0036184 Ga0466967_0036184_538_1527 325
133 3300046454 Ga0495592_0049898 Ga0495592_0049898_1900_2910 325
134 3300046463 Ga0495653_0035458 Ga0495653_0035458_194_1204 325
135 3300046473 Ga0495582_0077921 Ga0495582_0077921_168_1178 325
136 3300046476 Ga0495662_0020998 Ga0495662_0020998_1986_2996 325
137 3300046514 Ga0495618_0057284 Ga0495618_0057284_834_1844 325
138 3300046516 Ga0495628_0027655 Ga0495628_0027655_1573_2583 325
139 3300046533 Ga0495640_0012742 Ga0495640_0012742_2705_3715 325
140 3300046559 Ga0495667_0046190 Ga0495667_0046190_1119_2129 325
141 3300046679 Ga0495623_0053086 Ga0495623_0053086_664_1674 325
142 3300046689 Ga0495613_0017257 Ga0495613_0017257_666_1676 325
143 3300046809 Ga0495600_0168296 Ga0495600_0168296_357_1367 325
144 3300047315 Ga0495581_0058465 Ga0495581_0058465_940_1950 325
145 3300047319 Ga0495674_0000944 Ga0495674_0000944_25022_26032 325
146 3300047322 Ga0495680_0000491 Ga0495680_0000491_18555_19565 325
147 3300047471 Ga0495684_0034251 Ga0495684_0034251_1950_2960 325
148 3300048917 Ga0496114_0119045 Ga0496114_0119045_850_1854 325
149 3300048918 Ga0496115_0130654 Ga0496115_0130654_938_1948 325
150 3300049581 Ga0501047_0133362 Ga0501047_0133362_931_1920 325
151 3300049585 Ga0501069_0034647 Ga0501069_0034647_1605_2597 325
152 3300049586 Ga0501070_0000190 Ga0501070_0000190_1253_2245 325
153 3300049742 Ga0501080_0416452 Ga0501080_0416452_176_1165 325
154 3300049822 Ga0501035_0261804 Ga0501035_0261804_48_1037 325
155 3300053077 Ga0495601_0073587 Ga0495601_0073587_805_1815 325
156 3300053085 Ga0495619_0012401 Ga0495619_0012401_1866_2876 325
157 3300009176 Ga0105242_10460473 Ga0105242_104604732 326
158 3300025934 Ga0207686_10277858 Ga0207686_102778581 326
159 3300025935 Ga0207709_10083424 Ga0207709_100834241 326
160 3300025944 Ga0207661_10164059 Ga0207661_101640592 326
161 3300037466 Ga0395898_0335006 Ga0395898_0335006_192_1178 326
162 3300037466 Ga0395898_0575152 Ga0395898_0575152_47_1033 326
163 3300038443 Ga0395901_0240096 Ga0395901_0240096_43_1029 326
164 3300047319 Ga0495674_0111624 Ga0495674_0111624_255_1241 326
165 3300048903 Ga0496100_0120490 Ga0496100_0120490_243_1229 326
166 3300048907 Ga0496104_0067296 Ga0496104_0067296_2066_3052 326
167 3300048908 Ga0496105_0165494 Ga0496105_0165494_345_1331 326
168 3300048910 Ga0496107_0126027 Ga0496107_0126027_13_999 326
169 3300048911 Ga0496108_0021220 Ga0496108_0021220_1510_2496 326
170 3300048912 Ga0496109_0001247 Ga0496109_0001247_3390_4376 326
171 3300048913 Ga0496110_0002214 Ga0496110_0002214_7760_8746 326
172 3300048914 Ga0496111_0000240 Ga0496111_0000240_18243_19229 326
173 3300048916 Ga0496113_0015494 Ga0496113_0015494_1776_2762 326
174 3300048917 Ga0496114_0085835 Ga0496114_0085835_1289_2275 326
175 3300049577 Ga0501041_0100198 Ga0501041_0100198_786_1772 326
176 3300037312 Ga0395899_0020351 Ga0395899_0020351_4005_5003 327
177 3300037471 Ga0395905_0038167 Ga0395905_0038167_3313_4311 327
178 3300038443 Ga0395901_0008954 Ga0395901_0008954_2784_3782 327
179 3300036401 Ga0373937_0226578 Ga0373937_0226578_470_1468 328
180 3300046462 Ga0495651_0192091 Ga0495651_0192091_86_1084 328
181 3300046477 Ga0495664_0154292 Ga0495664_0154292_354_1352 328
182 3300046511 Ga0495608_0136265 Ga0495608_0136265_450_1448 328
183 3300046529 Ga0495652_0075984 Ga0495652_0075984_1605_2603 328
184 3300047322 Ga0495680_0097870 Ga0495680_0097870_125_1123 328
185 3300049572 Ga0501036_0104809 Ga0501036_0104809_220_1233 328
186 3300049575 Ga0501039_0034121 Ga0501039_0034121_1539_2552 328
187 3300049578 Ga0501042_0084466 Ga0501042_0084466_233_1246 328
188 3300049578 Ga0501042_0183749 Ga0501042_0183749_479_1498 328
189 3300049584 Ga0501068_0087049 Ga0501068_0087049_722_1735 328
190 3300049590 Ga0501074_0079818 Ga0501074_0079818_193_1206 328
191 3300049591 Ga0501075_0064987 Ga0501075_0064987_578_1591 328
192 3300049741 Ga0501079_0039326 Ga0501079_0039326_2109_3122 328
193 3300049742 Ga0501080_0184780 Ga0501080_0184780_115_1122 328
194 3300054114 Ga0501084_0041532 Ga0501084_0041532_2661_3674 328
195 3300005445 Ga0070708_100041394 Ga0070708_1000413943 329
196 3300005614 Ga0068856_100244868 Ga0068856_1002448681 329
197 3300013296 Ga0157374_10198782 Ga0157374_101987822 329
198 3300025915 Ga0207693_10015488 Ga0207693_100154882 329
199 3300025927 Ga0207687_10210408 Ga0207687_102104082 329
200 3300048903 Ga0496100_0011860 Ga0496100_0011860_1011_2015 329
201 3300048904 Ga0496101_0006382 Ga0496101_0006382_283_1287 329
202 3300048907 Ga0496104_0003577 Ga0496104_0003577_9342_10346 329
203 3300048908 Ga0496105_0049088 Ga0496105_0049088_2319_3323 329
204 3300048911 Ga0496108_0030770 Ga0496108_0030770_2330_3334 329
205 3300048912 Ga0496109_0004651 Ga0496109_0004651_764_1768 329
206 3300048913 Ga0496110_0005481 Ga0496110_0005481_693_1697 329
207 3300048915 Ga0496112_0098840 Ga0496112_0098840_982_1986 329
208 3300048917 Ga0496114_0001055 Ga0496114_0001055_12708_13712 329
209 3300048918 Ga0496115_0001930 Ga0496115_0001930_3675_4679 329
210 3300005329 Ga0070683_100033669 Ga0070683_1000336692 330
211 3300005339 Ga0070660_100009902 Ga0070660_1000099024 330
212 3300005344 Ga0070661_100091534 Ga0070661_1000915344 330
213 3300005530 Ga0070679_100027597 Ga0070679_1000275976 330
214 3300005536 Ga0070697_100027408 Ga0070697_1000274085 330
215 3300005563 Ga0068855_100005352 Ga0068855_10000535212 330
216 3300005563 Ga0068855_100115414 Ga0068855_1001154144 330
217 3300009093 Ga0105240_10058319 Ga0105240_100583194 330
218 3300013104 Ga0157370_10016647 Ga0157370_100166475 330
219 3300013105 Ga0157369_10065773 Ga0157369_100657734 330
220 3300020070 Ga0206356_10625028 Ga0206356_106250282 330
221 3300020082 Ga0206353_11717398 Ga0206353_117173984 330
222 3300025909 Ga0207705_10005937 Ga0207705_1000593711 330
223 3300025917 Ga0207660_10013947 Ga0207660_100139472 330
224 3300025919 Ga0207657_10014652 Ga0207657_100146524 330
225 3300025919 Ga0207657_10033954 Ga0207657_100339544 330
226 3300025920 Ga0207649_10120283 Ga0207649_101202831 330
227 3300025921 Ga0207652_10008538 Ga0207652_100085381 330
228 3300025944 Ga0207661_10154015 Ga0207661_101540152 330
229 3300035171 Ga0373946_0091422 Ga0373946_0091422_227_1249 330
230 3300045976 Ga0466967_0059291 Ga0466967_0059291_1180_2217 330
231 3300046455 Ga0495603_0031071 Ga0495603_0031071_413_1435 330
232 3300046472 Ga0495580_0050232 Ga0495580_0050232_507_1529 330
233 3300046473 Ga0495582_0134109 Ga0495582_0134109_315_1337 330
234 3300047321 Ga0495676_0036492 Ga0495676_0036492_477_1499 330
235 3300049583 Ga0501067_0001229 Ga0501067_0001229_170_1171 330
236 3300049585 Ga0501069_0003463 Ga0501069_0003463_5030_6031 330
237 3300025915 Ga0207693_10062055 Ga0207693_100620553 331
238 3300028654 Ga0265322_10005219 Ga0265322_100052193 331
239 3300028800 Ga0265338_10012446 Ga0265338_100124462 331
240 3300031241 Ga0265325_10016017 Ga0265325_100160175 331
241 3300031242 Ga0265329_10005422 Ga0265329_100054224 331
242 3300031247 Ga0265340_10049742 Ga0265340_100497422 331
243 3300031249 Ga0265339_10042291 Ga0265339_100422914 331
244 3300031251 Ga0265327_10014009 Ga0265327_100140095 331
245 3300031251 Ga0265327_10020347 Ga0265327_100203474 331
246 3300031344 Ga0265316_10006791 Ga0265316_100067917 331
247 3300031595 Ga0265313_10015119 Ga0265313_100151194 331
248 3300031711 Ga0265314_10070648 Ga0265314_100706482 331
249 3300031712 Ga0265342_10086899 Ga0265342_100868992 331
250 3300045051 Ga0451576_0194207 Ga0451576_0194207_45_1061 331
251 3300048903 Ga0496100_0106632 Ga0496100_0106632_295_1290 331
252 3300048904 Ga0496101_0306446 Ga0496101_0306446_180_1175 331
253 3300048908 Ga0496105_0169546 Ga0496105_0169546_107_1120 331
254 3300049823 Ga0501044_0139285 Ga0501044_0139285_1280_2311 331
255 3300002244 JGI24742J22300_10010453 JGI24742J22300_100104532 332
256 3300005330 Ga0070690_100005734 Ga0070690_1000057344 332
257 3300005333 Ga0070677_10076293 Ga0070677_100762932 332
258 3300005336 Ga0070680_100055640 Ga0070680_1000556405 332
259 3300005336 Ga0070680_100103790 Ga0070680_1001037903 332
260 3300005337 Ga0070682_100011772 Ga0070682_1000117725 332
261 3300005338 Ga0068868_100026785 Ga0068868_1000267854 332
262 3300005339 Ga0070660_100127147 Ga0070660_1001271473 332
263 3300005340 Ga0070689_100061734 Ga0070689_1000617342 332
264 3300005345 Ga0070692_10020141 Ga0070692_100201412 332
265 3300005347 Ga0070668_100034276 Ga0070668_1000342761 332
266 3300005354 Ga0070675_100217355 Ga0070675_1002173553 332
267 3300005356 Ga0070674_100126445 Ga0070674_1001264452 332
268 3300005364 Ga0070673_100178181 Ga0070673_1001781812 332
269 3300005366 Ga0070659_100054394 Ga0070659_1000543942 332
270 3300005434 Ga0070709_10039647 Ga0070709_100396473 332
271 3300005435 Ga0070714_100202629 Ga0070714_1002026293 332
272 3300005437 Ga0070710_10033882 Ga0070710_100338824 332
273 3300005438 Ga0070701_10005898 Ga0070701_100058982 332
274 3300005439 Ga0070711_100006848 Ga0070711_1000068482 332
275 3300005441 Ga0070700_100007469 Ga0070700_1000074692 332
276 3300005444 Ga0070694_100047499 Ga0070694_1000474994 332
277 3300005455 Ga0070663_100018281 Ga0070663_1000182815 332
278 3300005459 Ga0068867_100010996 Ga0068867_1000109963 332
279 3300005466 Ga0070685_10027118 Ga0070685_100271185 332
280 3300005467 Ga0070706_100260743 Ga0070706_1002607432 332
281 3300005468 Ga0070707_100207313 Ga0070707_1002073134 332
282 3300005543 Ga0070672_100004936 Ga0070672_1000049363 332
283 3300005544 Ga0070686_100019522 Ga0070686_1000195222 332
284 3300005545 Ga0070695_100067083 Ga0070695_1000670833 332
285 3300005546 Ga0070696_100120902 Ga0070696_1001209022 332
286 3300005547 Ga0070693_100103600 Ga0070693_1001036002 332
287 3300005548 Ga0070665_100003419 Ga0070665_10000341918 332
288 3300005578 Ga0068854_100321823 Ga0068854_1003218231 332
289 3300005615 Ga0070702_100015435 Ga0070702_1000154355 332
290 3300005616 Ga0068852_100008885 Ga0068852_1000088851 332
291 3300005617 Ga0068859_100315498 Ga0068859_1003154982 332
292 3300005618 Ga0068864_100183108 Ga0068864_1001831083 332
293 3300005718 Ga0068866_10005511 Ga0068866_100055114 332
294 3300005842 Ga0068858_100086022 Ga0068858_1000860222 332
295 3300006058 Ga0075432_10019857 Ga0075432_100198573 332
296 3300006175 Ga0070712_100175451 Ga0070712_1001754512 332
297 3300006237 Ga0097621_100055999 Ga0097621_1000559993 332
298 3300006358 Ga0068871_100006377 Ga0068871_1000063772 332
299 3300006852 Ga0075433_10017294 Ga0075433_100172943 332
300 3300006871 Ga0075434_100013806 Ga0075434_1000138063 332
301 3300006871 Ga0075434_100031031 Ga0075434_1000310314 332
302 3300006881 Ga0068865_100065685 Ga0068865_1000656853 332
303 3300006914 Ga0075436_100001566 Ga0075436_10000156613 332
304 3300006931 Ga0097620_100315494 Ga0097620_1003154942 332
305 3300007076 Ga0075435_100007518 Ga0075435_1000075187 332
306 3300009098 Ga0105245_10134746 Ga0105245_101347463 332
307 3300009101 Ga0105247_10192412 Ga0105247_101924122 332
308 3300009147 Ga0114129_10013022 Ga0114129_100130229 332
309 3300009174 Ga0105241_10101879 Ga0105241_101018793 332
310 3300009177 Ga0105248_10034471 Ga0105248_100344713 332
311 3300009553 Ga0105249_10001347 Ga0105249_1000134718 332
312 3300010375 Ga0105239_10009547 Ga0105239_100095473 332
313 3300013105 Ga0157369_10505708 Ga0157369_105057081 332
314 3300013296 Ga0157374_10007016 Ga0157374_1000701611 332
315 3300013297 Ga0157378_10006940 Ga0157378_100069409 332
316 3300013306 Ga0163162_10011880 Ga0163162_100118802 332
317 3300013308 Ga0157375_10111172 Ga0157375_101111723 332
318 3300014326 Ga0157380_10186130 Ga0157380_101861302 332
319 3300014745 Ga0157377_10004788 Ga0157377_100047884 332
320 3300014969 Ga0157376_10043956 Ga0157376_100439563 332
321 3300020070 Ga0206356_10005950 Ga0206356_100059502 332
322 3300020082 Ga0206353_11788903 Ga0206353_117889034 332
323 3300025901 Ga0207688_10065715 Ga0207688_100657153 332
324 3300025906 Ga0207699_10015849 Ga0207699_100158493 332
325 3300025911 Ga0207654_10040644 Ga0207654_100406442 332
326 3300025915 Ga0207693_10001176 Ga0207693_100011768 332
327 3300025916 Ga0207663_10181615 Ga0207663_101816152 332
328 3300025917 Ga0207660_10071979 Ga0207660_100719793 332
329 3300025926 Ga0207659_10155924 Ga0207659_101559243 332
330 3300025931 Ga0207644_10032152 Ga0207644_100321523 332
331 3300025931 Ga0207644_10069118 Ga0207644_100691184 332
332 3300025932 Ga0207690_10208528 Ga0207690_102085282 332
333 3300025934 Ga0207686_10015963 Ga0207686_100159635 332
334 3300025935 Ga0207709_10157180 Ga0207709_101571801 332
335 3300025935 Ga0207709_10157625 Ga0207709_101576252 332
336 3300025937 Ga0207669_10066596 Ga0207669_100665963 332
337 3300025938 Ga0207704_10005166 Ga0207704_100051662 332
338 3300025940 Ga0207691_10007187 Ga0207691_1000718712 332
339 3300025941 Ga0207711_10151872 Ga0207711_101518723 332
340 3300025961 Ga0207712_10148331 Ga0207712_101483313 332
341 3300026067 Ga0207678_10004730 Ga0207678_1000473010 332
342 3300026075 Ga0207708_10001288 Ga0207708_1000128813 332
343 3300026089 Ga0207648_10000136 Ga0207648_1000013666 332
344 3300026121 Ga0207683_10000371 Ga0207683_1000037127 332
345 3300026142 Ga0207698_10263168 Ga0207698_102631682 332
346 3300028800 Ga0265338_10051453 Ga0265338_100514535 332
347 3300037312 Ga0395899_0178675 Ga0395899_0178675_63_1061 332
348 3300037418 Ga0395900_0018624 Ga0395900_0018624_135_1133 332
349 3300037418 Ga0395900_0337745 Ga0395900_0337745_307_1344 332
350 3300037466 Ga0395898_0059698 Ga0395898_0059698_207_1205 332
351 3300037466 Ga0395898_0059758 Ga0395898_0059758_2159_3157 332
352 3300037466 Ga0395898_0077501 Ga0395898_0077501_380_1417 332
353 3300037466 Ga0395898_0117230 Ga0395898_0117230_185_1198 332
354 3300037471 Ga0395905_0005221 Ga0395905_0005221_5464_6477 332
355 3300037471 Ga0395905_0017850 Ga0395905_0017850_325_1323 332
356 3300038443 Ga0395901_0001778 Ga0395901_0001778_6362_7375 332
357 3300038443 Ga0395901_0078772 Ga0395901_0078772_494_1516 332
358 3300038443 Ga0395901_0192310 Ga0395901_0192310_164_1201 332
359 3300038443 Ga0395901_0277822 Ga0395901_0277822_705_1703 332
360 3300046455 Ga0495603_0017515 Ga0495603_0017515_3113_4111 332
361 3300046473 Ga0495582_0025840 Ga0495582_0025840_620_1618 332
362 3300046491 Ga0495584_0054772 Ga0495584_0054772_662_1660 332
363 3300046664 Ga0495659_0065921 Ga0495659_0065921_108_1127 332
364 3300046689 Ga0495613_0172845 Ga0495613_0172845_443_1468 332
365 3300046689 Ga0495613_0246086 Ga0495613_0246086_151_1170 332
366 3300047315 Ga0495581_0009645 Ga0495581_0009645_3179_4177 332
367 3300047321 Ga0495676_0031375 Ga0495676_0031375_310_1308 332
368 3300048903 Ga0496100_0019682 Ga0496100_0019682_752_1783 332
369 3300048904 Ga0496101_0045709 Ga0496101_0045709_389_1387 332
370 3300048905 Ga0496102_0060363 Ga0496102_0060363_2157_3197 332
371 3300048905 Ga0496102_0107755 Ga0496102_0107755_1030_2028 332
372 3300048906 Ga0496103_0067736 Ga0496103_0067736_867_1907 332
373 3300048907 Ga0496104_0020881 Ga0496104_0020881_1109_2107 332
374 3300048907 Ga0496104_0066013 Ga0496104_0066013_983_1981 332
375 3300048908 Ga0496105_0010091 Ga0496105_0010091_3866_4864 332
376 3300048908 Ga0496105_0030063 Ga0496105_0030063_3054_4052 332
377 3300048909 Ga0496106_0003308 Ga0496106_0003308_2933_3931 332
378 3300048909 Ga0496106_0028289 Ga0496106_0028289_1811_2842 332
379 3300048909 Ga0496106_0036254 Ga0496106_0036254_643_1683 332
380 3300048910 Ga0496107_0002187 Ga0496107_0002187_8958_9998 332
381 3300048910 Ga0496107_0051476 Ga0496107_0051476_1840_2871 332
382 3300048911 Ga0496108_0005215 Ga0496108_0005215_3824_4822 332
383 3300048911 Ga0496108_0092424 Ga0496108_0092424_49_1047 332
384 3300048912 Ga0496109_0001424 Ga0496109_0001424_9903_10901 332
385 3300048912 Ga0496109_0006229 Ga0496109_0006229_740_1738 332
386 3300048912 Ga0496109_0214549 Ga0496109_0214549_31_1029 332
387 3300048913 Ga0496110_0031497 Ga0496110_0031497_125_1123 332
388 3300048914 Ga0496111_0010294 Ga0496111_0010294_3774_4772 332
389 3300048915 Ga0496112_0015217 Ga0496112_0015217_2463_3461 332
390 3300048915 Ga0496112_0028350 Ga0496112_0028350_3119_4117 332
391 3300048916 Ga0496113_0142280 Ga0496113_0142280_176_1174 332
392 3300048916 Ga0496113_0144775 Ga0496113_0144775_322_1320 332
393 3300048917 Ga0496114_0159139 Ga0496114_0159139_177_1175 332
394 3300048918 Ga0496115_0003007 Ga0496115_0003007_2319_3317 332
395 3300048918 Ga0496115_0124846 Ga0496115_0124846_46_1077 332
396 3300049591 Ga0501075_0159805 Ga0501075_0159805_36_1049 332
397 3300049592 Ga0501076_0216712 Ga0501076_0216712_326_1339 332
398 3300049743 Ga0501081_0111296 Ga0501081_0111296_704_1717 332
399 3300050507 nmdc:mga05p37_10836_c1 nmdc:mga05p37_10836_c1_7139_8137 332
400 3300050512 nmdc:mga0n895_279604_c2 nmdc:mga0n895_279604_c2_128_1126 332
401 3300050515 nmdc:mga0a205_65652_c1 nmdc:mga0a205_65652_c1_1259_2296 332
402 3300050515 nmdc:mga0a205_68354_c1 nmdc:mga0a205_68354_c1_2141_3139 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01368

DHH

DHH family

22

165

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.9206 11 331
5o4z-assembly1.cif.gz_A structure of the inactive t.maritima pde (tm1595) d80n d154n mutant with substrate 5'-papa 0.8962 11 331
4py9-assembly1.cif.gz_A crystal structure of an exopolyphosphatase-related protein from bacteroides fragilis. northeast structural genomics target bfr192 0.8904 8 330
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.8896 11 331
5o25-assembly1.cif.gz_A structure of wildtype t.maritima pde (tm1595) in ligand-free state 0.8766 11 331
ID Description Score Start End Superfamily
4ls9B01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8941 11 200 3.90.1640.10
4py9A01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8834 8 204 3.90.1640.10
af_Q2FXM3_201_313_3.10.310.30 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8775 212 329 3.10.310.30
3devB01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8655 10 204 3.90.1640.10
4ls9B01 Alpha Beta;Alpha-Beta Complex;inorganic pyrophosphatase (n-terminal core);inorganic pyrophosphatase (n-terminal core) 0.8635 11 200 3.90.1640.10
ID Description Score Start End GO Terms
AF-A0A7V9MAP7-F1-model_v4 DHHA1 domain-containing protein 0.9519 220 331 GO:0003676
AF-A0A7C8ARF2-F1-model_v4 deleted 0.9452 10 324
AF-K1GI14-F1-model_v4 DHHA1 domain-containing protein 0.9444 164 326 GO:0003676
AF-A0A6S6TFC5-F1-model_v4 FIG146085: 3'-to-5' oligoribonuclease A, Bacillus type 0.9443 11 328 GO:0003676
AF-A0A1V5NM93-F1-model_v4 Bifunctional oligoribonuclease and PAP phosphatase NrnA (EC 3.1.-.-) 0.9431 151 331 GO:0003676
GO:0016787

Feature Viewer

pLDDT pTM Quality
91.01 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map