F435149

General Info

Members Datasets Scaffolds Average Seq Length
402 311 253 319

Family's Representative Sequence

Representative Sequence 3300041498|Ga0451841_0040513|Ga0451841_0040513_251_1315
Length 354
Sequence MFNNVITFDQSDLNIYPFRKQAFKREIPMPLTLRLALRDWDYVTPLVLGDVSSPKLDIKVDRVGTLISHVGKSAEFDAAEMSFSRYTQLRIDGDESVTGIPNFIMRGFRHRCIVTTKDSKLQELGDLAGKRIGVTGWRDSGNTWTRAAIRREGVEVEDAMWYAGRLTDAHPVIDRLDGFGLPGRIEAAPGERPMVELLKEGMLDAIFTPFMPEGYFASGSPFRQLLSDFRGAERSYFDDVGYVPGMHLIGIKSGIAAEHPWVIEELSRLIDESQRMWLSKRRKYAETTPFMFDELLKCAAELPQGWNASGFAPNRKMIADFAGELHAQGILPRLMTPEELFPLDTDGKPIAAAA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
7 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
8 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
12 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
13 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
22 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
23 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
24 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
25 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
26 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
27 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
28 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
29 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
30 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
31 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
32 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
33 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
34 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
35 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
36 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
37 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
38 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
39 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
40 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
41 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
42 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
43 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
44 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
45 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
46 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
47 2643221568 Rhizobium sp. Root564 Isolate Unclassified
48 2643221736 Bosea sp. Root483D1 Isolate Unclassified
49 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
50 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
51 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
52 2738541293 Rhizobium sp. GV031 Isolate Unclassified
53 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
54 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
55 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
56 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
57 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
58 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
59 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
60 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
61 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
62 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
63 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
64 2791355266 Rhizobium sp. L43 Isolate Nodule
65 2802429633 Rhizobium anhuiense J3 Isolate Nodule
66 2802429634 Rhizobium anhuiense S10 Isolate Nodule
67 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
68 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
69 2802429637 Rhizobium anhuiense C15 Isolate Nodule
70 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
71 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
72 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
73 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
74 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
75 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
76 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
77 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
78 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
79 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
80 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
81 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
82 2841760612 Bosea sp. Tri-49 Isolate Nodule
83 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
84 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
85 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
86 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
87 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
88 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
89 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
90 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
91 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
92 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
93 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
94 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
95 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
96 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
97 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
98 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
99 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
100 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
101 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
102 2844104063 Bosea sp. Tri-39 Isolate Nodule
103 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
104 2851182111 Bosea sp. Tri-44 Isolate Nodule
105 2851246043 Bosea sp. Tri-54 Isolate Nodule
106 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
107 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
108 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
109 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
110 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
111 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
112 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
113 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
114 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
115 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
116 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
117 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
118 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
119 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
120 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
121 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
122 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
123 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
124 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
125 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
126 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
127 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
128 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
129 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
130 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
131 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
132 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
133 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
134 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
135 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
136 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
137 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
138 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
139 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
140 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
141 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
142 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
143 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
144 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
145 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
146 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
147 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
148 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
149 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
150 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
151 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
152 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
153 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
154 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
155 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
156 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
157 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
158 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
159 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
160 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
161 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
162 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
163 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
164 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
165 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
170 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
171 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
172 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
176 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
177 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
179 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
180 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
181 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
184 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
185 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
217 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
218 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
219 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
220 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
280 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
281 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
282 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
283 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
284 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
294 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
295 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
296 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
297 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
298 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
299 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
300 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
301 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
302 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
303 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
304 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
305 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
306 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
307 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
308 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
309 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
310 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
311 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.69
Metatranscriptomes 0.25
Isolates 37.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 27.11
Nodule 20.4
Rhizoplane 1.49
Rhizosphere 29.1
Stem 0
Stem Tuber 0
Unclassified 21.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001730 3300001979 Bacteria 10035
2 JGI25155J39150_1000003 3300002704 Bacteria 279666
3 JGI25156J39149_1000004 3300002705 Bacteria 273027
4 JGI25162J39368_1000114 3300002737 Bacteria 88296
5 JGI25162J39368_1000222 3300002737 Bacteria 58781
6 JGI25154J39366_1000088 3300002738 Bacteria 84250
7 JGI25158J39367_1000735 3300002739 Bacteria 6289
8 JGI25157J39369_1000004 3300002741 Bacteria 273009
9 JGI25152J39213_1000209 3300002773 Bacteria 39553
10 JGI25152J39213_1006956 3300002773 Bacteria 2989
11 JGI25152J39213_1006992 3300002773 Bacteria 2974
12 JGI25150J39212_1000101 3300002774 Bacteria 49081
13 JGI25159J45721_1000765 3300002987 Bacteria 13959
14 JGI25159J45721_1003851 3300002987 Bacteria 5150
15 JGI25151J46595_10000085 3300003187 Bacteria 127212
16 JGI25165J46597_1000232 3300003214 Bacteria 77724
17 JGI25165J46597_1000233 3300003214 Bacteria 77242
18 JGI25165J46597_1004896 3300003214 Bacteria 2712
19 JGI25153J46596_10000553 3300003215 Bacteria 23352
20 JGI25153J46596_10016268 3300003215 Bacteria 2989
21 JGI25153J46596_10016362 3300003215 Bacteria 2974
22 JGI25153J46596_10018285 3300003215 Bacteria 2729
23 rootL2_10009270 3300003322 Bacteria 15122
24 rootH1_10019141 3300003323 Bacteria 2985
25 JGI25160J50197_1004068 3300003354 Bacteria 6366
26 JGI25160J50197_1015336 3300003354 Bacteria 2519
27 JGI25161J50226_1000154 3300003374 Bacteria 47801
28 Ga0055526_1002237 3300003771 Bacteria 13247
29 Ga0055524_1003101 3300003775 Bacteria 8204
30 Ga0055524_1007531 3300003775 Bacteria 4610
31 Ga0055524_1015467 3300003775 Bacteria 2780
32 Ga0055536_1011284 3300003781 Bacteria 3443
33 Ga0055528_1000745 3300003790 Bacteria 22728
34 Ga0055528_1002344 3300003790 Bacteria 10245
35 Ga0055528_1008833 3300003790 Bacteria 4269
36 Ga0055540_1009527 3300003792 Bacteria 3344
37 Ga0055543_1000365 3300004625 Bacteria 30039
38 Ga0055543_1000513 3300004625 Bacteria 22087
39 Ga0065165_1000139 3300005262 Bacteria 126209
40 Ga0070668_100086638 3300005347 Bacteria 2463
41 Ga0070667_100027677 3300005367 Bacteria 4717
42 Ga0068867_100264188 3300005459 Bacteria 1404
43 Ga0070665_100058456 3300005548 Bacteria 3865
44 Ga0068855_100227080 3300005563 Bacteria 2092
45 Ga0068852_100225279 3300005616 Bacteria 1785
46 Ga0075365_10110537 3300006038 Bacteria 1888
47 Ga0075362_10055149 3300006177 Bacteria 1788
48 Ga0075367_10101284 3300006178 Bacteria 1761
49 Ga0075367_10158316 3300006178 Bacteria 1408
50 Ga0075366_10014561 3300006195 Bacteria 4493
51 Ga0075370_10003432 3300006353 Bacteria 7542
52 Ga0075370_10016298 3300006353 Bacteria 3998
53 Ga0105240_10000012 3300009093 Bacteria 496639
54 Ga0105243_10077543 3300009148 Bacteria 2703
55 Ga0105237_10000941 3300009545 Bacteria 39120
56 Ga0157371_10029156 3300013102 Bacteria 3994
57 Ga0157370_10002378 3300013104 Bacteria 22683
58 Ga0157369_10101433 3300013105 Bacteria 3067
59 Ga0171462_1020 3300013250 Bacteria 143729
60 Ga0157380_10059875 3300014326 Bacteria 3041
61 Ga0182007_10006059 3300015262 Bacteria 5228
62 Ga0209435_100006 3300025206 Bacteria 542459
63 Ga0209436_100021 3300025208 Bacteria 102115
64 Ga0209437_100022 3300025233 Bacteria 625694
65 Ga0209437_100040 3300025233 Bacteria 448096
66 Ga0207425_1000065 3300025245 Bacteria 127264
67 Ga0207425_1000753 3300025245 Bacteria 16834
68 Ga0207425_1014528 3300025245 Bacteria 1785
69 Ga0209646_1000015 3300025246 Bacteria 542459
70 Ga0209646_1004264 3300025246 Bacteria 2630
71 Ga0209026_1000039 3300025250 Bacteria 280608
72 Ga0209677_100204 3300025253 Bacteria 47556
73 Ga0209148_1005819 3300025254 Bacteria 2757
74 Ga0209759_1000005 3300025256 Bacteria 542459
75 Ga0209129_1000132 3300025258 Bacteria 127262
76 Ga0209129_1000548 3300025258 Bacteria 26009
77 Ga0209129_1000962 3300025258 Bacteria 17318
78 Ga0209129_1001002 3300025258 Bacteria 16842
79 Ga0209233_1000031 3300025261 Bacteria 624646
80 Ga0209233_1000051 3300025261 Bacteria 447617
81 Ga0209233_1000146 3300025261 Bacteria 187269
82 Ga0209673_1000005 3300025273 Bacteria 692788
83 Ga0209673_1001946 3300025273 Bacteria 16231
84 Ga0209673_1003429 3300025273 Bacteria 9368
85 Ga0209673_1004631 3300025273 Bacteria 7280
86 Ga0209673_1008106 3300025273 Bacteria 4723
87 Ga0209130_1000019 3300025284 Bacteria 381993
88 Ga0209130_1000148 3300025284 Bacteria 109763
89 Ga0209676_1000026 3300025292 Bacteria 574599
90 Ga0209676_1011179 3300025292 Bacteria 3649
91 Ga0209025_1000247 3300025294 Bacteria 127264
92 Ga0209025_1000397 3300025294 Bacteria 89703
93 Ga0209025_1002744 3300025294 Bacteria 17833
94 Ga0209025_1005708 3300025294 Bacteria 10009
95 Ga0209025_1015458 3300025294 Bacteria 4601
96 Ga0209564_1001757 3300025295 Bacteria 20239
97 Ga0209564_1008179 3300025295 Bacteria 5225
98 Ga0209758_1000212 3300025297 Bacteria 127597
99 Ga0209758_1001264 3300025297 Bacteria 31314
100 Ga0209758_1001362 3300025297 Bacteria 29278
101 Ga0209758_1002029 3300025297 Bacteria 21765
102 Ga0209758_1002190 3300025297 Bacteria 20464
103 Ga0209050_1004960 3300025298 Bacteria 8671
104 Ga0209256_1004795 3300025299 Bacteria 8216
105 Ga0209256_1005014 3300025299 Bacteria 7909
106 Ga0209256_1018185 3300025299 Bacteria 2298
107 Ga0207426_1000005 3300025302 Bacteria 1037188
108 Ga0207426_1000355 3300025302 Bacteria 83450
109 Ga0209051_1003465 3300025303 Bacteria 10332
110 Ga0209051_1006630 3300025303 Bacteria 6486
111 Ga0209051_1026575 3300025303 Bacteria 2329
112 Ga0209257_1016951 3300025304 Bacteria 2904
113 Ga0207695_10000120 3300025913 Bacteria 234247
114 Ga0207671_10000023 3300025914 Bacteria 274756
115 Ga0207669_10070667 3300025937 Bacteria 2190
116 Ga0207704_10301884 3300025938 Bacteria 1227
117 Ga0207667_10205586 3300025949 Bacteria 2019
118 Ga0207668_10159736 3300025972 Bacteria 1755
119 Ga0207658_10019123 3300025986 Bacteria 4737
120 Ga0207702_10254542 3300026078 Bacteria 1650
121 Ga0209371_1003015 3300027312 Bacteria 8704
122 Ga0209813_10033691 3300027866 Bacteria 1524
123 Ga0268266_10098548 3300028379 Bacteria 2572
124 Ga0307515_10005985 3300028794 Bacteria 24500
125 Ga0268256_1002669 3300030500 Bacteria 8796
126 Ga0307513_10007297 3300031456 Bacteria 14354
127 Ga0307405_10001611 3300031731 Bacteria 9591
128 Ga0307416_100059958 3300032002 Bacteria 3096
129 Ga0307416_100101696 3300032002 Unclassified 2504
130 Ga0395905_0027244 3300037471 Bacteria 5389
131 Ga0400483_161204 3300039062 Bacteria 5328
132 Ga0451833_0435848 3300041491 Bacteria 1248
133 Ga0451835_0651028 3300041492 Bacteria 3353
134 Ga0451841_0040513 3300041498 Bacteria 1332
135 Ga0451847_0778576 3300041503 Bacteria 1681
136 Ga0451849_1221770 3300041505 Bacteria 1858
137 Ga0451851_0844213 3300041507 Bacteria 1694
138 Ga0466966_0041445 3300044684 Bacteria 2959
139 Ga0466963_0006963 3300044694 Bacteria 6729
140 Ga0466971_0046213 3300044719 Bacteria 1957
141 Ga0466970_0001826 3300044765 Bacteria 10276
142 Ga0466957_0014112 3300044842 Bacteria 4648
143 Ga0466958_0005473 3300045836 Bacteria 6842
144 Ga0466967_0182524 3300045976 Bacteria 1980
145 Ga0466967_0185557 3300045976 Bacteria 1964
146 Ga0495629_0110210 3300046459 Bacteria 1919
147 Ga0495650_0014044 3300046471 Bacteria 4195
148 Ga0495662_0002075 3300046476 Bacteria 10049
149 Ga0495585_0113177 3300046492 Bacteria 1441
150 Ga0495585_0196187 3300046492 Bacteria 1030
151 Ga0495606_0004915 3300046507 Bacteria 13075
152 Ga0495610_0008975 3300046512 Bacteria 6392
153 Ga0495616_0022770 3300046513 Bacteria 3379
154 Ga0495620_0001324 3300046515 Bacteria 15023
155 Ga0495620_0080875 3300046515 Bacteria 1315
156 Ga0495631_0007668 3300046518 Bacteria 5481
157 Ga0495632_0000023 3300046519 Bacteria 180933
158 Ga0495632_0002480 3300046519 Bacteria 14013
159 Ga0495643_0008302 3300046522 Bacteria 6587
160 Ga0495643_0054699 3300046522 Bacteria 2136
161 Ga0495648_0046376 3300046524 Bacteria 2694
162 Ga0495663_0000059 3300046525 Bacteria 51157
163 Ga0495640_0154853 3300046533 Bacteria 1471
164 Ga0495609_0032496 3300046538 Bacteria 2370
165 Ga0495597_0007189 3300046542 Bacteria 5678
166 Ga0495622_0000783 3300046557 Bacteria 17693
167 Ga0495633_0002084 3300046558 Bacteria 14387
168 Ga0495633_0043702 3300046558 Bacteria 2125
169 Ga0495668_0015155 3300046616 Bacteria 4507
170 Ga0495668_0061812 3300046616 Bacteria 2065
171 Ga0495668_0133327 3300046616 Bacteria 1360
172 Ga0495611_0003083 3300046648 Bacteria 7404
173 Ga0495625_0008605 3300046660 Bacteria 8686
174 Ga0495625_0032066 3300046660 Bacteria 3901
175 Ga0495649_0015950 3300046694 Bacteria 4265
176 Ga0495660_0003657 3300046810 Bacteria 9469
177 Ga0495604_0029769 3300047317 Bacteria 4343
178 Ga0495686_0014914 3300047472 Bacteria 5332
179 Ga0495686_0104783 3300047472 Bacteria 1702
180 Ga0496102_0007618 3300048905 Bacteria 9251
181 Ga0496103_0039877 3300048906 Bacteria 2886
182 Ga0496116_0000380 3300048919 Bacteria 65998
183 Ga0496116_0003445 3300048919 Bacteria 15617
184 Ga0496116_0005245 3300048919 Bacteria 12113
185 Ga0496116_0015307 3300048919 Bacteria 6067
186 Ga0496117_0001510 3300048920 Bacteria 33334
187 Ga0496117_0010083 3300048920 Bacteria 8675
188 Ga0496117_0011129 3300048920 Bacteria 8090
189 Ga0496118_0001956 3300048921 Bacteria 29198
190 Ga0496118_0002702 3300048921 Bacteria 23375
191 Ga0496118_0002990 3300048921 Bacteria 21862
192 Ga0496118_0012005 3300048921 Bacteria 8371
193 Ga0496118_0054807 3300048921 Bacteria 3016
194 Ga0496118_0164316 3300048921 Bacteria 1367
195 Ga0496119_0007327 3300048922 Bacteria 9980
196 Ga0496119_0057229 3300048922 Bacteria 2357
197 Ga0496119_0064152 3300048922 Bacteria 2182
198 Ga0496120_0092915 3300048923 Bacteria 1608
199 Ga0496121_0002903 3300048924 Bacteria 25156
200 Ga0496121_0065194 3300048924 Bacteria 2965
201 Ga0496122_0001636 3300048925 Bacteria 34822
202 Ga0496122_0005369 3300048925 Bacteria 15305
203 Ga0496122_0007429 3300048925 Bacteria 12184
204 Ga0496122_0075119 3300048925 Bacteria 2386
205 Ga0496122_0162913 3300048925 Bacteria 1357
206 Ga0496123_0018887 3300048926 Bacteria 5458
207 Ga0496123_0028943 3300048926 Bacteria 4090
208 Ga0496124_0000091 3300048927 Bacteria 189706
209 Ga0496124_0001332 3300048927 Bacteria 37075
210 Ga0496124_0001996 3300048927 Bacteria 27794
211 Ga0496124_0018208 3300048927 Bacteria 6587
212 Ga0496124_0112673 3300048927 Bacteria 2187
213 Ga0496124_0145254 3300048927 Bacteria 1867
214 Ga0496125_0008216 3300048928 Bacteria 10974
215 Ga0496125_0031051 3300048928 Bacteria 4768
216 Ga0496125_0130369 3300048928 Bacteria 1771
217 Ga0496126_0000293 3300048929 Bacteria 106340
218 Ga0496126_0181403 3300048929 Bacteria 1788
219 Ga0495678_027698 3300049459 Bacteria 2401
220 Ga0501032_0079644 3300049569 Bacteria 2181
221 Ga0501036_0035126 3300049572 Bacteria 4241
222 Ga0501038_0084636 3300049574 Bacteria 2668
223 Ga0501039_0017184 3300049575 Bacteria 5547
224 Ga0501048_0014876 3300049582 Bacteria 5753
225 Ga0501080_0105393 3300049742 Bacteria 2614
226 Ga0501035_0228587 3300049822 Bacteria 1586
227 Ga0501044_0125232 3300049823 Bacteria 2567
228 Ga0501044_0125234 3300049823 Bacteria 2567
229 Ga0501044_0155897 3300049823 Bacteria 2263
230 nmdc:mga00v17_230672_c1 3300050491 Bacteria 1199
231 nmdc:mga0yw44_245410_c1 3300050492 Bacteria 1191
232 nmdc:mga0k408_8377_c1 3300050493 Bacteria 5545
233 Ga0500610_0039072 3300053079 Bacteria 2447
234 Ga0500578_0170943 3300053086 Bacteria 1344
235 Ga0500557_004550 3300053105 Bacteria 2926
236 Ga0500562_004230 3300053108 Bacteria 3630
237 Ga0500569_001092 3300053109 Bacteria 4958
238 Ga0500569_004123 3300053109 Bacteria 3033
239 Ga0500572_000942 3300053111 Bacteria 8854
240 Ga0500594_0002548 3300053118 Bacteria 3965
241 Ga0500618_000908 3300053125 Bacteria 15486
242 Ga0500658_0007491 3300053134 Bacteria 4034
243 Ga0500568_0001264 3300053139 Bacteria 16716
244 Ga0500568_0100247 3300053139 Bacteria 1087
245 Ga0500573_0010842 3300053140 Bacteria 5091
246 Ga0500573_0029483 3300053140 Bacteria 3162
247 Ga0500616_0010238 3300053153 Bacteria 5622
248 Ga0500616_0015043 3300053153 Bacteria 4433
249 Ga0500627_0017996 3300053158 Bacteria 2789
250 Ga0500636_0000012 3300053177 Bacteria 132207
251 Ga0500636_0000639 3300053177 Bacteria 18889
252 Ga0500636_0002613 3300053177 Bacteria 10001
253 Ga0587090_013146 3300059510 Bacteria 1192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053139 Ga0500568_0100247 Ga0500568_0100247_137_1060 279
2 iso_pu_bacteria 2551306416 2553004202 291
3 iso_pu_bacteria 2923510766 2923512039 291
4 3300048925 Ga0496122_0162913 Ga0496122_0162913_426_1346 294
5 3300046492 Ga0495585_0196187 Ga0495585_0196187_28_930 296
6 3300046507 Ga0495606_0004915 Ga0495606_0004915_10983_11903 298
7 3300046512 Ga0495610_0008975 Ga0495610_0008975_5375_6295 298
8 3300046515 Ga0495620_0001324 Ga0495620_0001324_8809_9729 298
9 3300046522 Ga0495643_0008302 Ga0495643_0008302_2390_3310 298
10 3300046542 Ga0495597_0007189 Ga0495597_0007189_3963_4883 298
11 3300046616 Ga0495668_0061812 Ga0495668_0061812_554_1474 298
12 3300046694 Ga0495649_0015950 Ga0495649_0015950_2785_3705 298
13 3300046810 Ga0495660_0003657 Ga0495660_0003657_1323_2243 298
14 3300047472 Ga0495686_0014914 Ga0495686_0014914_45_965 298
15 3300053109 Ga0500569_001092 Ga0500569_001092_3406_4326 298
16 3300053134 Ga0500658_0007491 Ga0500658_0007491_2182_3102 298
17 3300053153 Ga0500616_0010238 Ga0500616_0010238_2313_3233 298
18 3300053158 Ga0500627_0017996 Ga0500627_0017996_1699_2619 298
19 3300009148 Ga0105243_10077543 Ga0105243_100775432 299
20 3300046558 Ga0495633_0043702 Ga0495633_0043702_193_1155 299
21 3300050492 nmdc:mga0yw44_245410_c1 nmdc:mga0yw44_245410_c1_33_953 301
22 3300046660 Ga0495625_0032066 Ga0495625_0032066_43_1005 302
23 3300048927 Ga0496124_0000091 Ga0496124_0000091_117787_118740 302
24 3300003781 Ga0055536_1011284 Ga0055536_10112842 305
25 3300025292 Ga0209676_1000026 Ga0209676_1000026407 305
26 3300025298 Ga0209050_1004960 Ga0209050_10049609 305
27 3300049575 Ga0501039_0017184 Ga0501039_0017184_4180_5163 305
28 3300049582 Ga0501048_0014876 Ga0501048_0014876_4384_5367 305
29 3300049742 Ga0501080_0105393 Ga0501080_0105393_27_1010 305
30 3300049823 Ga0501044_0125234 Ga0501044_0125234_408_1391 305
31 3300048925 Ga0496122_0001636 Ga0496122_0001636_985_1905 306
32 3300053140 Ga0500573_0029483 Ga0500573_0029483_363_1349 307
33 3300003792 Ga0055540_1009527 Ga0055540_10095273 309
34 3300025303 Ga0209051_1006630 Ga0209051_10066302 309
35 3300048920 Ga0496117_0011129 Ga0496117_0011129_895_1824 309
36 3300053140 Ga0500573_0010842 Ga0500573_0010842_2244_3221 309
37 3300053177 Ga0500636_0000012 Ga0500636_0000012_76045_76998 309
38 3300013102 Ga0157371_10029156 Ga0157371_100291563 310
39 3300013105 Ga0157369_10101433 Ga0157369_101014332 310
40 3300048919 Ga0496116_0000380 Ga0496116_0000380_47578_48543 310
41 3300048927 Ga0496124_0145254 Ga0496124_0145254_751_1716 310
42 3300048929 Ga0496126_0000293 Ga0496126_0000293_35485_36450 310
43 3300009545 Ga0105237_10000941 Ga0105237_1000094110 311
44 3300015262 Ga0182007_10006059 Ga0182007_100060595 311
45 3300044684 Ga0466966_0041445 Ga0466966_0041445_1762_2697 311
46 3300044694 Ga0466963_0006963 Ga0466963_0006963_487_1422 311
47 3300044719 Ga0466971_0046213 Ga0466971_0046213_944_1879 311
48 3300044765 Ga0466970_0001826 Ga0466970_0001826_2435_3370 311
49 3300044842 Ga0466957_0014112 Ga0466957_0014112_3641_4576 311
50 3300045836 Ga0466958_0005473 Ga0466958_0005473_328_1263 311
51 3300045976 Ga0466967_0185557 Ga0466967_0185557_918_1853 311
52 3300046459 Ga0495629_0110210 Ga0495629_0110210_362_1297 311
53 3300046476 Ga0495662_0002075 Ga0495662_0002075_8489_9424 311
54 3300046533 Ga0495640_0154853 Ga0495640_0154853_434_1369 311
55 3300047317 Ga0495604_0029769 Ga0495604_0029769_675_1610 311
56 3300048905 Ga0496102_0007618 Ga0496102_0007618_8022_8957 311
57 3300048906 Ga0496103_0039877 Ga0496103_0039877_330_1265 311
58 3300048919 Ga0496116_0005245 Ga0496116_0005245_6137_7072 311
59 3300048920 Ga0496117_0001510 Ga0496117_0001510_21621_22556 311
60 3300048921 Ga0496118_0001956 Ga0496118_0001956_21609_22544 311
61 3300048921 Ga0496118_0164316 Ga0496118_0164316_100_1035 311
62 3300048922 Ga0496119_0007327 Ga0496119_0007327_4147_5082 311
63 3300048922 Ga0496119_0057229 Ga0496119_0057229_449_1384 311
64 3300048923 Ga0496120_0092915 Ga0496120_0092915_211_1146 311
65 3300048924 Ga0496121_0002903 Ga0496121_0002903_6682_7617 311
66 3300048925 Ga0496122_0005369 Ga0496122_0005369_6826_7761 311
67 3300048925 Ga0496122_0075119 Ga0496122_0075119_24_962 311
68 3300048926 Ga0496123_0018887 Ga0496123_0018887_1354_2289 311
69 3300048926 Ga0496123_0028943 Ga0496123_0028943_3078_4013 311
70 3300048927 Ga0496124_0001996 Ga0496124_0001996_21961_22896 311
71 3300048927 Ga0496124_0018208 Ga0496124_0018208_984_1919 311
72 3300048928 Ga0496125_0008216 Ga0496125_0008216_1092_2027 311
73 3300048928 Ga0496125_0130369 Ga0496125_0130369_810_1748 311
74 3300049822 Ga0501035_0228587 Ga0501035_0228587_38_985 311
75 iso_pu_bacteria 2919679072 2919680446 311
76 3300003215 JGI25153J46596_10000553 JGI25153J46596_100005535 312
77 3300003790 Ga0055528_1008833 Ga0055528_10088332 312
78 3300025273 Ga0209673_1004631 Ga0209673_10046316 312
79 3300025297 Ga0209758_1001264 Ga0209758_100126417 312
80 3300025299 Ga0209256_1018185 Ga0209256_10181852 312
81 3300025303 Ga0209051_1026575 Ga0209051_10265752 312
82 3300041503 Ga0451847_0778576 Ga0451847_0778576_85_1047 312
83 3300041507 Ga0451851_0844213 Ga0451851_0844213_258_1220 312
84 3300046471 Ga0495650_0014044 Ga0495650_0014044_2233_3195 312
85 iso_pu_bacteria 2582581304 2585255650 312
86 iso_pu_bacteria 2738541317 2738944816 312
87 iso_pu_bacteria 2913308742 2913309437 312
88 3300003354 JGI25160J50197_1004068 JGI25160J50197_10040682 313
89 3300004625 Ga0055543_1000365 Ga0055543_10003654 313
90 3300005459 Ga0068867_100264188 Ga0068867_1002641881 313
91 3300014326 Ga0157380_10059875 Ga0157380_100598753 313
92 3300025302 Ga0207426_1000355 Ga0207426_10003559 313
93 3300025937 Ga0207669_10070667 Ga0207669_100706672 313
94 3300025938 Ga0207704_10301884 Ga0207704_103018841 313
95 3300025972 Ga0207668_10159736 Ga0207668_101597362 313
96 3300031456 Ga0307513_10007297 Ga0307513_1000729712 313
97 3300041491 Ga0451833_0435848 Ga0451833_0435848_158_1120 313
98 3300041492 Ga0451835_0651028 Ga0451835_0651028_318_1280 313
99 3300046492 Ga0495585_0113177 Ga0495585_0113177_127_1089 313
100 3300046524 Ga0495648_0046376 Ga0495648_0046376_1628_2590 313
101 3300046616 Ga0495668_0133327 Ga0495668_0133327_188_1150 313
102 3300053111 Ga0500572_000942 Ga0500572_000942_2724_3686 313
103 3300053177 Ga0500636_0000639 Ga0500636_0000639_12220_13182 313
104 3300032002 Ga0307416_100059958 Ga0307416_1000599582 314
105 iso_pu_bacteria 2899803654 2899806831 314
106 iso_pu_bacteria 2939598168 2939599521 315
107 3300046557 Ga0495622_0000783 Ga0495622_0000783_8606_9595 316
108 iso_pu_bacteria 2508501050 2508728285 316
109 iso_pu_bacteria 2508501114 2509075780 316
110 iso_pu_bacteria 2513237085 2513578324 316
111 iso_pu_bacteria 2513237093 2513631077 316
112 iso_pu_bacteria 2513237103 2513711018 316
113 iso_pu_bacteria 2515075009 2515108540 316
114 iso_pu_bacteria 2515154113 2515632291 316
115 iso_pu_bacteria 2515154116 2515658276 316
116 iso_pu_bacteria 2515154134 2515738049 316
117 iso_pu_bacteria 2516653077 2517041267 316
118 iso_pu_bacteria 2516653085 2517080110 316
119 iso_pu_bacteria 2517093000 2517098101 316
120 iso_pu_bacteria 2517287029 2517410125 316
121 iso_pu_bacteria 2585427526 2585525645 316
122 iso_pu_bacteria 2585427528 2585538746 316
123 iso_pu_bacteria 2585427593 2585836697 316
124 iso_pu_bacteria 2671180139 2671694748 316
125 iso_pu_bacteria 2724679232 2725947904 316
126 iso_pu_bacteria 2738541333 2739034168 316
127 iso_pu_bacteria 2765235802 2765467408 316
128 iso_pu_bacteria 2765235942 2766069379 316
129 iso_pu_bacteria 2775506901 2776259867 316
130 iso_pu_bacteria 2791355091 2792624629 316
131 iso_pu_bacteria 2791355092 2792630528 316
132 iso_pu_bacteria 2791355266 2793358200 316
133 iso_pu_bacteria 2802429633 2806042966 316
134 iso_pu_bacteria 2802429634 2806050919 316
135 iso_pu_bacteria 2802429635 2806057913 316
136 iso_pu_bacteria 2802429636 2806065373 316
137 iso_pu_bacteria 2802429637 2806076857 316
138 iso_pu_bacteria 2835312727 2835317017 316
139 iso_pu_bacteria 2838686498 2838687536 316
140 iso_pu_bacteria 2838729681 2838734052 316
141 iso_pu_bacteria 2838742623 2838746504 316
142 iso_pu_bacteria 2841851746 2841854085 316
143 iso_pu_bacteria 2842110456 2842111252 316
144 iso_pu_bacteria 2842156927 2842159548 316
145 iso_pu_bacteria 2842163707 2842163993 316
146 iso_pu_bacteria 2842180545 2842182882 316
147 iso_pu_bacteria 2842217011 2842221521 316
148 iso_pu_bacteria 2842229732 2842232593 316
149 iso_pu_bacteria 2842243621 2842247163 316
150 iso_pu_bacteria 2842257432 2842259150 316
151 iso_pu_bacteria 2842271015 2842272431 316
152 iso_pu_bacteria 2842304105 2842309775 316
153 iso_pu_bacteria 2844454524 2844460531 316
154 iso_pu_bacteria 2857516855 2857518106 316
155 iso_pu_bacteria 2884298095 2884301286 316
156 iso_pu_bacteria 2933570622 2933576217 316
157 iso_pu_bacteria 2933586486 2933587805 316
158 iso_pu_bacteria 2935901341 2935903095 316
159 iso_pu_bacteria 2936367885 2936374335 316
160 iso_pu_bacteria 2936375103 2936375157 316
161 iso_pu_bacteria 2978969890 2978970156 316
162 iso_pu_bacteria 2984587000 2984587183 316
163 iso_pu_bacteria 8005307578 8005307864 316
164 iso_pu_bacteria 8005376324 8005379863 316
165 iso_pu_bacteria 8005460587 8005467286 316
166 iso_pu_bacteria 8005556819 8005559416 316
167 iso_pu_bacteria 8005563573 8005565446 316
168 iso_pu_bacteria 8005570704 8005575819 316
169 iso_pu_bacteria 8018150411 8018155197 316
170 iso_pu_bacteria 8018163183 8018165585 316
171 iso_pu_bacteria 8023680758 8023688029 316
172 iso_pu_bacteria 8024479707 8024484959 316
173 iso_pu_bacteria 8054460903 8054464375 316
174 iso_pu_bacteria 8057874678 8057877940 316
175 3300005563 Ga0068855_100227080 Ga0068855_1002270802 317
176 3300006178 Ga0075367_10158316 Ga0075367_101583161 317
177 3300025949 Ga0207667_10205586 Ga0207667_102055862 317
178 3300039062 Ga0400483_161204 Ga0400483_161204_2906_3877 317
179 3300048921 Ga0496118_0002990 Ga0496118_0002990_6048_7001 317
180 3300048928 Ga0496125_0031051 Ga0496125_0031051_1767_2720 317
181 iso_pu_bacteria 2643221568 2643854970 317
182 iso_pu_bacteria 2841760612 2841763125 317
183 iso_pu_bacteria 2844104063 2844109005 317
184 iso_pu_bacteria 2851182111 2851182366 317
185 iso_pu_bacteria 2851246043 2851251112 317
186 iso_pu_bacteria 2919166419 2919170695 317
187 3300028794 Ga0307515_10005985 Ga0307515_1000598520 318
188 iso_pu_bacteria 2643221736 2644744659 318
189 iso_pu_bacteria 8057529695 8057534955 318
190 3300002987 JGI25159J45721_1003851 JGI25159J45721_10038512 319
191 3300059510 Ga0587090_013146 Ga0587090_013146_13_972 319
192 iso_pu_bacteria 2510917030 2511195067 319
193 iso_pu_bacteria 2513237138 2513868285 319
194 iso_pu_bacteria 2582581298 2585221946 319
195 iso_pu_bacteria 2582581867 2585404285 319
196 iso_pu_bacteria 2585427529 2585543884 319
197 iso_pu_bacteria 2585427590 2585823215 319
198 iso_pu_bacteria 2919100787 2919103101 319
199 iso_pu_bacteria 3005445848 3005451710 319
200 3300003775 Ga0055524_1015467 Ga0055524_10154672 320
201 3300006038 Ga0075365_10110537 Ga0075365_101105372 320
202 3300006177 Ga0075362_10055149 Ga0075362_100551492 320
203 3300006178 Ga0075367_10101284 Ga0075367_101012842 320
204 3300006195 Ga0075366_10014561 Ga0075366_100145614 320
205 3300006353 Ga0075370_10003432 Ga0075370_100034322 320
206 3300025245 Ga0207425_1014528 Ga0207425_10145282 320
207 3300025258 Ga0209129_1000548 Ga0209129_10005488 320
208 3300025273 Ga0209673_1001946 Ga0209673_10019462 320
209 3300025294 Ga0209025_1000397 Ga0209025_100039718 320
210 3300025297 Ga0209758_1001362 Ga0209758_100136210 320
211 3300025299 Ga0209256_1004795 Ga0209256_10047956 320
212 3300025303 Ga0209051_1003465 Ga0209051_10034659 320
213 3300027866 Ga0209813_10033691 Ga0209813_100336912 320
214 3300032002 Ga0307416_100101696 Ga0307416_1001016962 320
215 3300037471 Ga0395905_0027244 Ga0395905_0027244_3508_4524 320
216 3300045976 Ga0466967_0182524 Ga0466967_0182524_995_1969 320
217 3300048921 Ga0496118_0054807 Ga0496118_0054807_457_1419 320
218 3300049823 Ga0501044_0125232 Ga0501044_0125232_408_1391 320
219 3300050491 nmdc:mga00v17_230672_c1 nmdc:mga00v17_230672_c1_58_1020 320
220 3300050493 nmdc:mga0k408_8377_c1 nmdc:mga0k408_8377_c1_1022_1984 320
221 3300053086 Ga0500578_0170943 Ga0500578_0170943_237_1208 320
222 3300053125 Ga0500618_000908 Ga0500618_000908_11368_12330 320
223 3300053177 Ga0500636_0002613 Ga0500636_0002613_2216_3202 320
224 iso_pu_bacteria 2515154114 2515643453 320
225 iso_pu_bacteria 2874123672 2874127845 320
226 iso_pu_bacteria 2904578770 2904581765 320
227 iso_pu_bacteria 2917699015 2917702656 320
228 iso_pu_bacteria 2919119836 2919123432 320
229 iso_pu_bacteria 2509276021 2509390442 321
230 iso_pu_bacteria 2510917022 2511132654 321
231 iso_pu_bacteria 2513237144 2513911912 321
232 iso_pu_bacteria 2513237146 2513929211 321
233 iso_pu_bacteria 2582581299 2585229431 321
234 iso_pu_bacteria 2582581307 2585275534 321
235 iso_pu_bacteria 2582581308 2585278300 321
236 iso_pu_bacteria 2582581315 2585324858 321
237 iso_pu_bacteria 2582581316 2585332339 321
238 iso_pu_bacteria 2585427527 2585532043 321
239 iso_pu_bacteria 2585427530 2585552403 321
240 iso_pu_bacteria 2585427531 2585562610 321
241 iso_pu_bacteria 2585427608 2585899279 321
242 iso_pu_bacteria 2585427609 2585906222 321
243 iso_pu_bacteria 2585428125 2587981644 321
244 iso_pu_bacteria 2599185156 2599334148 321
245 iso_pu_bacteria 2599185170 2599415560 321
246 iso_pu_bacteria 2615840626 2616307818 321
247 iso_pu_bacteria 2615840698 2616552405 321
248 iso_pu_bacteria 2617270742 2617381857 321
249 iso_pu_bacteria 2667528174 2671112841 321
250 iso_pu_bacteria 2767802442 2770196691 321
251 iso_pu_bacteria 2775506902 2776272721 321
252 iso_pu_bacteria 2775506904 2776284664 321
253 iso_pu_bacteria 2775507266 2778178328 321
254 iso_pu_bacteria 2818991448 2819607946 321
255 iso_pu_bacteria 2818991453 2819640288 321
256 iso_pu_bacteria 2838022645 2838029033 321
257 iso_pu_bacteria 2838029111 2838032797 321
258 iso_pu_bacteria 2838035591 2838035678 321
259 iso_pu_bacteria 2838074704 2838080171 321
260 iso_pu_bacteria 2838661181 2838665265 321
261 iso_pu_bacteria 2840764183 2840768784 321
262 iso_pu_bacteria 2841864319 2841866236 321
263 iso_pu_bacteria 2842198810 2842205192 321
264 iso_pu_bacteria 2842341865 2842342133 321
265 iso_pu_bacteria 2842363717 2842365890 321
266 iso_pu_bacteria 2842475841 2842479529 321
267 iso_pu_bacteria 2842482326 2842486941 321
268 iso_pu_bacteria 2842502639 2842506805 321
269 iso_pu_bacteria 2842922631 2842925571 321
270 iso_pu_bacteria 2852387548 2852394188 321
271 iso_pu_bacteria 2919408235 2919412627 321
272 iso_pu_bacteria 2933016740 2933022905 321
273 iso_pu_bacteria 3005416602 3005421203 321
274 iso_pu_bacteria 8005314921 8005319062 321
275 iso_pu_bacteria 8005484373 8005489617 321
276 iso_pu_bacteria 8005645114 8005650478 321
277 iso_pu_bacteria 8005682033 8005684134 321
278 iso_pu_bacteria 8046767195 8046772902 321
279 iso_pu_bacteria 8057575449 8057576356 321
280 3300005262 Ga0065165_1000139 Ga0065165_10001396 322
281 3300025284 Ga0209130_1000148 Ga0209130_100014888 322
282 3300025294 Ga0209025_1005708 Ga0209025_10057086 322
283 3300002739 JGI25158J39367_1000735 JGI25158J39367_10007352 323
284 3300002773 JGI25152J39213_1006956 JGI25152J39213_10069563 323
285 3300002773 JGI25152J39213_1006992 JGI25152J39213_10069923 323
286 3300002987 JGI25159J45721_1000765 JGI25159J45721_10007659 323
287 3300003215 JGI25153J46596_10016268 JGI25153J46596_100162681 323
288 3300003215 JGI25153J46596_10016362 JGI25153J46596_100163621 323
289 3300003354 JGI25160J50197_1015336 JGI25160J50197_10153362 323
290 3300003374 JGI25161J50226_1000154 JGI25161J50226_10001547 323
291 3300003771 Ga0055526_1002237 Ga0055526_10022376 323
292 3300003775 Ga0055524_1003101 Ga0055524_10031013 323
293 3300003790 Ga0055528_1002344 Ga0055528_100234410 323
294 3300004625 Ga0055543_1000513 Ga0055543_10005137 323
295 3300005347 Ga0070668_100086638 Ga0070668_1000866382 323
296 3300025208 Ga0209436_100021 Ga0209436_1000217 323
297 3300025245 Ga0207425_1000753 Ga0207425_100075315 323
298 3300025258 Ga0209129_1000962 Ga0209129_100096215 323
299 3300025258 Ga0209129_1001002 Ga0209129_10010025 323
300 3300025273 Ga0209673_1003429 Ga0209673_10034298 323
301 3300025273 Ga0209673_1008106 Ga0209673_10081064 323
302 3300025284 Ga0209130_1000019 Ga0209130_100001973 323
303 3300025294 Ga0209025_1002744 Ga0209025_10027445 323
304 3300025295 Ga0209564_1001757 Ga0209564_10017577 323
305 3300025297 Ga0209758_1002029 Ga0209758_10020297 323
306 3300025297 Ga0209758_1002190 Ga0209758_100219011 323
307 3300025302 Ga0207426_1000005 Ga0207426_1000005534 323
308 3300025304 Ga0209257_1016951 Ga0209257_10169512 323
309 3300046513 Ga0495616_0022770 Ga0495616_0022770_1050_2033 323
310 3300046515 Ga0495620_0080875 Ga0495620_0080875_64_1047 323
311 3300046518 Ga0495631_0007668 Ga0495631_0007668_867_1850 323
312 3300046538 Ga0495609_0032496 Ga0495609_0032496_1307_2290 323
313 3300046616 Ga0495668_0015155 Ga0495668_0015155_2725_3708 323
314 3300046648 Ga0495611_0003083 Ga0495611_0003083_1844_2827 323
315 3300046660 Ga0495625_0008605 Ga0495625_0008605_901_1884 323
316 3300049459 Ga0495678_027698 Ga0495678_027698_85_1068 323
317 3300053079 Ga0500610_0039072 Ga0500610_0039072_778_1761 323
318 3300053105 Ga0500557_004550 Ga0500557_004550_670_1653 323
319 3300053109 Ga0500569_004123 Ga0500569_004123_911_1894 323
320 3300053118 Ga0500594_0002548 Ga0500594_0002548_246_1229 323
321 iso_pu_bacteria 2585427594 2585842401 323
322 iso_pu_bacteria 2738541293 2738802615 323
323 3300013250 Ga0171462_1020 Ga0171462_1020116 324
324 3300001979 JGI24740J21852_10001730 JGI24740J21852_100017303 325
325 3300002704 JGI25155J39150_1000003 JGI25155J39150_1000003270 325
326 3300002705 JGI25156J39149_1000004 JGI25156J39149_1000004264 325
327 3300002737 JGI25162J39368_1000114 JGI25162J39368_100011433 325
328 3300002737 JGI25162J39368_1000222 JGI25162J39368_100022239 325
329 3300002738 JGI25154J39366_1000088 JGI25154J39366_100008812 325
330 3300002741 JGI25157J39369_1000004 JGI25157J39369_100000412 325
331 3300002773 JGI25152J39213_1000209 JGI25152J39213_10002099 325
332 3300002774 JGI25150J39212_1000101 JGI25150J39212_100010113 325
333 3300003187 JGI25151J46595_10000085 JGI25151J46595_1000008534 325
334 3300003214 JGI25165J46597_1000232 JGI25165J46597_100023234 325
335 3300003214 JGI25165J46597_1000233 JGI25165J46597_100023328 325
336 3300003214 JGI25165J46597_1004896 JGI25165J46597_10048963 325
337 3300003215 JGI25153J46596_10018285 JGI25153J46596_100182852 325
338 3300003322 rootL2_10009270 rootL2_100092704 325
339 3300003323 rootH1_10019141 rootH1_100191413 325
340 3300003775 Ga0055524_1007531 Ga0055524_10075314 325
341 3300003790 Ga0055528_1000745 Ga0055528_100074511 325
342 3300005367 Ga0070667_100027677 Ga0070667_1000276773 325
343 3300005548 Ga0070665_100058456 Ga0070665_1000584563 325
344 3300005616 Ga0068852_100225279 Ga0068852_1002252792 325
345 3300006353 Ga0075370_10016298 Ga0075370_100162985 325
346 3300009093 Ga0105240_10000012 Ga0105240_10000012198 325
347 3300013104 Ga0157370_10002378 Ga0157370_100023788 325
348 3300025206 Ga0209435_100006 Ga0209435_10000613 325
349 3300025233 Ga0209437_100022 Ga0209437_100022446 325
350 3300025233 Ga0209437_100040 Ga0209437_100040204 325
351 3300025245 Ga0207425_1000065 Ga0207425_100006532 325
352 3300025246 Ga0209646_1000015 Ga0209646_1000015521 325
353 3300025246 Ga0209646_1004264 Ga0209646_10042642 325
354 3300025250 Ga0209026_1000039 Ga0209026_100003913 325
355 3300025253 Ga0209677_100204 Ga0209677_1002043 325
356 3300025254 Ga0209148_1005819 Ga0209148_10058192 325
357 3300025256 Ga0209759_1000005 Ga0209759_100000513 325
358 3300025258 Ga0209129_1000132 Ga0209129_100013232 325
359 3300025261 Ga0209233_1000031 Ga0209233_1000031446 325
360 3300025261 Ga0209233_1000051 Ga0209233_1000051205 325
361 3300025261 Ga0209233_1000146 Ga0209233_100014613 325
362 3300025273 Ga0209673_1000005 Ga0209673_1000005641 325
363 3300025292 Ga0209676_1011179 Ga0209676_10111793 325
364 3300025294 Ga0209025_1000247 Ga0209025_100024732 325
365 3300025294 Ga0209025_1015458 Ga0209025_10154582 325
366 3300025295 Ga0209564_1008179 Ga0209564_10081796 325
367 3300025297 Ga0209758_1000212 Ga0209758_100021232 325
368 3300025299 Ga0209256_1005014 Ga0209256_10050142 325
369 3300025913 Ga0207695_10000120 Ga0207695_1000012015 325
370 3300025914 Ga0207671_10000023 Ga0207671_1000002370 325
371 3300025986 Ga0207658_10019123 Ga0207658_100191233 325
372 3300026078 Ga0207702_10254542 Ga0207702_102545422 325
373 3300027312 Ga0209371_1003015 Ga0209371_10030154 325
374 3300028379 Ga0268266_10098548 Ga0268266_100985482 325
375 3300030500 Ga0268256_1002669 Ga0268256_10026695 325
376 3300031731 Ga0307405_10001611 Ga0307405_100016116 325
377 3300041498 Ga0451841_0040513 Ga0451841_0040513_251_1315 325
378 3300041505 Ga0451849_1221770 Ga0451849_1221770_523_1503 325
379 3300046519 Ga0495632_0000023 Ga0495632_0000023_141145_142143 325
380 3300046519 Ga0495632_0002480 Ga0495632_0002480_3015_3995 325
381 3300046522 Ga0495643_0054699 Ga0495643_0054699_33_1022 325
382 3300046525 Ga0495663_0000059 Ga0495663_0000059_38791_39789 325
383 3300046558 Ga0495633_0002084 Ga0495633_0002084_11531_12529 325
384 3300047472 Ga0495686_0104783 Ga0495686_0104783_88_1083 325
385 3300048919 Ga0496116_0003445 Ga0496116_0003445_10038_11024 325
386 3300048919 Ga0496116_0015307 Ga0496116_0015307_209_1195 325
387 3300048920 Ga0496117_0010083 Ga0496117_0010083_3193_4179 325
388 3300048921 Ga0496118_0002702 Ga0496118_0002702_14247_15233 325
389 3300048921 Ga0496118_0012005 Ga0496118_0012005_4741_5727 325
390 3300048922 Ga0496119_0064152 Ga0496119_0064152_363_1349 325
391 3300048924 Ga0496121_0065194 Ga0496121_0065194_72_1055 325
392 3300048925 Ga0496122_0007429 Ga0496122_0007429_7875_8861 325
393 3300048927 Ga0496124_0001332 Ga0496124_0001332_10783_11769 325
394 3300048927 Ga0496124_0112673 Ga0496124_0112673_947_1942 325
395 3300048929 Ga0496126_0181403 Ga0496126_0181403_660_1646 325
396 3300049569 Ga0501032_0079644 Ga0501032_0079644_1009_2004 325
397 3300049572 Ga0501036_0035126 Ga0501036_0035126_2698_3693 325
398 3300049574 Ga0501038_0084636 Ga0501038_0084636_1138_2133 325
399 3300049823 Ga0501044_0155897 Ga0501044_0155897_1244_2239 325
400 3300053108 Ga0500562_004230 Ga0500562_004230_1144_2133 325
401 3300053139 Ga0500568_0001264 Ga0500568_0001264_4550_5539 325
402 3300053153 Ga0500616_0015043 Ga0500616_0015043_96_1085 325

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.6365 1 313
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.6166 1 313
7ahr-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.615 1 308
7an7-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.606 1 308
2nxo-assembly2.cif.gz_C crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178 0.6027 5 309
ID Description Score Start End Superfamily
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7684 85 180 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7367 81 197 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7282 85 178 3.40.190.10
4zefA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7022 85 199 3.40.190.10
1q1kA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6838 84 196 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W5N9S3-F1-model_v4 deleted 0.9828 1 313
AF-A0A3D0EQ18-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.981 1 313
AF-A0A7V8SNN9-F1-model_v4 ABC transporter substrate-binding protein 0.9809 3 313
AF-A0A2V3SPM9-F1-model_v4 deleted 0.9801 1 313
AF-A0A419N9Y8-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.98 1 313

Feature Viewer

pLDDT pTM Quality
94.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map