F435194

General Info

Members Datasets Scaffolds Average Seq Length
402 201 804 152

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0420351|Ga0495680_0420351_59_601
Length 180
Sequence MDADFMDADRSGIRRSGRYNGTSVLGTAAMTPNPVYVRAVQDIVHASPYPALIGLKNTELELDGCRVELDLRADHLQPFGIVHGGVLATLIDTATFWAAFMRLPEDAGLVNVDLKLNYLKAVAKGHLRAEGECLRAGRQISYTIASVYNEAGELVAHGTSTMMALPGKGLRVDVPKFIAD

Samples

Sample ID Description Type Environment
1 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
119 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
120 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
129 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
130 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
131 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
200 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
201 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.25
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 1.49
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495680_0420351 3300047322 Bacteria 920
2 rootH2_10201976 3300003320 Bacteria 3236
3 Ga0070658_11483900 3300005327 Bacteria 588
4 Ga0070683_100825255 3300005329 Bacteria 889
5 Ga0070690_100509457 3300005330 Bacteria 902
6 Ga0070670_100366785 3300005331 Bacteria 1267
7 Ga0070670_100442005 3300005331 Bacteria 1152
8 Ga0068869_100364957 3300005334 Bacteria 1180
9 Ga0068869_100491010 3300005334 Bacteria 1024
10 Ga0068869_100616069 3300005334 Bacteria 918
11 Ga0070666_10045283 3300005335 Bacteria 2949
12 Ga0070666_10121997 3300005335 Bacteria 1808
13 Ga0070666_10149918 3300005335 Bacteria 1627
14 Ga0070666_10169710 3300005335 Bacteria 1528
15 Ga0070682_100212090 3300005337 Bacteria 1373
16 Ga0070682_101164334 3300005337 Bacteria 649
17 Ga0068868_100081290 3300005338 Bacteria 2597
18 Ga0070661_100032130 3300005344 Bacteria 3798
19 Ga0070661_100135152 3300005344 Bacteria 1855
20 Ga0070661_100402340 3300005344 Bacteria 1083
21 Ga0070661_101352495 3300005344 Bacteria 598
22 Ga0070668_100118848 3300005347 Bacteria 2110
23 Ga0070668_101226161 3300005347 Bacteria 680
24 Ga0070675_100640982 3300005354 Bacteria 965
25 Ga0070671_100037964 3300005355 Bacteria 3997
26 Ga0070671_100261617 3300005355 Bacteria 1470
27 Ga0070688_100249266 3300005365 Bacteria 1264
28 Ga0070667_100000251 3300005367 Bacteria 60913
29 Ga0070667_100006230 3300005367 Bacteria 9926
30 Ga0070667_100076318 3300005367 Bacteria 2861
31 Ga0070667_100125539 3300005367 Bacteria 2236
32 Ga0070667_100176980 3300005367 Bacteria 1885
33 Ga0070667_100519634 3300005367 Bacteria 1092
34 Ga0070667_100577031 3300005367 Bacteria 1035
35 Ga0070667_101852155 3300005367 Bacteria 568
36 Ga0070709_10322579 3300005434 Bacteria 1134
37 Ga0070714_100046222 3300005435 Bacteria 3692
38 Ga0070710_10112262 3300005437 Bacteria 1639
39 Ga0070711_100023171 3300005439 Bacteria 4034
40 Ga0070663_100011071 3300005455 Bacteria 5647
41 Ga0070663_100143515 3300005455 Bacteria 1825
42 Ga0070663_100278913 3300005455 Bacteria 1331
43 Ga0070663_100313254 3300005455 Bacteria 1260
44 Ga0070678_100016443 3300005456 Bacteria 4734
45 Ga0070681_10072165 3300005458 Bacteria 3415
46 Ga0068867_100039778 3300005459 Bacteria 3430
47 Ga0070684_100186602 3300005535 Bacteria 1886
48 Ga0070684_100613728 3300005535 Bacteria 1012
49 Ga0068853_100000431 3300005539 Bacteria 28645
50 Ga0068853_100003515 3300005539 Bacteria 11987
51 Ga0068853_100004856 3300005539 Bacteria 10446
52 Ga0068853_100478734 3300005539 Bacteria 1173
53 Ga0068853_101286382 3300005539 Bacteria 707
54 Ga0068853_101490114 3300005539 Bacteria 655
55 Ga0070693_100088533 3300005547 Bacteria 1862
56 Ga0070693_100437914 3300005547 Bacteria 914
57 Ga0070665_100000108 3300005548 Bacteria 155204
58 Ga0070665_100008293 3300005548 Bacteria 10507
59 Ga0070665_100045694 3300005548 Bacteria 4398
60 Ga0070665_100139239 3300005548 Bacteria 2430
61 Ga0070665_100260001 3300005548 Bacteria 1737
62 Ga0070665_100940788 3300005548 Bacteria 877
63 Ga0068855_100006302 3300005563 Bacteria 14460
64 Ga0068855_100054006 3300005563 Bacteria 4725
65 Ga0068855_100071053 3300005563 Bacteria 4048
66 Ga0070664_100026769 3300005564 Bacteria 4788
67 Ga0068857_100047295 3300005577 Bacteria 3819
68 Ga0068856_100048689 3300005614 Bacteria 4178
69 Ga0068856_100496947 3300005614 Bacteria 1241
70 Ga0068856_101412874 3300005614 Unclassified 710
71 Ga0068852_100391791 3300005616 Bacteria 1365
72 Ga0068852_100807395 3300005616 Bacteria 952
73 Ga0068859_100000358 3300005617 Bacteria 45525
74 Ga0068859_101205426 3300005617 Bacteria 834
75 Ga0068864_100278155 3300005618 Bacteria 1561
76 Ga0068864_100808572 3300005618 Bacteria 922
77 Ga0068866_10721546 3300005718 Bacteria 686
78 Ga0068861_100010693 3300005719 Bacteria 6376
79 Ga0068861_100157618 3300005719 Bacteria 1869
80 Ga0068861_101068095 3300005719 Bacteria 774
81 Ga0068851_10108079 3300005834 Bacteria 1483
82 Ga0068863_100008795 3300005841 Bacteria 9860
83 Ga0068863_100020204 3300005841 Bacteria 6372
84 Ga0068863_100079500 3300005841 Bacteria 3105
85 Ga0068863_100260131 3300005841 Bacteria 1678
86 Ga0068863_100873620 3300005841 Bacteria 899
87 Ga0068863_100966943 3300005841 Bacteria 853
88 Ga0068863_101561489 3300005841 Bacteria 669
89 Ga0068858_100154770 3300005842 Bacteria 2157
90 Ga0068858_100379072 3300005842 Bacteria 1357
91 Ga0068858_100824490 3300005842 Bacteria 905
92 Ga0068860_100553370 3300005843 Bacteria 1153
93 Ga0068862_100000844 3300005844 Bacteria 30147
94 Ga0068862_100071309 3300005844 Bacteria 3000
95 Ga0068862_100699623 3300005844 Bacteria 982
96 Ga0081540_1002376 3300005983 Bacteria 15369
97 Ga0075365_10183025 3300006038 Bacteria 1465
98 Ga0075363_100113618 3300006048 Bacteria 1507
99 Ga0075363_100215292 3300006048 Bacteria 1100
100 Ga0075364_10216386 3300006051 Bacteria 1299
101 Ga0075367_10567445 3300006178 Bacteria 721
102 Ga0097621_100015404 3300006237 Bacteria 5751
103 Ga0097621_100289280 3300006237 Bacteria 1444
104 Ga0097621_100373248 3300006237 Bacteria 1273
105 Ga0097621_100883898 3300006237 Bacteria 831
106 Ga0068871_100039592 3300006358 Bacteria 3772
107 Ga0068871_100045068 3300006358 Bacteria 3548
108 Ga0068871_100217100 3300006358 Bacteria 1656
109 Ga0068871_100446363 3300006358 Bacteria 1159
110 Ga0068871_100490028 3300006358 Bacteria 1107
111 Ga0068865_100094434 3300006881 Bacteria 2177
112 Ga0068865_100239692 3300006881 Bacteria 1426
113 Ga0068865_101440172 3300006881 Bacteria 616
114 Ga0097620_100000358 3300006931 Bacteria 45525
115 Ga0097620_101205429 3300006931 Bacteria 834
116 Ga0105247_10090602 3300009101 Bacteria 1940
117 Ga0105241_10498341 3300009174 Bacteria 1085
118 Ga0105241_11344166 3300009174 Unclassified 682
119 Ga0105242_10098443 3300009176 Bacteria 2474
120 Ga0105242_11071097 3300009176 Bacteria 818
121 Ga0105248_10004826 3300009177 Bacteria 14921
122 Ga0105248_10083435 3300009177 Bacteria 3595
123 Ga0105248_10199724 3300009177 Bacteria 2253
124 Ga0105248_10320683 3300009177 Bacteria 1745
125 Ga0105248_11057890 3300009177 Bacteria 917
126 Ga0105237_10003015 3300009545 Bacteria 20311
127 Ga0105237_10063133 3300009545 Bacteria 3702
128 Ga0105237_10110422 3300009545 Bacteria 2742
129 Ga0105237_10996858 3300009545 Unclassified 844
130 Ga0105238_10054492 3300009551 Bacteria 4016
131 Ga0105249_10001609 3300009553 Bacteria 19767
132 Ga0105249_10015427 3300009553 Bacteria 6762
133 Ga0105249_11223993 3300009553 Bacteria 822
134 Ga0105249_11466662 3300009553 Bacteria 754
135 Ga0105032_100617 3300009979 Bacteria 3486
136 Ga0105239_10005996 3300010375 Bacteria 14143
137 Ga0105239_10786815 3300010375 Bacteria 1090
138 Ga0157370_10484735 3300013104 Bacteria 1136
139 Ga0157370_10537541 3300013104 Bacteria 1072
140 Ga0157370_11041062 3300013104 Bacteria 740
141 Ga0157369_10729373 3300013105 Bacteria 1020
142 Ga0157374_10115583 3300013296 Bacteria 2585
143 Ga0157374_10268525 3300013296 Bacteria 1682
144 Ga0157374_11302432 3300013296 Bacteria 749
145 Ga0163162_10050832 3300013306 Bacteria 4157
146 Ga0163162_10215856 3300013306 Bacteria 2048
147 Ga0163162_10406731 3300013306 Bacteria 1494
148 Ga0157372_10047647 3300013307 Bacteria 4763
149 Ga0157372_10075844 3300013307 Bacteria 3795
150 Ga0157372_10805564 3300013307 Bacteria 1091
151 Ga0157375_10001737 3300013308 Bacteria 18731
152 Ga0157375_10336155 3300013308 Bacteria 1675
153 Ga0157375_12166844 3300013308 Bacteria 662
154 Ga0163163_10048633 3300014325 Bacteria 4171
155 Ga0163163_10261282 3300014325 Bacteria 1782
156 Ga0163163_10969498 3300014325 Bacteria 914
157 Ga0163163_11709245 3300014325 Bacteria 690
158 Ga0157377_11419600 3300014745 Bacteria 548
159 Ga0157379_10095171 3300014968 Bacteria 2672
160 Ga0157379_10115515 3300014968 Bacteria 2413
161 Ga0157379_10881502 3300014968 Bacteria 848
162 Ga0157379_11056268 3300014968 Bacteria 776
163 Ga0157376_10039525 3300014969 Bacteria 3848
164 Ga0157376_10042998 3300014969 Bacteria 3706
165 Ga0157376_10162398 3300014969 Bacteria 2027
166 Ga0157376_10170575 3300014969 Unclassified 1981
167 Ga0157376_10454228 3300014969 Bacteria 1250
168 Ga0157376_10465232 3300014969 Bacteria 1236
169 Ga0157376_12196519 3300014969 Bacteria 591
170 Ga0163161_11525442 3300017792 Bacteria 587
171 Ga0209233_1004278 3300025261 Bacteria 4884
172 Ga0207697_10028329 3300025315 Bacteria 2291
173 Ga0207656_10189089 3300025321 Bacteria 991
174 Ga0207656_10228055 3300025321 Bacteria 907
175 Ga0207710_10074164 3300025900 Bacteria 1566
176 Ga0207710_10490004 3300025900 Bacteria 637
177 Ga0207680_10244844 3300025903 Bacteria 1237
178 Ga0207680_10289604 3300025903 Bacteria 1139
179 Ga0207647_10146311 3300025904 Bacteria 1382
180 Ga0207705_11136412 3300025909 Bacteria 601
181 Ga0207707_10012247 3300025912 Bacteria 7456
182 Ga0207671_10000640 3300025914 Bacteria 45841
183 Ga0207671_10105761 3300025914 Bacteria 2136
184 Ga0207663_10087937 3300025916 Bacteria 2053
185 Ga0207649_10041246 3300025920 Bacteria 2810
186 Ga0207694_10117960 3300025924 Bacteria 2116
187 Ga0207650_10136152 3300025925 Bacteria 1927
188 Ga0207650_10151396 3300025925 Bacteria 1831
189 Ga0207686_10801343 3300025934 Bacteria 755
190 Ga0207704_10035541 3300025938 Bacteria 2856
191 Ga0207704_10492603 3300025938 Bacteria 986
192 Ga0207711_10163141 3300025941 Bacteria 2018
193 Ga0207689_10179777 3300025942 Bacteria 1745
194 Ga0207689_10303598 3300025942 Bacteria 1323
195 Ga0207689_10335325 3300025942 Bacteria 1256
196 Ga0207661_10309055 3300025944 Bacteria 1419
197 Ga0207679_10483837 3300025945 Bacteria 1102
198 Ga0207667_10009078 3300025949 Bacteria 11757
199 Ga0207667_10344554 3300025949 Bacteria 1520
200 Ga0207651_10291809 3300025960 Bacteria 1353
201 Ga0207651_10375454 3300025960 Bacteria 1204
202 Ga0207712_10001073 3300025961 Bacteria 19130
203 Ga0207712_10763089 3300025961 Bacteria 848
204 Ga0207712_10805919 3300025961 Bacteria 826
205 Ga0207668_10080907 3300025972 Bacteria 2355
206 Ga0207668_10275794 3300025972 Bacteria 1377
207 Ga0207668_11853889 3300025972 Bacteria 544
208 Ga0207658_10002218 3300025986 Bacteria 14426
209 Ga0207658_10053714 3300025986 Bacteria 2978
210 Ga0207658_10081029 3300025986 Bacteria 2488
211 Ga0207658_10126387 3300025986 Bacteria 2047
212 Ga0207658_10456246 3300025986 Bacteria 1132
213 Ga0207677_10168141 3300026023 Bacteria 1711
214 Ga0207703_10328482 3300026035 Bacteria 1402
215 Ga0207703_10541902 3300026035 Bacteria 1096
216 Ga0207703_10919968 3300026035 Bacteria 838
217 Ga0207703_11184732 3300026035 Bacteria 734
218 Ga0207639_10002376 3300026041 Bacteria 12650
219 Ga0207639_10005906 3300026041 Bacteria 8296
220 Ga0207639_10938853 3300026041 Bacteria 809
221 Ga0207639_11443998 3300026041 Bacteria 646
222 Ga0207639_11710318 3300026041 Bacteria 589
223 Ga0207678_10000199 3300026067 Bacteria 52540
224 Ga0207678_10011513 3300026067 Bacteria 7770
225 Ga0207678_10256294 3300026067 Bacteria 1499
226 Ga0207678_10362538 3300026067 Bacteria 1251
227 Ga0207702_10935412 3300026078 Bacteria 859
228 Ga0207702_11391454 3300026078 Unclassified 695
229 Ga0207641_10010015 3300026088 Bacteria 7798
230 Ga0207641_10238161 3300026088 Bacteria 1694
231 Ga0207641_10269589 3300026088 Bacteria 1597
232 Ga0207641_10467759 3300026088 Bacteria 1220
233 Ga0207648_10020392 3300026089 Bacteria 5969
234 Ga0207648_10378582 3300026089 Bacteria 1279
235 Ga0207676_10263576 3300026095 Bacteria 1557
236 Ga0207676_10418332 3300026095 Bacteria 1256
237 Ga0207674_10036777 3300026116 Bacteria 5096
238 Ga0207674_10058282 3300026116 Bacteria 3913
239 Ga0207675_100123638 3300026118 Bacteria 2450
240 Ga0207675_100333158 3300026118 Bacteria 1484
241 Ga0207683_10075300 3300026121 Bacteria 2987
242 Ga0207698_10483083 3300026142 Bacteria 1202
243 Ga0268266_10000001 3300028379 Bacteria 4040580
244 Ga0268266_10050250 3300028379 Bacteria 3577
245 Ga0268266_10093875 3300028379 Bacteria 2633
246 Ga0268266_10431749 3300028379 Unclassified 1250
247 Ga0268266_10709232 3300028379 Bacteria 970
248 Ga0268266_11063592 3300028379 Bacteria 783
249 Ga0268265_10000478 3300028380 Bacteria 42016
250 Ga0268265_10052988 3300028380 Bacteria 3072
251 Ga0268265_10662910 3300028380 Bacteria 1004
252 Ga0268264_10705559 3300028381 Bacteria 1002
253 Ga0268264_10818481 3300028381 Bacteria 931
254 Ga0307508_10138651 3300031616 Bacteria 2036
255 Ga0316575_10032422 3300031665 Unclassified 2046
256 Ga0316579_10006103 3300031691 Unclassified 4892
257 Ga0316578_10000110 3300031728 Bacteria 19548
258 Ga0316578_10272905 3300031728 Bacteria 1013
259 Ga0316578_10372441 3300031728 Bacteria 848
260 Ga0316578_10377068 3300031728 Bacteria 842
261 Ga0307516_10407251 3300031730 Bacteria 1019
262 Ga0316577_10001268 3300031733 Bacteria 11788
263 Ga0307411_11432723 3300032005 Bacteria 633
264 Ga0316583_10003254 3300032133 Bacteria 5708
265 Ga0316583_10007364 3300032133 Bacteria 3963
266 Ga0316583_10024929 3300032133 Unclassified 2136
267 Ga0316583_10148141 3300032133 Unclassified 817
268 Ga0316585_10002670 3300032137 Unclassified 4839
269 Ga0316580_10001918 3300032139 Bacteria 5601
270 Ga0307507_10225782 3300033179 Bacteria 1251
271 Ga0316586_1012986 3300033527 Unclassified 1299
272 Ga0316574_0000007 3300035398 Bacteria 48238
273 Ga0316574_0006830 3300035398 Bacteria 6200
274 Ga0316574_0033832 3300035398 Bacteria 3112
275 Ga0316574_0088463 3300035398 Unclassified 1972
276 Ga0316574_0132396 3300035398 Unclassified 1605
277 Ga0316574_0375889 3300035398 Unclassified 897
278 Ga0373937_0219706 3300036401 Bacteria 1789
279 Ga0316582_0000843 3300036647 Bacteria 12493
280 Ga0316582_0148008 3300036647 Bacteria 1586
281 Ga0316584_0000675 3300036712 Bacteria 18742
282 Ga0316584_0096382 3300036712 Unclassified 2214
283 Ga0395898_0540088 3300037466 Bacteria 1108
284 Ga0316581_0019262 3300037588 Unclassified 1988
285 Ga0400483_066884 3300039062 Bacteria 7628
286 Ga0400483_201063 3300039062 Bacteria 3734
287 Ga0400489_10543 3300039093 Bacteria 10025
288 Ga0439453_0042706 3300041408 Bacteria 894
289 Ga0451798_0970104 3300041458 Bacteria 925
290 Ga0451800_0246915 3300041459 Bacteria 609
291 Ga0451802_0497339 3300041460 Bacteria 2291
292 Ga0451807_0578653 3300041486 Bacteria 622
293 Ga0451853_3521559 3300041512 Bacteria 652
294 Ga0439434_0068559 3300042435 Bacteria 1115
295 Ga0453684_0072577 3300044712 Bacteria 4345
296 Ga0495638_0000009 3300046460 Bacteria 525345
297 Ga0495594_0414458 3300046499 Bacteria 766
298 Ga0495663_0024511 3300046525 Bacteria 1754
299 Ga0495622_0049538 3300046557 Bacteria 1950
300 Ga0495656_0007408 3300046615 Bacteria 3877
301 Ga0495625_0078060 3300046660 Bacteria 2312
302 Ga0495659_0033857 3300046664 Bacteria 1795
303 Ga0495657_0167003 3300046675 Bacteria 1358
304 Ga0495636_0246969 3300047318 Bacteria 824
305 Ga0495636_0625471 3300047318 Bacteria 527
306 Ga0495683_0369385 3300047323 Unclassified 602
307 Ga0495685_023099 3300047447 Bacteria 2140
308 Ga0495686_0003651 3300047472 Bacteria 13168
309 Ga0496114_0692444 3300048917 Bacteria 894
310 Ga0496115_0167669 3300048918 Bacteria 1816
311 Ga0496121_0235368 3300048924 Bacteria 1280
312 Ga0496121_0272959 3300048924 Bacteria 1161
313 Ga0496122_0002072 3300048925 Bacteria 29724
314 Ga0496123_0000113 3300048926 Bacteria 163689
315 Ga0496126_0103943 3300048929 Bacteria 2482
316 Ga0501031_0098412 3300049568 Bacteria 1909
317 Ga0501031_0107268 3300049568 Bacteria 1823
318 Ga0501032_0003829 3300049569 Bacteria 11430
319 Ga0501032_0083678 3300049569 Bacteria 2121
320 Ga0501032_0198727 3300049569 Bacteria 1309
321 Ga0501033_0000246 3300049570 Bacteria 52184
322 Ga0501033_0083923 3300049570 Bacteria 2334
323 Ga0501034_0004266 3300049571 Bacteria 15945
324 Ga0501036_0003550 3300049572 Bacteria 12468
325 Ga0501036_0038613 3300049572 Bacteria 4040
326 Ga0501036_1049522 3300049572 Bacteria 666
327 Ga0501037_0029757 3300049573 Bacteria 4034
328 Ga0501037_0324992 3300049573 Bacteria 1064
329 Ga0501038_0002364 3300049574 Bacteria 17579
330 Ga0501038_0274767 3300049574 Unclassified 1328
331 Ga0501038_0564861 3300049574 Bacteria 864
332 Ga0501038_0651782 3300049574 Bacteria 792
333 Ga0501039_0000880 3300049575 Bacteria 21807
334 Ga0501039_0037605 3300049575 Bacteria 3736
335 Ga0501040_0077580 3300049576 Bacteria 2298
336 Ga0501042_0292762 3300049578 Bacteria 1176
337 Ga0501042_0575900 3300049578 Bacteria 818
338 Ga0501043_0019946 3300049579 Bacteria 5261
339 Ga0501043_0039151 3300049579 Bacteria 3726
340 Ga0501043_0056440 3300049579 Bacteria 3084
341 Ga0501043_0104245 3300049579 Bacteria 2228
342 Ga0501043_0776975 3300049579 Bacteria 694
343 Ga0501046_0031059 3300049580 Bacteria 4333
344 Ga0501046_0044062 3300049580 Bacteria 3549
345 Ga0501046_0099655 3300049580 Bacteria 2230
346 Ga0501046_0170088 3300049580 Bacteria 1636
347 Ga0501047_0035523 3300049581 Bacteria 4815
348 Ga0501047_0073041 3300049581 Bacteria 3302
349 Ga0501047_0273526 3300049581 Bacteria 1535
350 Ga0501047_0273587 3300049581 Bacteria 1535
351 Ga0501047_0516524 3300049581 Bacteria 1020
352 Ga0501048_0020740 3300049582 Bacteria 4816
353 Ga0501067_0075035 3300049583 Bacteria 1874
354 Ga0501067_0103930 3300049583 Bacteria 1578
355 Ga0501068_0130016 3300049584 Bacteria 1574
356 Ga0501068_0210391 3300049584 Bacteria 1235
357 Ga0501068_0217107 3300049584 Bacteria 1215
358 Ga0501069_0046640 3300049585 Bacteria 2404
359 Ga0501069_0100156 3300049585 Bacteria 1644
360 Ga0501070_0118428 3300049586 Bacteria 2188
361 Ga0501070_0426819 3300049586 Bacteria 1070
362 Ga0501070_0593865 3300049586 Bacteria 883
363 Ga0501071_0024674 3300049587 Bacteria 4206
364 Ga0501073_0004198 3300049589 Bacteria 10800
365 Ga0501073_0036915 3300049589 Bacteria 3470
366 Ga0501073_0074623 3300049589 Bacteria 2361
367 Ga0501073_0321261 3300049589 Bacteria 1068
368 Ga0501073_0507680 3300049589 Bacteria 833
369 Ga0501074_0005823 3300049590 Bacteria 8890
370 Ga0501074_0093714 3300049590 Bacteria 2150
371 Ga0501074_0585758 3300049590 Bacteria 789
372 Ga0501080_0029908 3300049742 Bacteria 5070
373 Ga0501080_0044756 3300049742 Bacteria 4120
374 Ga0501080_0139324 3300049742 Bacteria 2243
375 Ga0501081_0102690 3300049743 Bacteria 2023
376 Ga0501083_0280269 3300049744 Bacteria 1084
377 Ga0501035_0010376 3300049822 Bacteria 8640
378 Ga0501035_0877747 3300049822 Bacteria 712
379 Ga0501044_0082286 3300049823 Bacteria 3257
380 Ga0501044_0132859 3300049823 Bacteria 2482
381 Ga0501044_0167150 3300049823 Bacteria 2173
382 Ga0501045_0124528 3300049824 Bacteria 1914
383 nmdc:mga03n38_276093_c1 3300050490 Bacteria 895
384 nmdc:mga00v17_297819_c1 3300050491 Bacteria 1048
385 nmdc:mga0yw44_177218_c1 3300050492 Bacteria 1402
386 nmdc:mga06z11_154276_c1 3300050494 Bacteria 1308
387 nmdc:mga08y16_1025635_c1 3300050511 Unclassified 804
388 Ga0500610_0000447 3300053079 Bacteria 12721
389 Ga0500643_008057 3300053087 Bacteria 4175
390 Ga0500651_0053273 3300053093 Bacteria 2537
391 Ga0500597_005422 3300053120 Bacteria 4111
392 Ga0500568_0000449 3300053139 Bacteria 30962
393 Ga0500620_054639 3300053155 Bacteria 1347
394 Ga0500645_083238 3300053730 Bacteria 912
395 Ga0501084_0160062 3300054114 Bacteria 1899
396 Ga0501082_0000954 3300060353 Bacteria 25550
397 Ga0501082_0080772 3300060353 Bacteria 2806
398 Ga0501082_1117206 3300060353 Bacteria 689
399 Ga0530510_0437007 3300061734 Bacteria 989
400 2525555683 2524614729 Bacteria 3091755
401 2572253850 2571042365 Bacteria 3289345
402 2630650697 2627854209 Bacteria 3093011
403 Ga0495680_0420351
404 rootH2_10201976
405 Ga0070658_11483900
406 Ga0070683_100825255
407 Ga0070690_100509457
408 Ga0070670_100366785
409 Ga0070670_100442005
410 Ga0068869_100364957
411 Ga0068869_100491010
412 Ga0068869_100616069
413 Ga0070666_10045283
414 Ga0070666_10121997
415 Ga0070666_10149918
416 Ga0070666_10169710
417 Ga0070682_100212090
418 Ga0070682_101164334
419 Ga0068868_100081290
420 Ga0070661_100032130
421 Ga0070661_100135152
422 Ga0070661_100402340
423 Ga0070661_101352495
424 Ga0070668_100118848
425 Ga0070668_101226161
426 Ga0070675_100640982
427 Ga0070671_100037964
428 Ga0070671_100261617
429 Ga0070688_100249266
430 Ga0070667_100000251
431 Ga0070667_100006230
432 Ga0070667_100076318
433 Ga0070667_100125539
434 Ga0070667_100176980
435 Ga0070667_100519634
436 Ga0070667_100577031
437 Ga0070667_101852155
438 Ga0070709_10322579
439 Ga0070714_100046222
440 Ga0070710_10112262
441 Ga0070711_100023171
442 Ga0070663_100011071
443 Ga0070663_100143515
444 Ga0070663_100278913
445 Ga0070663_100313254
446 Ga0070678_100016443
447 Ga0070681_10072165
448 Ga0068867_100039778
449 Ga0070684_100186602
450 Ga0070684_100613728
451 Ga0068853_100000431
452 Ga0068853_100003515
453 Ga0068853_100004856
454 Ga0068853_100478734
455 Ga0068853_101286382
456 Ga0068853_101490114
457 Ga0070693_100088533
458 Ga0070693_100437914
459 Ga0070665_100000108
460 Ga0070665_100008293
461 Ga0070665_100045694
462 Ga0070665_100139239
463 Ga0070665_100260001
464 Ga0070665_100940788
465 Ga0068855_100006302
466 Ga0068855_100054006
467 Ga0068855_100071053
468 Ga0070664_100026769
469 Ga0068857_100047295
470 Ga0068856_100048689
471 Ga0068856_100496947
472 Ga0068856_101412874
473 Ga0068852_100391791
474 Ga0068852_100807395
475 Ga0068859_100000358
476 Ga0068859_101205426
477 Ga0068864_100278155
478 Ga0068864_100808572
479 Ga0068866_10721546
480 Ga0068861_100010693
481 Ga0068861_100157618
482 Ga0068861_101068095
483 Ga0068851_10108079
484 Ga0068863_100008795
485 Ga0068863_100020204
486 Ga0068863_100079500
487 Ga0068863_100260131
488 Ga0068863_100873620
489 Ga0068863_100966943
490 Ga0068863_101561489
491 Ga0068858_100154770
492 Ga0068858_100379072
493 Ga0068858_100824490
494 Ga0068860_100553370
495 Ga0068862_100000844
496 Ga0068862_100071309
497 Ga0068862_100699623
498 Ga0081540_1002376
499 Ga0075365_10183025
500 Ga0075363_100113618
501 Ga0075363_100215292
502 Ga0075364_10216386
503 Ga0075367_10567445
504 Ga0097621_100015404
505 Ga0097621_100289280
506 Ga0097621_100373248
507 Ga0097621_100883898
508 Ga0068871_100039592
509 Ga0068871_100045068
510 Ga0068871_100217100
511 Ga0068871_100446363
512 Ga0068871_100490028
513 Ga0068865_100094434
514 Ga0068865_100239692
515 Ga0068865_101440172
516 Ga0097620_100000358
517 Ga0097620_101205429
518 Ga0105247_10090602
519 Ga0105241_10498341
520 Ga0105241_11344166
521 Ga0105242_10098443
522 Ga0105242_11071097
523 Ga0105248_10004826
524 Ga0105248_10083435
525 Ga0105248_10199724
526 Ga0105248_10320683
527 Ga0105248_11057890
528 Ga0105237_10003015
529 Ga0105237_10063133
530 Ga0105237_10110422
531 Ga0105237_10996858
532 Ga0105238_10054492
533 Ga0105249_10001609
534 Ga0105249_10015427
535 Ga0105249_11223993
536 Ga0105249_11466662
537 Ga0105032_100617
538 Ga0105239_10005996
539 Ga0105239_10786815
540 Ga0157370_10484735
541 Ga0157370_10537541
542 Ga0157370_11041062
543 Ga0157369_10729373
544 Ga0157374_10115583
545 Ga0157374_10268525
546 Ga0157374_11302432
547 Ga0163162_10050832
548 Ga0163162_10215856
549 Ga0163162_10406731
550 Ga0157372_10047647
551 Ga0157372_10075844
552 Ga0157372_10805564
553 Ga0157375_10001737
554 Ga0157375_10336155
555 Ga0157375_12166844
556 Ga0163163_10048633
557 Ga0163163_10261282
558 Ga0163163_10969498
559 Ga0163163_11709245
560 Ga0157377_11419600
561 Ga0157379_10095171
562 Ga0157379_10115515
563 Ga0157379_10881502
564 Ga0157379_11056268
565 Ga0157376_10039525
566 Ga0157376_10042998
567 Ga0157376_10162398
568 Ga0157376_10170575
569 Ga0157376_10454228
570 Ga0157376_10465232
571 Ga0157376_12196519
572 Ga0163161_11525442
573 Ga0209233_1004278
574 Ga0207697_10028329
575 Ga0207656_10189089
576 Ga0207656_10228055
577 Ga0207710_10074164
578 Ga0207710_10490004
579 Ga0207680_10244844
580 Ga0207680_10289604
581 Ga0207647_10146311
582 Ga0207705_11136412
583 Ga0207707_10012247
584 Ga0207671_10000640
585 Ga0207671_10105761
586 Ga0207663_10087937
587 Ga0207649_10041246
588 Ga0207694_10117960
589 Ga0207650_10136152
590 Ga0207650_10151396
591 Ga0207686_10801343
592 Ga0207704_10035541
593 Ga0207704_10492603
594 Ga0207711_10163141
595 Ga0207689_10179777
596 Ga0207689_10303598
597 Ga0207689_10335325
598 Ga0207661_10309055
599 Ga0207679_10483837
600 Ga0207667_10009078
601 Ga0207667_10344554
602 Ga0207651_10291809
603 Ga0207651_10375454
604 Ga0207712_10001073
605 Ga0207712_10763089
606 Ga0207712_10805919
607 Ga0207668_10080907
608 Ga0207668_10275794
609 Ga0207668_11853889
610 Ga0207658_10002218
611 Ga0207658_10053714
612 Ga0207658_10081029
613 Ga0207658_10126387
614 Ga0207658_10456246
615 Ga0207677_10168141
616 Ga0207703_10328482
617 Ga0207703_10541902
618 Ga0207703_10919968
619 Ga0207703_11184732
620 Ga0207639_10002376
621 Ga0207639_10005906
622 Ga0207639_10938853
623 Ga0207639_11443998
624 Ga0207639_11710318
625 Ga0207678_10000199
626 Ga0207678_10011513
627 Ga0207678_10256294
628 Ga0207678_10362538
629 Ga0207702_10935412
630 Ga0207702_11391454
631 Ga0207641_10010015
632 Ga0207641_10238161
633 Ga0207641_10269589
634 Ga0207641_10467759
635 Ga0207648_10020392
636 Ga0207648_10378582
637 Ga0207676_10263576
638 Ga0207676_10418332
639 Ga0207674_10036777
640 Ga0207674_10058282
641 Ga0207675_100123638
642 Ga0207675_100333158
643 Ga0207683_10075300
644 Ga0207698_10483083
645 Ga0268266_10000001
646 Ga0268266_10050250
647 Ga0268266_10093875
648 Ga0268266_10431749
649 Ga0268266_10709232
650 Ga0268266_11063592
651 Ga0268265_10000478
652 Ga0268265_10052988
653 Ga0268265_10662910
654 Ga0268264_10705559
655 Ga0268264_10818481
656 Ga0307508_10138651
657 Ga0316575_10032422
658 Ga0316579_10006103
659 Ga0316578_10000110
660 Ga0316578_10272905
661 Ga0316578_10372441
662 Ga0316578_10377068
663 Ga0307516_10407251
664 Ga0316577_10001268
665 Ga0307411_11432723
666 Ga0316583_10003254
667 Ga0316583_10007364
668 Ga0316583_10024929
669 Ga0316583_10148141
670 Ga0316585_10002670
671 Ga0316580_10001918
672 Ga0307507_10225782
673 Ga0316586_1012986
674 Ga0316574_0000007
675 Ga0316574_0006830
676 Ga0316574_0033832
677 Ga0316574_0088463
678 Ga0316574_0132396
679 Ga0316574_0375889
680 Ga0373937_0219706
681 Ga0316582_0000843
682 Ga0316582_0148008
683 Ga0316584_0000675
684 Ga0316584_0096382
685 Ga0395898_0540088
686 Ga0316581_0019262
687 Ga0400483_066884
688 Ga0400483_201063
689 Ga0400489_10543
690 Ga0439453_0042706
691 Ga0451798_0970104
692 Ga0451800_0246915
693 Ga0451802_0497339
694 Ga0451807_0578653
695 Ga0451853_3521559
696 Ga0439434_0068559
697 Ga0453684_0072577
698 Ga0495638_0000009
699 Ga0495594_0414458
700 Ga0495663_0024511
701 Ga0495622_0049538
702 Ga0495656_0007408
703 Ga0495625_0078060
704 Ga0495659_0033857
705 Ga0495657_0167003
706 Ga0495636_0246969
707 Ga0495636_0625471
708 Ga0495683_0369385
709 Ga0495685_023099
710 Ga0495686_0003651
711 Ga0496114_0692444
712 Ga0496115_0167669
713 Ga0496121_0235368
714 Ga0496121_0272959
715 Ga0496122_0002072
716 Ga0496123_0000113
717 Ga0496126_0103943
718 Ga0501031_0098412
719 Ga0501031_0107268
720 Ga0501032_0003829
721 Ga0501032_0083678
722 Ga0501032_0198727
723 Ga0501033_0000246
724 Ga0501033_0083923
725 Ga0501034_0004266
726 Ga0501036_0003550
727 Ga0501036_0038613
728 Ga0501036_1049522
729 Ga0501037_0029757
730 Ga0501037_0324992
731 Ga0501038_0002364
732 Ga0501038_0274767
733 Ga0501038_0564861
734 Ga0501038_0651782
735 Ga0501039_0000880
736 Ga0501039_0037605
737 Ga0501040_0077580
738 Ga0501042_0292762
739 Ga0501042_0575900
740 Ga0501043_0019946
741 Ga0501043_0039151
742 Ga0501043_0056440
743 Ga0501043_0104245
744 Ga0501043_0776975
745 Ga0501046_0031059
746 Ga0501046_0044062
747 Ga0501046_0099655
748 Ga0501046_0170088
749 Ga0501047_0035523
750 Ga0501047_0073041
751 Ga0501047_0273526
752 Ga0501047_0273587
753 Ga0501047_0516524
754 Ga0501048_0020740
755 Ga0501067_0075035
756 Ga0501067_0103930
757 Ga0501068_0130016
758 Ga0501068_0210391
759 Ga0501068_0217107
760 Ga0501069_0046640
761 Ga0501069_0100156
762 Ga0501070_0118428
763 Ga0501070_0426819
764 Ga0501070_0593865
765 Ga0501071_0024674
766 Ga0501073_0004198
767 Ga0501073_0036915
768 Ga0501073_0074623
769 Ga0501073_0321261
770 Ga0501073_0507680
771 Ga0501074_0005823
772 Ga0501074_0093714
773 Ga0501074_0585758
774 Ga0501080_0029908
775 Ga0501080_0044756
776 Ga0501080_0139324
777 Ga0501081_0102690
778 Ga0501083_0280269
779 Ga0501035_0010376
780 Ga0501035_0877747
781 Ga0501044_0082286
782 Ga0501044_0132859
783 Ga0501044_0167150
784 Ga0501045_0124528
785 nmdc:mga03n38_276093_c1
786 nmdc:mga00v17_297819_c1
787 nmdc:mga0yw44_177218_c1
788 nmdc:mga06z11_154276_c1
789 nmdc:mga08y16_1025635_c1
790 Ga0500610_0000447
791 Ga0500643_008057
792 Ga0500651_0053273
793 Ga0500597_005422
794 Ga0500568_0000449
795 Ga0500620_054639
796 Ga0500645_083238
797 Ga0501084_0160062
798 Ga0501082_0000954
799 Ga0501082_0080772
800 Ga0501082_1117206
801 Ga0530510_0437007
802 2525555683
803 2572253850
804 2630650697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

79

156

0.95

PF14539

DUF4442

Domain of unknown function (DUF4442)

38

164

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9399 18 137
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9369 19 135
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9366 19 138
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9325 22 138
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9306 19 135
ID Description Score Start End Superfamily
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9436 19 138 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9306 19 135 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9306 15 138 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9288 19 138 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9285 19 137 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3N5YJT3-F1-model_v4 PaaI family thioesterase 0.9892 1 150 GO:0047617
AF-A0A5K7YPQ4-F1-model_v4 Thioesterase domain-containing protein 0.9868 1 151 GO:0047617
AF-A0A3D6BZZ3-F1-model_v4 PaaI family thioesterase 0.9853 1 150 GO:0047617
AF-A0A3N5YJT3-F1-model_v4 PaaI family thioesterase 0.9827 1 150 GO:0047617
AF-B8FML3-F1-model_v4 Thioesterase superfamily protein 0.9817 1 151 GO:0005829
GO:0061522

Map