F435122

General Info

Members Datasets Scaffolds Average Seq Length
402 141 804 312

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100060269|Ga0307408_1000602692
Length 284
Sequence MIELLTDNPPLKYLLLVSLFAVIVAGAYFAAVAVIARQLARERLAEAGTASEPVAVAGSLRSDRVESAWMKLVTKDEKVRRTLIAAGYSAPYAPRVYTLVRLVAVIALPALVLLYYWAIGSVVIAAGLGLYLPVLLVRAKADRRQREIVNGFPDALDLMLVCVEAGLGLEAAFARVGMEMTESHPRIAEQLGTVTLELRAGRNREDALRRLADRAGTDEIRAFATLLIQSTKLGSSVAQTLRIYASEMRERRRLRAEEKAHRLPVLLSIPLVVCMRSVMPALGG

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.49
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100060269 3300031548 Bacteria 2766
2 JGI24740J21852_10051806 3300001979 Bacteria 1172
3 JGI24739J22299_10027449 3300001989 Unclassified 1990
4 JGI24737J22298_10000926 3300001990 Bacteria 10435
5 JGI24737J22298_10021284 3300001990 Bacteria 2068
6 JGI24735J21928_10007235 3300002067 Bacteria 3621
7 JGI24735J21928_10017848 3300002067 Bacteria 2192
8 rootH1_10036246 3300003323 Bacteria 4087
9 rootH1_10254987 3300003323 Bacteria 3729
10 Ga0065712_10081291 3300005290 Unclassified 3020
11 Ga0065715_10169149 3300005293 Bacteria 1561
12 Ga0070658_10004010 3300005327 Bacteria 12066
13 Ga0070658_10015133 3300005327 Bacteria 6173
14 Ga0070658_10033983 3300005327 Bacteria 4103
15 Ga0070658_10046335 3300005327 Bacteria 3519
16 Ga0070658_10053920 3300005327 Bacteria 3265
17 Ga0070658_10250229 3300005327 Bacteria 1503
18 Ga0070658_10491734 3300005327 Bacteria 1059
19 Ga0070676_10135436 3300005328 Bacteria 1562
20 Ga0070683_100055368 3300005329 Bacteria 3681
21 Ga0070670_100028445 3300005331 Bacteria 4810
22 Ga0070677_10046476 3300005333 Bacteria 1736
23 Ga0070666_10018154 3300005335 Bacteria 4519
24 Ga0070666_10037011 3300005335 Bacteria 3243
25 Ga0070680_100218453 3300005336 Bacteria 1608
26 Ga0070682_100021324 3300005337 Bacteria 3821
27 Ga0070660_100002698 3300005339 Bacteria 12183
28 Ga0070660_100013841 3300005339 Bacteria 5802
29 Ga0070660_100020332 3300005339 Bacteria 4877
30 Ga0070660_100073055 3300005339 Bacteria 2681
31 Ga0070660_100141793 3300005339 Bacteria 1928
32 Ga0070660_100372318 3300005339 Bacteria 1178
33 Ga0070691_10039133 3300005341 Bacteria 2240
34 Ga0070661_100004157 3300005344 Bacteria 9986
35 Ga0070661_100010367 3300005344 Bacteria 6479
36 Ga0070661_100012179 3300005344 Bacteria 6013
37 Ga0070669_100134098 3300005353 Unclassified 1903
38 Ga0070669_100231075 3300005353 Bacteria 1466
39 Ga0070675_100016604 3300005354 Bacteria 5844
40 Ga0070675_100077204 3300005354 Bacteria 2772
41 Ga0070671_100013427 3300005355 Bacteria 6603
42 Ga0070671_100039794 3300005355 Bacteria 3903
43 Ga0070671_100128398 3300005355 Unclassified 2134
44 Ga0070671_100186368 3300005355 Bacteria 1758
45 Ga0070674_100157963 3300005356 Bacteria 1718
46 Ga0070673_100028714 3300005364 Unclassified 4140
47 Ga0070659_100000972 3300005366 Bacteria 21069
48 Ga0070659_100004636 3300005366 Bacteria 9822
49 Ga0070659_100007991 3300005366 Bacteria 7710
50 Ga0070659_100016976 3300005366 Bacteria 5471
51 Ga0070659_100040619 3300005366 Bacteria 3635
52 Ga0070667_100035739 3300005367 Bacteria 4163
53 Ga0070663_100008280 3300005455 Bacteria 6388
54 Ga0070663_100045039 3300005455 Bacteria 3115
55 Ga0070663_100115063 3300005455 Bacteria 2026
56 Ga0070663_100263428 3300005455 Bacteria 1368
57 Ga0070662_100001755 3300005457 Bacteria 13350
58 Ga0070662_100004336 3300005457 Bacteria 8961
59 Ga0070662_100008316 3300005457 Bacteria 6762
60 Ga0070662_100069730 3300005457 Bacteria 2589
61 Ga0070662_100077397 3300005457 Bacteria 2468
62 Ga0070662_100133167 3300005457 Bacteria 1919
63 Ga0070681_10085086 3300005458 Bacteria 3115
64 Ga0068867_100261041 3300005459 Bacteria 1412
65 Ga0070679_100012572 3300005530 Bacteria 8094
66 Ga0070679_100166905 3300005530 Bacteria 2174
67 Ga0068853_100001668 3300005539 Bacteria 16249
68 Ga0068853_100013276 3300005539 Bacteria 6726
69 Ga0068853_100048596 3300005539 Bacteria 3645
70 Ga0068853_100101205 3300005539 Bacteria 2548
71 Ga0068853_100154741 3300005539 Bacteria 2065
72 Ga0068853_100333342 3300005539 Bacteria 1408
73 Ga0068853_100527112 3300005539 Bacteria 1117
74 Ga0070672_100015229 3300005543 Bacteria 5468
75 Ga0070672_100106789 3300005543 Bacteria 2278
76 Ga0070672_100154266 3300005543 Bacteria 1902
77 Ga0068855_100015231 3300005563 Bacteria 9258
78 Ga0068855_100022227 3300005563 Bacteria 7601
79 Ga0068855_100080854 3300005563 Bacteria 3768
80 Ga0070664_100001054 3300005564 Bacteria 21689
81 Ga0070664_100123173 3300005564 Bacteria 2272
82 Ga0068857_100013056 3300005577 Bacteria 7236
83 Ga0068857_100032006 3300005577 Bacteria 4648
84 Ga0068857_100528180 3300005577 Unclassified 1110
85 Ga0068854_100001447 3300005578 Bacteria 14367
86 Ga0068856_100024465 3300005614 Bacteria 5880
87 Ga0068856_100057031 3300005614 Bacteria 3856
88 Ga0068852_100015477 3300005616 Bacteria 5919
89 Ga0068852_100019599 3300005616 Bacteria 5358
90 Ga0068852_100069089 3300005616 Bacteria 3095
91 Ga0068852_100325228 3300005616 Bacteria 1494
92 Ga0068859_100351943 3300005617 Bacteria 1568
93 Ga0068864_100027585 3300005618 Bacteria 4797
94 Ga0068864_100032518 3300005618 Bacteria 4433
95 Ga0068863_100259819 3300005841 Bacteria 1678
96 Ga0068863_100386710 3300005841 Bacteria 1367
97 Ga0070717_10122779 3300006028 Bacteria 2227
98 Ga0068871_100040539 3300006358 Bacteria 3730
99 Ga0068871_100127389 3300006358 Bacteria 2156
100 Ga0097620_100351929 3300006931 Bacteria 1568
101 Ga0105240_10007907 3300009093 Bacteria 15338
102 Ga0105240_10119695 3300009093 Bacteria 3172
103 Ga0105245_10082560 3300009098 Bacteria 2940
104 Ga0105248_10005944 3300009177 Bacteria 13408
105 Ga0105248_10025054 3300009177 Bacteria 6632
106 Ga0105248_10054333 3300009177 Bacteria 4491
107 Ga0105248_10094127 3300009177 Bacteria 3374
108 Ga0105248_10112029 3300009177 Unclassified 3078
109 Ga0105248_10243138 3300009177 Bacteria 2026
110 Ga0105238_10040974 3300009551 Bacteria 4692
111 Ga0105238_10075088 3300009551 Unclassified 3372
112 Ga0105238_10324523 3300009551 Bacteria 1526
113 Ga0105239_10457783 3300010375 Bacteria 1448
114 Ga0157373_10022503 3300013100 Bacteria 4573
115 Ga0157373_10175375 3300013100 Bacteria 1509
116 Ga0157371_10003108 3300013102 Bacteria 15354
117 Ga0157371_10041370 3300013102 Bacteria 3289
118 Ga0157371_10046157 3300013102 Bacteria 3099
119 Ga0157370_10049450 3300013104 Bacteria 4024
120 Ga0157369_10002143 3300013105 Bacteria 23814
121 Ga0157369_10004627 3300013105 Bacteria 16166
122 Ga0157369_10009632 3300013105 Bacteria 11047
123 Ga0157369_10167041 3300013105 Bacteria 2320
124 Ga0157374_10077980 3300013296 Unclassified 3137
125 Ga0157372_10003926 3300013307 Bacteria 15969
126 Ga0157372_10628868 3300013307 Bacteria 1251
127 Ga0157375_10105782 3300013308 Unclassified 2905
128 Ga0157375_10226283 3300013308 Bacteria 2029
129 Ga0163163_10004776 3300014325 Bacteria 11626
130 Ga0213875_10026190 3300021388 Bacteria 2775
131 Ga0207682_10033641 3300025893 Bacteria 2065
132 Ga0207680_10063962 3300025903 Bacteria 2253
133 Ga0207680_10077020 3300025903 Bacteria 2084
134 Ga0207680_10231742 3300025903 Bacteria 1270
135 Ga0207647_10003500 3300025904 Bacteria 11775
136 Ga0207647_10004134 3300025904 Bacteria 10774
137 Ga0207705_10003916 3300025909 Bacteria 11315
138 Ga0207705_10005464 3300025909 Bacteria 9504
139 Ga0207705_10014372 3300025909 Bacteria 5697
140 Ga0207705_10041416 3300025909 Bacteria 3305
141 Ga0207705_10043260 3300025909 Bacteria 3235
142 Ga0207705_10076015 3300025909 Bacteria 2441
143 Ga0207705_10088758 3300025909 Unclassified 2262
144 Ga0207707_10015603 3300025912 Bacteria 6618
145 Ga0207707_10193042 3300025912 Bacteria 1776
146 Ga0207707_10204752 3300025912 Bacteria 1720
147 Ga0207695_10005397 3300025913 Bacteria 16978
148 Ga0207695_10039949 3300025913 Bacteria 5038
149 Ga0207660_10056351 3300025917 Bacteria 2812
150 Ga0207660_10058113 3300025917 Bacteria 2772
151 Ga0207660_10070242 3300025917 Bacteria 2545
152 Ga0207657_10000548 3300025919 Bacteria 40056
153 Ga0207657_10001957 3300025919 Bacteria 22218
154 Ga0207657_10026718 3300025919 Bacteria 5298
155 Ga0207649_10001492 3300025920 Bacteria 13737
156 Ga0207649_10003891 3300025920 Bacteria 8146
157 Ga0207649_10056803 3300025920 Bacteria 2445
158 Ga0207649_10074526 3300025920 Bacteria 2178
159 Ga0207649_10092841 3300025920 Bacteria 1979
160 Ga0207649_10097926 3300025920 Bacteria 1935
161 Ga0207649_10104990 3300025920 Bacteria 1877
162 Ga0207652_10030293 3300025921 Bacteria 4530
163 Ga0207681_10202667 3300025923 Bacteria 1524
164 Ga0207694_10000403 3300025924 Bacteria 40239
165 Ga0207650_10006489 3300025925 Bacteria 7973
166 Ga0207650_10074181 3300025925 Bacteria 2564
167 Ga0207659_10050270 3300025926 Bacteria 2961
168 Ga0207659_10134873 3300025926 Bacteria 1910
169 Ga0207644_10008794 3300025931 Bacteria 6609
170 Ga0207644_10027738 3300025931 Bacteria 3914
171 Ga0207644_10040928 3300025931 Bacteria 3276
172 Ga0207644_10058625 3300025931 Bacteria 2783
173 Ga0207644_10129288 3300025931 Bacteria 1932
174 Ga0207690_10013716 3300025932 Bacteria 4877
175 Ga0207690_10015425 3300025932 Bacteria 4630
176 Ga0207690_10087632 3300025932 Bacteria 2191
177 Ga0207690_10346598 3300025932 Bacteria 1173
178 Ga0207706_10004129 3300025933 Bacteria 13706
179 Ga0207706_10006385 3300025933 Bacteria 10953
180 Ga0207706_10029496 3300025933 Bacteria 4897
181 Ga0207706_10035234 3300025933 Unclassified 4450
182 Ga0207706_10051023 3300025933 Bacteria 3654
183 Ga0207706_10117729 3300025933 Bacteria 2336
184 Ga0207669_10090877 3300025937 Bacteria 1987
185 Ga0207691_10026745 3300025940 Bacteria 5413
186 Ga0207691_10159244 3300025940 Bacteria 1981
187 Ga0207691_10230955 3300025940 Bacteria 1602
188 Ga0207711_10042313 3300025941 Bacteria 3881
189 Ga0207711_10075070 3300025941 Bacteria 2942
190 Ga0207711_10176737 3300025941 Bacteria 1940
191 Ga0207679_10023393 3300025945 Bacteria 4224
192 Ga0207679_10032675 3300025945 Unclassified 3656
193 Ga0207679_10099406 3300025945 Bacteria 2272
194 Ga0207667_10012544 3300025949 Bacteria 9754
195 Ga0207667_10098597 3300025949 Bacteria 3015
196 Ga0207651_10056057 3300025960 Unclassified 2710
197 Ga0207651_10217010 3300025960 Bacteria 1544
198 Ga0207640_10000758 3300025981 Bacteria 18461
199 Ga0207640_10171762 3300025981 Bacteria 1616
200 Ga0207658_10086102 3300025986 Bacteria 2422
201 Ga0207677_10002311 3300026023 Bacteria 10019
202 Ga0207639_10000121 3300026041 Bacteria 59338
203 Ga0207639_10002825 3300026041 Bacteria 11651
204 Ga0207639_10009079 3300026041 Bacteria 6849
205 Ga0207639_10039041 3300026041 Bacteria 3535
206 Ga0207639_10101935 3300026041 Bacteria 2322
207 Ga0207678_10006249 3300026067 Bacteria 10581
208 Ga0207678_10011480 3300026067 Bacteria 7779
209 Ga0207678_10077405 3300026067 Bacteria 2849
210 Ga0207678_10198407 3300026067 Bacteria 1715
211 Ga0207702_10052918 3300026078 Bacteria 3437
212 Ga0207702_10093720 3300026078 Bacteria 2634
213 Ga0207641_10035239 3300026088 Bacteria 4168
214 Ga0207641_10166817 3300026088 Bacteria 2006
215 Ga0207648_10173905 3300026089 Bacteria 1904
216 Ga0207676_10012655 3300026095 Bacteria 6052
217 Ga0207676_10021060 3300026095 Bacteria 4779
218 Ga0207674_10000796 3300026116 Bacteria 41120
219 Ga0207674_10036196 3300026116 Bacteria 5146
220 Ga0207674_10211239 3300026116 Bacteria 1890
221 Ga0207683_10160315 3300026121 Bacteria 2033
222 Ga0207698_10001838 3300026142 Bacteria 12398
223 Ga0207698_10004900 3300026142 Bacteria 8210
224 Ga0207698_10155483 3300026142 Unclassified 1991
225 Ga0314311_1243533 3300030733 Bacteria 2008
226 Ga0307408_100105394 3300031548 Bacteria 2155
227 Ga0307408_100248536 3300031548 Bacteria 1466
228 Ga0307405_10008856 3300031731 Bacteria 5130
229 Ga0307405_10011699 3300031731 Bacteria 4614
230 Ga0307405_10019320 3300031731 Bacteria 3781
231 Ga0307405_10108569 3300031731 Bacteria 1875
232 Ga0307413_10002118 3300031824 Bacteria 7960
233 Ga0307413_10013428 3300031824 Bacteria 4117
234 Ga0307413_10037036 3300031824 Bacteria 2815
235 Ga0307410_10021839 3300031852 Bacteria 3943
236 Ga0307410_10065638 3300031852 Bacteria 2497
237 Ga0307410_10203363 3300031852 Bacteria 1513
238 Ga0307406_10034657 3300031901 Bacteria 3098
239 Ga0307406_10065097 3300031901 Bacteria 2368
240 Ga0307406_10096273 3300031901 Unclassified 2005
241 Ga0307406_10164879 3300031901 Bacteria 1597
242 Ga0307407_10011214 3300031903 Bacteria 4255
243 Ga0307407_10030727 3300031903 Bacteria 2901
244 Ga0307407_10064115 3300031903 Bacteria 2158
245 Ga0307412_10090084 3300031911 Bacteria 2143
246 Ga0307412_10180086 3300031911 Bacteria 1589
247 Ga0307409_100006542 3300031995 Bacteria 6862
248 Ga0307409_100007108 3300031995 Bacteria 6664
249 Ga0307409_100007599 3300031995 Bacteria 6499
250 Ga0307409_100036018 3300031995 Bacteria 3632
251 Ga0307409_100106008 3300031995 Bacteria 2344
252 Ga0307409_100108595 3300031995 Unclassified 2321
253 Ga0307409_100234223 3300031995 Bacteria 1667
254 Ga0307409_100244303 3300031995 Bacteria 1636
255 Ga0307409_100310817 3300031995 Bacteria 1471
256 Ga0307409_100599294 3300031995 Bacteria 1089
257 Ga0307416_100007711 3300032002 Bacteria 6875
258 Ga0307416_100066465 3300032002 Bacteria 2968
259 Ga0307416_100108738 3300032002 Bacteria 2437
260 Ga0307416_100706260 3300032002 Bacteria 1098
261 Ga0307414_10002041 3300032004 Bacteria 10494
262 Ga0307414_10035172 3300032004 Bacteria 3331
263 Ga0307414_10081535 3300032004 Bacteria 2369
264 Ga0307414_10096506 3300032004 Bacteria 2212
265 Ga0307411_10030357 3300032005 Bacteria 3312
266 Ga0307411_10184591 3300032005 Bacteria 1586
267 Ga0307411_10427405 3300032005 Bacteria 1102
268 Ga0307415_100002776 3300032126 Bacteria 8764
269 Ga0307415_100002850 3300032126 Bacteria 8657
270 Ga0307415_100062670 3300032126 Bacteria 2580
271 Ga0307415_100127266 3300032126 Bacteria 1922
272 Ga0395899_0002723 3300037312 Bacteria 14257
273 Ga0395899_0003843 3300037312 Bacteria 11842
274 Ga0395899_0005047 3300037312 Bacteria 10270
275 Ga0395899_0009949 3300037312 Bacteria 7294
276 Ga0395899_0026243 3300037312 Bacteria 4396
277 Ga0395899_0259633 3300037312 Bacteria 1189
278 Ga0395899_0283960 3300037312 Bacteria 1125
279 Ga0395899_0295985 3300037312 Bacteria 1097
280 Ga0395899_0319437 3300037312 Bacteria 1046
281 Ga0395900_0015434 3300037418 Bacteria 7786
282 Ga0395900_0016549 3300037418 Bacteria 7524
283 Ga0395900_0024859 3300037418 Bacteria 6130
284 Ga0395900_0035537 3300037418 Bacteria 5132
285 Ga0395900_0041561 3300037418 Unclassified 4740
286 Ga0395900_0048117 3300037418 Bacteria 4392
287 Ga0395900_0049732 3300037418 Bacteria 4319
288 Ga0395900_0055366 3300037418 Bacteria 4085
289 Ga0395900_0060081 3300037418 Unclassified 3912
290 Ga0395900_0069076 3300037418 Bacteria 3631
291 Ga0395900_0079392 3300037418 Bacteria 3372
292 Ga0395900_0141227 3300037418 Bacteria 2466
293 Ga0395900_0159740 3300037418 Bacteria 2299
294 Ga0395900_0161465 3300037418 Bacteria 2285
295 Ga0395900_0236135 3300037418 Bacteria 1836
296 Ga0395898_0013920 3300037466 Bacteria 8267
297 Ga0395898_0019136 3300037466 Bacteria 6971
298 Ga0395898_0020958 3300037466 Bacteria 6632
299 Ga0395898_0024365 3300037466 Bacteria 6103
300 Ga0395898_0033016 3300037466 Bacteria 5166
301 Ga0395898_0040687 3300037466 Bacteria 4594
302 Ga0395898_0116665 3300037466 Bacteria 2558
303 Ga0395898_0265391 3300037466 Bacteria 1637
304 Ga0395905_0004441 3300037471 Bacteria 14579
305 Ga0395905_0004688 3300037471 Bacteria 14133
306 Ga0395905_0011338 3300037471 Bacteria 8620
307 Ga0395905_0014168 3300037471 Bacteria 7620
308 Ga0395905_0014457 3300037471 Bacteria 7535
309 Ga0395905_0017711 3300037471 Bacteria 6763
310 Ga0395905_0023308 3300037471 Bacteria 5852
311 Ga0395905_0025126 3300037471 Bacteria 5618
312 Ga0395905_0040101 3300037471 Bacteria 4392
313 Ga0395905_0040104 3300037471 Bacteria 4392
314 Ga0395905_0048173 3300037471 Bacteria 3994
315 Ga0395905_0050879 3300037471 Bacteria 3881
316 Ga0395905_0062972 3300037471 Bacteria 3469
317 Ga0395905_0070638 3300037471 Bacteria 3272
318 Ga0395905_0092011 3300037471 Bacteria 2843
319 Ga0395905_0092815 3300037471 Bacteria 2831
320 Ga0395905_0097919 3300037471 Bacteria 2754
321 Ga0395905_0122399 3300037471 Bacteria 2446
322 Ga0395905_0171265 3300037471 Unclassified 2039
323 Ga0395905_0181380 3300037471 Unclassified 1977
324 Ga0395905_0212201 3300037471 Bacteria 1813
325 Ga0395905_0230029 3300037471 Bacteria 1734
326 Ga0395905_0241028 3300037471 Bacteria 1689
327 Ga0395905_0290946 3300037471 Bacteria 1520
328 Ga0395905_0446178 3300037471 Bacteria 1191
329 Ga0395905_0483722 3300037471 Bacteria 1137
330 Ga0395905_0491139 3300037471 Bacteria 1127
331 Ga0395905_0558126 3300037471 Bacteria 1046
332 Ga0436364_0914859 3300037853 Bacteria 9263
333 Ga0395901_0007176 3300038443 Bacteria 11238
334 Ga0395901_0009513 3300038443 Bacteria 9859
335 Ga0395901_0015126 3300038443 Bacteria 7845
336 Ga0395901_0029043 3300038443 Bacteria 5689
337 Ga0395901_0033027 3300038443 Bacteria 5340
338 Ga0395901_0044363 3300038443 Bacteria 4611
339 Ga0395901_0051565 3300038443 Bacteria 4278
340 Ga0395901_0052441 3300038443 Bacteria 4239
341 Ga0395901_0053762 3300038443 Bacteria 4184
342 Ga0395901_0074669 3300038443 Bacteria 3537
343 Ga0395901_0102494 3300038443 Bacteria 3004
344 Ga0395901_0113904 3300038443 Bacteria 2840
345 Ga0395901_0121381 3300038443 Bacteria 2746
346 Ga0395901_0168515 3300038443 Bacteria 2298
347 Ga0395901_0183351 3300038443 Bacteria 2195
348 Ga0395901_0195104 3300038443 Bacteria 2123
349 Ga0395901_0275714 3300038443 Bacteria 1748
350 Ga0395901_0299409 3300038443 Unclassified 1668
351 Ga0395901_0547381 3300038443 Bacteria 1173
352 Ga0439458_0000215 3300042157 Bacteria 13572
353 Ga0439458_0018739 3300042157 Bacteria 1588
354 Ga0466969_0049678 3300044656 Bacteria 2069
355 Ga0466972_0091782 3300044658 Bacteria 1440
356 Ga0466966_0017277 3300044684 Bacteria 4767
357 Ga0466966_0043292 3300044684 Bacteria 2887
358 Ga0466966_0154484 3300044684 Bacteria 1398
359 Ga0466961_0012068 3300044693 Bacteria 5521
360 Ga0466961_0055419 3300044693 Bacteria 2528
361 Ga0466963_0018128 3300044694 Bacteria 4396
362 Ga0466963_0028125 3300044694 Bacteria 3606
363 Ga0466963_0040286 3300044694 Bacteria 3062
364 Ga0466963_0184610 3300044694 Bacteria 1456
365 Ga0466964_0066308 3300044706 Bacteria 1515
366 Ga0466968_0028992 3300044735 Unclassified 2286
367 Ga0466970_0019815 3300044765 Unclassified 3491
368 Ga0466957_0002187 3300044842 Bacteria 10477
369 Ga0466957_0021396 3300044842 Bacteria 3810
370 Ga0466960_0264929 3300044901 Bacteria 959
371 Ga0466959_0050080 3300045049 Bacteria 3068
372 Ga0466959_0054301 3300045049 Bacteria 2928
373 Ga0466959_0201271 3300045049 Bacteria 1386
374 Ga0466958_0091550 3300045836 Unclassified 1883
375 Ga0466958_0173823 3300045836 Bacteria 1365
376 Ga0466958_0183864 3300045836 Bacteria 1327
377 Ga0466967_0038110 3300045976 Bacteria 4120
378 Ga0466967_0070913 3300045976 Bacteria 3118
379 Ga0466967_0097442 3300045976 Bacteria 2684
380 Ga0466967_0203478 3300045976 Bacteria 1876
381 Ga0466967_0664003 3300045976 Bacteria 1031
382 Ga0495663_0010737 3300046525 Bacteria 2549
383 Ga0495642_0114039 3300046528 Bacteria 1157
384 Ga0495621_0004714 3300046539 Bacteria 3863
385 Ga0495669_0000811 3300046684 Bacteria 13323
386 Ga0495669_0010773 3300046684 Bacteria 3870
387 Ga0495669_0048463 3300046684 Bacteria 1901
388 Ga0495670_0007626 3300046691 Bacteria 5320
389 Ga0495670_0009622 3300046691 Bacteria 4747
390 Ga0495677_0028029 3300047445 Bacteria 2044
391 Ga0496102_0478906 3300048905 Bacteria 1166
392 Ga0496108_0047568 3300048911 Bacteria 3586
393 Ga0496108_0506469 3300048911 Bacteria 1054
394 Ga0496110_0029392 3300048913 Unclassified 4729
395 Ga0496111_0015322 3300048914 Bacteria 5260
396 Ga0496112_0053068 3300048915 Bacteria 3980
397 Ga0496112_0108494 3300048915 Bacteria 2746
398 Ga0496112_0109515 3300048915 Bacteria 2732
399 Ga0496113_0035526 3300048916 Bacteria 3645
400 Ga0496114_0007699 3300048917 Bacteria 8520
401 Ga0501067_0080566 3300049583 Bacteria 1805
402 Ga0501273_009067 3300049770 Bacteria 1201
403 Ga0307408_100060269
404 JGI24740J21852_10051806
405 JGI24739J22299_10027449
406 JGI24737J22298_10000926
407 JGI24737J22298_10021284
408 JGI24735J21928_10007235
409 JGI24735J21928_10017848
410 rootH1_10036246
411 rootH1_10254987
412 Ga0065712_10081291
413 Ga0065715_10169149
414 Ga0070658_10004010
415 Ga0070658_10015133
416 Ga0070658_10033983
417 Ga0070658_10046335
418 Ga0070658_10053920
419 Ga0070658_10250229
420 Ga0070658_10491734
421 Ga0070676_10135436
422 Ga0070683_100055368
423 Ga0070670_100028445
424 Ga0070677_10046476
425 Ga0070666_10018154
426 Ga0070666_10037011
427 Ga0070680_100218453
428 Ga0070682_100021324
429 Ga0070660_100002698
430 Ga0070660_100013841
431 Ga0070660_100020332
432 Ga0070660_100073055
433 Ga0070660_100141793
434 Ga0070660_100372318
435 Ga0070691_10039133
436 Ga0070661_100004157
437 Ga0070661_100010367
438 Ga0070661_100012179
439 Ga0070669_100134098
440 Ga0070669_100231075
441 Ga0070675_100016604
442 Ga0070675_100077204
443 Ga0070671_100013427
444 Ga0070671_100039794
445 Ga0070671_100128398
446 Ga0070671_100186368
447 Ga0070674_100157963
448 Ga0070673_100028714
449 Ga0070659_100000972
450 Ga0070659_100004636
451 Ga0070659_100007991
452 Ga0070659_100016976
453 Ga0070659_100040619
454 Ga0070667_100035739
455 Ga0070663_100008280
456 Ga0070663_100045039
457 Ga0070663_100115063
458 Ga0070663_100263428
459 Ga0070662_100001755
460 Ga0070662_100004336
461 Ga0070662_100008316
462 Ga0070662_100069730
463 Ga0070662_100077397
464 Ga0070662_100133167
465 Ga0070681_10085086
466 Ga0068867_100261041
467 Ga0070679_100012572
468 Ga0070679_100166905
469 Ga0068853_100001668
470 Ga0068853_100013276
471 Ga0068853_100048596
472 Ga0068853_100101205
473 Ga0068853_100154741
474 Ga0068853_100333342
475 Ga0068853_100527112
476 Ga0070672_100015229
477 Ga0070672_100106789
478 Ga0070672_100154266
479 Ga0068855_100015231
480 Ga0068855_100022227
481 Ga0068855_100080854
482 Ga0070664_100001054
483 Ga0070664_100123173
484 Ga0068857_100013056
485 Ga0068857_100032006
486 Ga0068857_100528180
487 Ga0068854_100001447
488 Ga0068856_100024465
489 Ga0068856_100057031
490 Ga0068852_100015477
491 Ga0068852_100019599
492 Ga0068852_100069089
493 Ga0068852_100325228
494 Ga0068859_100351943
495 Ga0068864_100027585
496 Ga0068864_100032518
497 Ga0068863_100259819
498 Ga0068863_100386710
499 Ga0070717_10122779
500 Ga0068871_100040539
501 Ga0068871_100127389
502 Ga0097620_100351929
503 Ga0105240_10007907
504 Ga0105240_10119695
505 Ga0105245_10082560
506 Ga0105248_10005944
507 Ga0105248_10025054
508 Ga0105248_10054333
509 Ga0105248_10094127
510 Ga0105248_10112029
511 Ga0105248_10243138
512 Ga0105238_10040974
513 Ga0105238_10075088
514 Ga0105238_10324523
515 Ga0105239_10457783
516 Ga0157373_10022503
517 Ga0157373_10175375
518 Ga0157371_10003108
519 Ga0157371_10041370
520 Ga0157371_10046157
521 Ga0157370_10049450
522 Ga0157369_10002143
523 Ga0157369_10004627
524 Ga0157369_10009632
525 Ga0157369_10167041
526 Ga0157374_10077980
527 Ga0157372_10003926
528 Ga0157372_10628868
529 Ga0157375_10105782
530 Ga0157375_10226283
531 Ga0163163_10004776
532 Ga0213875_10026190
533 Ga0207682_10033641
534 Ga0207680_10063962
535 Ga0207680_10077020
536 Ga0207680_10231742
537 Ga0207647_10003500
538 Ga0207647_10004134
539 Ga0207705_10003916
540 Ga0207705_10005464
541 Ga0207705_10014372
542 Ga0207705_10041416
543 Ga0207705_10043260
544 Ga0207705_10076015
545 Ga0207705_10088758
546 Ga0207707_10015603
547 Ga0207707_10193042
548 Ga0207707_10204752
549 Ga0207695_10005397
550 Ga0207695_10039949
551 Ga0207660_10056351
552 Ga0207660_10058113
553 Ga0207660_10070242
554 Ga0207657_10000548
555 Ga0207657_10001957
556 Ga0207657_10026718
557 Ga0207649_10001492
558 Ga0207649_10003891
559 Ga0207649_10056803
560 Ga0207649_10074526
561 Ga0207649_10092841
562 Ga0207649_10097926
563 Ga0207649_10104990
564 Ga0207652_10030293
565 Ga0207681_10202667
566 Ga0207694_10000403
567 Ga0207650_10006489
568 Ga0207650_10074181
569 Ga0207659_10050270
570 Ga0207659_10134873
571 Ga0207644_10008794
572 Ga0207644_10027738
573 Ga0207644_10040928
574 Ga0207644_10058625
575 Ga0207644_10129288
576 Ga0207690_10013716
577 Ga0207690_10015425
578 Ga0207690_10087632
579 Ga0207690_10346598
580 Ga0207706_10004129
581 Ga0207706_10006385
582 Ga0207706_10029496
583 Ga0207706_10035234
584 Ga0207706_10051023
585 Ga0207706_10117729
586 Ga0207669_10090877
587 Ga0207691_10026745
588 Ga0207691_10159244
589 Ga0207691_10230955
590 Ga0207711_10042313
591 Ga0207711_10075070
592 Ga0207711_10176737
593 Ga0207679_10023393
594 Ga0207679_10032675
595 Ga0207679_10099406
596 Ga0207667_10012544
597 Ga0207667_10098597
598 Ga0207651_10056057
599 Ga0207651_10217010
600 Ga0207640_10000758
601 Ga0207640_10171762
602 Ga0207658_10086102
603 Ga0207677_10002311
604 Ga0207639_10000121
605 Ga0207639_10002825
606 Ga0207639_10009079
607 Ga0207639_10039041
608 Ga0207639_10101935
609 Ga0207678_10006249
610 Ga0207678_10011480
611 Ga0207678_10077405
612 Ga0207678_10198407
613 Ga0207702_10052918
614 Ga0207702_10093720
615 Ga0207641_10035239
616 Ga0207641_10166817
617 Ga0207648_10173905
618 Ga0207676_10012655
619 Ga0207676_10021060
620 Ga0207674_10000796
621 Ga0207674_10036196
622 Ga0207674_10211239
623 Ga0207683_10160315
624 Ga0207698_10001838
625 Ga0207698_10004900
626 Ga0207698_10155483
627 Ga0314311_1243533
628 Ga0307408_100105394
629 Ga0307408_100248536
630 Ga0307405_10008856
631 Ga0307405_10011699
632 Ga0307405_10019320
633 Ga0307405_10108569
634 Ga0307413_10002118
635 Ga0307413_10013428
636 Ga0307413_10037036
637 Ga0307410_10021839
638 Ga0307410_10065638
639 Ga0307410_10203363
640 Ga0307406_10034657
641 Ga0307406_10065097
642 Ga0307406_10096273
643 Ga0307406_10164879
644 Ga0307407_10011214
645 Ga0307407_10030727
646 Ga0307407_10064115
647 Ga0307412_10090084
648 Ga0307412_10180086
649 Ga0307409_100006542
650 Ga0307409_100007108
651 Ga0307409_100007599
652 Ga0307409_100036018
653 Ga0307409_100106008
654 Ga0307409_100108595
655 Ga0307409_100234223
656 Ga0307409_100244303
657 Ga0307409_100310817
658 Ga0307409_100599294
659 Ga0307416_100007711
660 Ga0307416_100066465
661 Ga0307416_100108738
662 Ga0307416_100706260
663 Ga0307414_10002041
664 Ga0307414_10035172
665 Ga0307414_10081535
666 Ga0307414_10096506
667 Ga0307411_10030357
668 Ga0307411_10184591
669 Ga0307411_10427405
670 Ga0307415_100002776
671 Ga0307415_100002850
672 Ga0307415_100062670
673 Ga0307415_100127266
674 Ga0395899_0002723
675 Ga0395899_0003843
676 Ga0395899_0005047
677 Ga0395899_0009949
678 Ga0395899_0026243
679 Ga0395899_0259633
680 Ga0395899_0283960
681 Ga0395899_0295985
682 Ga0395899_0319437
683 Ga0395900_0015434
684 Ga0395900_0016549
685 Ga0395900_0024859
686 Ga0395900_0035537
687 Ga0395900_0041561
688 Ga0395900_0048117
689 Ga0395900_0049732
690 Ga0395900_0055366
691 Ga0395900_0060081
692 Ga0395900_0069076
693 Ga0395900_0079392
694 Ga0395900_0141227
695 Ga0395900_0159740
696 Ga0395900_0161465
697 Ga0395900_0236135
698 Ga0395898_0013920
699 Ga0395898_0019136
700 Ga0395898_0020958
701 Ga0395898_0024365
702 Ga0395898_0033016
703 Ga0395898_0040687
704 Ga0395898_0116665
705 Ga0395898_0265391
706 Ga0395905_0004441
707 Ga0395905_0004688
708 Ga0395905_0011338
709 Ga0395905_0014168
710 Ga0395905_0014457
711 Ga0395905_0017711
712 Ga0395905_0023308
713 Ga0395905_0025126
714 Ga0395905_0040101
715 Ga0395905_0040104
716 Ga0395905_0048173
717 Ga0395905_0050879
718 Ga0395905_0062972
719 Ga0395905_0070638
720 Ga0395905_0092011
721 Ga0395905_0092815
722 Ga0395905_0097919
723 Ga0395905_0122399
724 Ga0395905_0171265
725 Ga0395905_0181380
726 Ga0395905_0212201
727 Ga0395905_0230029
728 Ga0395905_0241028
729 Ga0395905_0290946
730 Ga0395905_0446178
731 Ga0395905_0483722
732 Ga0395905_0491139
733 Ga0395905_0558126
734 Ga0436364_0914859
735 Ga0395901_0007176
736 Ga0395901_0009513
737 Ga0395901_0015126
738 Ga0395901_0029043
739 Ga0395901_0033027
740 Ga0395901_0044363
741 Ga0395901_0051565
742 Ga0395901_0052441
743 Ga0395901_0053762
744 Ga0395901_0074669
745 Ga0395901_0102494
746 Ga0395901_0113904
747 Ga0395901_0121381
748 Ga0395901_0168515
749 Ga0395901_0183351
750 Ga0395901_0195104
751 Ga0395901_0275714
752 Ga0395901_0299409
753 Ga0395901_0547381
754 Ga0439458_0000215
755 Ga0439458_0018739
756 Ga0466969_0049678
757 Ga0466972_0091782
758 Ga0466966_0017277
759 Ga0466966_0043292
760 Ga0466966_0154484
761 Ga0466961_0012068
762 Ga0466961_0055419
763 Ga0466963_0018128
764 Ga0466963_0028125
765 Ga0466963_0040286
766 Ga0466963_0184610
767 Ga0466964_0066308
768 Ga0466968_0028992
769 Ga0466970_0019815
770 Ga0466957_0002187
771 Ga0466957_0021396
772 Ga0466960_0264929
773 Ga0466959_0050080
774 Ga0466959_0054301
775 Ga0466959_0201271
776 Ga0466958_0091550
777 Ga0466958_0173823
778 Ga0466958_0183864
779 Ga0466967_0038110
780 Ga0466967_0070913
781 Ga0466967_0097442
782 Ga0466967_0203478
783 Ga0466967_0664003
784 Ga0495663_0010737
785 Ga0495642_0114039
786 Ga0495621_0004714
787 Ga0495669_0000811
788 Ga0495669_0010773
789 Ga0495669_0048463
790 Ga0495670_0007626
791 Ga0495670_0009622
792 Ga0495677_0028029
793 Ga0496102_0478906
794 Ga0496108_0047568
795 Ga0496108_0506469
796 Ga0496110_0029392
797 Ga0496111_0015322
798 Ga0496112_0053068
799 Ga0496112_0108494
800 Ga0496112_0109515
801 Ga0496113_0035526
802 Ga0496114_0007699
803 Ga0501067_0080566
804 Ga0501273_009067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

155

280

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8578 144 261
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8458 144 254
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8453 144 252
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8182 144 254
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8174 144 261
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8237 151 279 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8059 151 279 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7569 138 249 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.6874 138 249 1.20.81.30
2ezkA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.483 137 206 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2V8BKU7-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9249 127 293 GO:0005886
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.9217 130 268 GO:0005886
AF-A0A4S0V8E1-F1-model_v4 Type II secretion system F family protein 0.9048 126 264 GO:0005886
AF-A0A2V8BKU7-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9045 127 293 GO:0005886
AF-A0A529Q458-F1-model_v4 Type II secretion system F family protein 0.9028 118 243 GO:0005886

Map