F435101
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 402 | 248 | 402 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300025321|Ga0207656_10638439|Ga0207656_106384392 |
| Length | 107 |
| Sequence | MCGAPAQSPVLPPNVDVTKETVIYGVVSKNDAPVPAAYVRLLDNTGEFTAEVVTSATGDYRFFAAPGAWTLSVLHRDGAVRQPINASRRSRVSRPACSTMRSAALKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 170 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 172 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 174 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 227 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.28 |
| Metatranscriptomes | 5.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.72 |
| Rhizosphere | 92.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10123441 | 3300001979 | Bacteria | 648 |
| 2 | JGI24739J22299_10214000 | 3300001989 | Bacteria | 565 |
| 3 | JGI24735J21928_10018243 | 3300002067 | Bacteria | 2164 |
| 4 | JGI25404J52841_10108483 | 3300003659 | Bacteria | 583 |
| 5 | Ga0070676_10623199 | 3300005328 | Bacteria | 780 |
| 6 | Ga0070683_100886775 | 3300005329 | Bacteria | 855 |
| 7 | Ga0070690_100039220 | 3300005330 | Bacteria | 2992 |
| 8 | Ga0068869_100110406 | 3300005334 | Bacteria | 2091 |
| 9 | Ga0070666_10066807 | 3300005335 | Bacteria | 2441 |
| 10 | Ga0070666_10137693 | 3300005335 | Bacteria | 1699 |
| 11 | Ga0070680_100684024 | 3300005336 | Bacteria | 882 |
| 12 | Ga0070682_100155589 | 3300005337 | Bacteria | 1573 |
| 13 | Ga0068868_100056468 | 3300005338 | Bacteria | 3100 |
| 14 | Ga0068868_102400112 | 3300005338 | Bacteria | 504 |
| 15 | Ga0070660_100043396 | 3300005339 | Bacteria | 3437 |
| 16 | Ga0070689_100192076 | 3300005340 | Bacteria | 1663 |
| 17 | Ga0070691_10038038 | 3300005341 | Bacteria | 2271 |
| 18 | Ga0070687_100118299 | 3300005343 | Bacteria | 1511 |
| 19 | Ga0070668_100166870 | 3300005347 | Bacteria | 1790 |
| 20 | Ga0070669_100118996 | 3300005353 | Bacteria | 2012 |
| 21 | Ga0070669_100456610 | 3300005353 | Bacteria | 1054 |
| 22 | Ga0070671_100079784 | 3300005355 | Bacteria | 2736 |
| 23 | Ga0070674_100051460 | 3300005356 | Bacteria | 2839 |
| 24 | Ga0070673_100389799 | 3300005364 | Bacteria | 1243 |
| 25 | Ga0070659_100764744 | 3300005366 | Bacteria | 838 |
| 26 | Ga0070667_100025482 | 3300005367 | Bacteria | 4917 |
| 27 | Ga0070667_100083698 | 3300005367 | Bacteria | 2733 |
| 28 | Ga0070709_10240639 | 3300005434 | Bacteria | 1299 |
| 29 | Ga0070714_100000007 | 3300005435 | Bacteria | 285654 |
| 30 | Ga0070714_100043638 | 3300005435 | Bacteria | 3793 |
| 31 | Ga0070714_101059414 | 3300005435 | Bacteria | 790 |
| 32 | Ga0070714_101588573 | 3300005435 | Bacteria | 639 |
| 33 | Ga0070713_100207999 | 3300005436 | Bacteria | 1770 |
| 34 | Ga0070713_100451233 | 3300005436 | Bacteria | 1208 |
| 35 | Ga0070710_10033219 | 3300005437 | Bacteria | 2800 |
| 36 | Ga0070701_10155678 | 3300005438 | Bacteria | 1320 |
| 37 | Ga0070711_100061353 | 3300005439 | Bacteria | 2617 |
| 38 | Ga0070700_100779604 | 3300005441 | Bacteria | 768 |
| 39 | Ga0070694_100123216 | 3300005444 | Bacteria | 1862 |
| 40 | Ga0070663_100334396 | 3300005455 | Bacteria | 1222 |
| 41 | Ga0070663_100871406 | 3300005455 | Bacteria | 776 |
| 42 | Ga0070678_100096135 | 3300005456 | Bacteria | 2284 |
| 43 | Ga0070681_10611974 | 3300005458 | Bacteria | 1004 |
| 44 | Ga0070681_11686540 | 3300005458 | Bacteria | 560 |
| 45 | Ga0068867_100714153 | 3300005459 | Bacteria | 886 |
| 46 | Ga0070685_10993516 | 3300005466 | Bacteria | 629 |
| 47 | Ga0070706_101121590 | 3300005467 | Bacteria | 724 |
| 48 | Ga0070698_101431485 | 3300005471 | Bacteria | 642 |
| 49 | Ga0070679_100357079 | 3300005530 | Bacteria | 1409 |
| 50 | Ga0070684_101002946 | 3300005535 | Bacteria | 784 |
| 51 | Ga0070697_100433471 | 3300005536 | Bacteria | 1143 |
| 52 | Ga0068853_100063660 | 3300005539 | Bacteria | 3195 |
| 53 | Ga0068853_101656731 | 3300005539 | Bacteria | 620 |
| 54 | Ga0070672_100490278 | 3300005543 | Bacteria | 1062 |
| 55 | Ga0070686_100065624 | 3300005544 | Bacteria | 2359 |
| 56 | Ga0070696_100074305 | 3300005546 | Bacteria | 2397 |
| 57 | Ga0070693_100012097 | 3300005547 | Bacteria | 4359 |
| 58 | Ga0070665_100056155 | 3300005548 | Bacteria | 3948 |
| 59 | Ga0070665_100739222 | 3300005548 | Bacteria | 997 |
| 60 | Ga0070704_100134832 | 3300005549 | Bacteria | 1919 |
| 61 | Ga0068855_100021593 | 3300005563 | Bacteria | 7721 |
| 62 | Ga0068855_100098364 | 3300005563 | Bacteria | 3371 |
| 63 | Ga0068855_100695128 | 3300005563 | Bacteria | 1089 |
| 64 | Ga0070664_100042499 | 3300005564 | Bacteria | 3836 |
| 65 | Ga0068857_100052368 | 3300005577 | Bacteria | 3622 |
| 66 | Ga0068854_100375707 | 3300005578 | Bacteria | 1170 |
| 67 | Ga0068856_100047448 | 3300005614 | Bacteria | 4231 |
| 68 | Ga0068856_100097110 | 3300005614 | Bacteria | 2935 |
| 69 | Ga0070702_100018120 | 3300005615 | Bacteria | 3646 |
| 70 | Ga0068852_100026447 | 3300005616 | Bacteria | 4717 |
| 71 | Ga0068852_100313876 | 3300005616 | Bacteria | 1521 |
| 72 | Ga0068859_100001814 | 3300005617 | Bacteria | 21752 |
| 73 | Ga0068859_100215421 | 3300005617 | Bacteria | 2008 |
| 74 | Ga0068864_100263293 | 3300005618 | Bacteria | 1604 |
| 75 | Ga0068866_10103458 | 3300005718 | Bacteria | 1575 |
| 76 | Ga0068861_100073897 | 3300005719 | Bacteria | 2650 |
| 77 | Ga0068851_10126447 | 3300005834 | Bacteria | 1379 |
| 78 | Ga0068863_100015970 | 3300005841 | Bacteria | 7202 |
| 79 | Ga0068863_100310929 | 3300005841 | Bacteria | 1529 |
| 80 | Ga0068858_100031845 | 3300005842 | Bacteria | 4901 |
| 81 | Ga0068858_100261044 | 3300005842 | Bacteria | 1646 |
| 82 | Ga0068860_100000114 | 3300005843 | Bacteria | 128789 |
| 83 | Ga0068860_101687201 | 3300005843 | Bacteria | 655 |
| 84 | Ga0068862_100139496 | 3300005844 | Bacteria | 2151 |
| 85 | Ga0081540_1008747 | 3300005983 | Bacteria | 7039 |
| 86 | Ga0081539_10185474 | 3300005985 | Bacteria | 972 |
| 87 | Ga0070717_10153525 | 3300006028 | Bacteria | 1993 |
| 88 | Ga0070716_100007509 | 3300006173 | Bacteria | 5372 |
| 89 | Ga0070716_100935874 | 3300006173 | Bacteria | 681 |
| 90 | Ga0070712_100062926 | 3300006175 | Bacteria | 2625 |
| 91 | Ga0070712_100491057 | 3300006175 | Bacteria | 1028 |
| 92 | Ga0097621_100027356 | 3300006237 | Bacteria | 4483 |
| 93 | Ga0068871_100802458 | 3300006358 | Bacteria | 868 |
| 94 | Ga0075433_10019681 | 3300006852 | Bacteria | 5630 |
| 95 | Ga0068865_100167848 | 3300006881 | Bacteria | 1680 |
| 96 | Ga0075436_100196571 | 3300006914 | Bacteria | 1428 |
| 97 | Ga0075436_101082314 | 3300006914 | Bacteria | 603 |
| 98 | Ga0097620_100001814 | 3300006931 | Bacteria | 21752 |
| 99 | Ga0097620_100215431 | 3300006931 | Bacteria | 2008 |
| 100 | Ga0075435_100131381 | 3300007076 | Bacteria | 2095 |
| 101 | Ga0075435_100611882 | 3300007076 | Bacteria | 945 |
| 102 | Ga0105251_10208901 | 3300009011 | Bacteria | 879 |
| 103 | Ga0105250_10186504 | 3300009092 | Bacteria | 872 |
| 104 | Ga0105240_10012953 | 3300009093 | Bacteria | 11487 |
| 105 | Ga0105240_10018411 | 3300009093 | Bacteria | 9379 |
| 106 | Ga0105240_10139974 | 3300009093 | Bacteria | 2894 |
| 107 | Ga0105240_10157867 | 3300009093 | Bacteria | 2696 |
| 108 | Ga0105240_10578577 | 3300009093 | Bacteria | 1239 |
| 109 | Ga0111539_10088850 | 3300009094 | Bacteria | 3630 |
| 110 | Ga0105245_10012924 | 3300009098 | Bacteria | 7277 |
| 111 | Ga0105247_10005186 | 3300009101 | Bacteria | 8242 |
| 112 | Ga0105247_10282207 | 3300009101 | Bacteria | 1146 |
| 113 | Ga0105243_10027780 | 3300009148 | Bacteria | 4338 |
| 114 | Ga0105241_10120464 | 3300009174 | Bacteria | 2112 |
| 115 | Ga0105241_11210950 | 3300009174 | Bacteria | 716 |
| 116 | Ga0105242_10303911 | 3300009176 | Bacteria | 1457 |
| 117 | Ga0105248_10031838 | 3300009177 | Bacteria | 5893 |
| 118 | Ga0105248_11057242 | 3300009177 | Bacteria | 917 |
| 119 | Ga0105237_10043626 | 3300009545 | Bacteria | 4517 |
| 120 | Ga0105237_10102967 | 3300009545 | Bacteria | 2847 |
| 121 | Ga0105237_11048878 | 3300009545 | Bacteria | 822 |
| 122 | Ga0105237_12182923 | 3300009545 | Bacteria | 563 |
| 123 | Ga0105238_10220012 | 3300009551 | Bacteria | 1875 |
| 124 | Ga0105238_10438226 | 3300009551 | Bacteria | 1303 |
| 125 | Ga0105238_11235545 | 3300009551 | Bacteria | 772 |
| 126 | Ga0105238_11865196 | 3300009551 | Bacteria | 634 |
| 127 | Ga0105249_10065215 | 3300009553 | Bacteria | 3350 |
| 128 | Ga0105239_10011539 | 3300010375 | Bacteria | 9855 |
| 129 | Ga0157370_10063337 | 3300013104 | Bacteria | 3504 |
| 130 | Ga0157370_10867901 | 3300013104 | Bacteria | 820 |
| 131 | Ga0157369_10649843 | 3300013105 | Bacteria | 1087 |
| 132 | Ga0157369_11703293 | 3300013105 | Bacteria | 641 |
| 133 | Ga0157369_12031485 | 3300013105 | Bacteria | 583 |
| 134 | Ga0157374_10163581 | 3300013296 | Bacteria | 2168 |
| 135 | Ga0157374_10261535 | 3300013296 | Bacteria | 1704 |
| 136 | Ga0157374_11581473 | 3300013296 | Bacteria | 679 |
| 137 | Ga0157378_10046006 | 3300013297 | Bacteria | 3880 |
| 138 | Ga0157378_10307075 | 3300013297 | Bacteria | 1537 |
| 139 | Ga0163162_10031688 | 3300013306 | Bacteria | 5245 |
| 140 | Ga0163162_12118197 | 3300013306 | Bacteria | 645 |
| 141 | Ga0157372_10876019 | 3300013307 | Bacteria | 1042 |
| 142 | Ga0157372_11340087 | 3300013307 | Bacteria | 826 |
| 143 | Ga0157372_11996024 | 3300013307 | Bacteria | 667 |
| 144 | Ga0163163_10059004 | 3300014325 | Bacteria | 3794 |
| 145 | Ga0163163_10567072 | 3300014325 | Bacteria | 1198 |
| 146 | Ga0157380_10086680 | 3300014326 | Bacteria | 2573 |
| 147 | Ga0157377_10158722 | 3300014745 | Bacteria | 1404 |
| 148 | Ga0157379_10137611 | 3300014968 | Bacteria | 2201 |
| 149 | Ga0157379_10191388 | 3300014968 | Bacteria | 1849 |
| 150 | Ga0157379_10754976 | 3300014968 | Bacteria | 916 |
| 151 | Ga0157376_10013982 | 3300014969 | Bacteria | 6005 |
| 152 | Ga0163161_10008261 | 3300017792 | Bacteria | 7201 |
| 153 | Ga0197907_10459964 | 3300020069 | Bacteria | 1264 |
| 154 | Ga0197907_10533094 | 3300020069 | Bacteria | 1073 |
| 155 | Ga0197907_11009689 | 3300020069 | Bacteria | 959 |
| 156 | Ga0197907_11222175 | 3300020069 | Bacteria | 2078 |
| 157 | Ga0206356_10162526 | 3300020070 | Bacteria | 997 |
| 158 | Ga0206351_10238902 | 3300020077 | Bacteria | 1408 |
| 159 | Ga0206352_10839149 | 3300020078 | Bacteria | 594 |
| 160 | Ga0206350_10360878 | 3300020080 | Bacteria | 1488 |
| 161 | Ga0206350_10513969 | 3300020080 | Bacteria | 2384 |
| 162 | Ga0206350_10589506 | 3300020080 | Bacteria | 2327 |
| 163 | Ga0206354_10306350 | 3300020081 | Bacteria | 559 |
| 164 | Ga0206354_10795613 | 3300020081 | Bacteria | 1362 |
| 165 | Ga0206354_10995898 | 3300020081 | Bacteria | 632 |
| 166 | Ga0206354_11004522 | 3300020081 | Bacteria | 2063 |
| 167 | Ga0206353_10845988 | 3300020082 | Bacteria | 784 |
| 168 | Ga0206353_11256512 | 3300020082 | Bacteria | 2760 |
| 169 | Ga0206353_11788172 | 3300020082 | Bacteria | 2114 |
| 170 | Ga0154015_1147703 | 3300020610 | Bacteria | 503 |
| 171 | Ga0154015_1304045 | 3300020610 | Bacteria | 1469 |
| 172 | Ga0154015_1337719 | 3300020610 | Bacteria | 1122 |
| 173 | Ga0224712_10008632 | 3300022467 | Bacteria | 3031 |
| 174 | Ga0224712_10052787 | 3300022467 | Bacteria | 1589 |
| 175 | Ga0207656_10638439 | 3300025321 | Bacteria | 544 |
| 176 | Ga0207713_1118618 | 3300025735 | Bacteria | 890 |
| 177 | Ga0207653_10030595 | 3300025885 | Bacteria | 1737 |
| 178 | Ga0207692_10124600 | 3300025898 | Bacteria | 1447 |
| 179 | Ga0207642_10028631 | 3300025899 | Bacteria | 2296 |
| 180 | Ga0207710_10006182 | 3300025900 | Bacteria | 5123 |
| 181 | Ga0207710_10267724 | 3300025900 | Bacteria | 858 |
| 182 | Ga0207688_10005912 | 3300025901 | Bacteria | 6663 |
| 183 | Ga0207680_10017231 | 3300025903 | Bacteria | 3813 |
| 184 | Ga0207680_10396733 | 3300025903 | Bacteria | 974 |
| 185 | Ga0207647_10154039 | 3300025904 | Bacteria | 1342 |
| 186 | Ga0207647_10327549 | 3300025904 | Bacteria | 869 |
| 187 | Ga0207647_10338426 | 3300025904 | Bacteria | 853 |
| 188 | Ga0207647_10446523 | 3300025904 | Bacteria | 725 |
| 189 | Ga0207645_10780334 | 3300025907 | Bacteria | 650 |
| 190 | Ga0207643_10046453 | 3300025908 | Bacteria | 2455 |
| 191 | Ga0207705_10605472 | 3300025909 | Bacteria | 852 |
| 192 | Ga0207654_10127722 | 3300025911 | Bacteria | 1605 |
| 193 | Ga0207695_10069000 | 3300025913 | Bacteria | 3619 |
| 194 | Ga0207695_10075644 | 3300025913 | Bacteria | 3425 |
| 195 | Ga0207671_10065014 | 3300025914 | Bacteria | 2712 |
| 196 | Ga0207671_10531010 | 3300025914 | Bacteria | 938 |
| 197 | Ga0207693_10000970 | 3300025915 | Bacteria | 25775 |
| 198 | Ga0207693_10589538 | 3300025915 | Bacteria | 866 |
| 199 | Ga0207663_10452761 | 3300025916 | Bacteria | 990 |
| 200 | Ga0207657_10002184 | 3300025919 | Bacteria | 21193 |
| 201 | Ga0207681_10067966 | 3300025923 | Bacteria | 2473 |
| 202 | Ga0207681_10502428 | 3300025923 | Bacteria | 993 |
| 203 | Ga0207694_10084737 | 3300025924 | Bacteria | 2493 |
| 204 | Ga0207694_10429861 | 3300025924 | Bacteria | 1101 |
| 205 | Ga0207687_10027450 | 3300025927 | Bacteria | 3820 |
| 206 | Ga0207687_10079873 | 3300025927 | Bacteria | 2359 |
| 207 | Ga0207700_10190178 | 3300025928 | Bacteria | 1724 |
| 208 | Ga0207700_10412759 | 3300025928 | Bacteria | 1185 |
| 209 | Ga0207664_10000014 | 3300025929 | Bacteria | 249865 |
| 210 | Ga0207664_10087764 | 3300025929 | Bacteria | 2543 |
| 211 | Ga0207664_11025889 | 3300025929 | Bacteria | 739 |
| 212 | Ga0207664_11328273 | 3300025929 | Bacteria | 639 |
| 213 | Ga0207644_10047373 | 3300025931 | Bacteria | 3067 |
| 214 | Ga0207644_10205245 | 3300025931 | Bacteria | 1556 |
| 215 | Ga0207690_10051975 | 3300025932 | Bacteria | 2743 |
| 216 | Ga0207706_10208574 | 3300025933 | Bacteria | 1713 |
| 217 | Ga0207686_10143141 | 3300025934 | Bacteria | 1655 |
| 218 | Ga0207686_10183684 | 3300025934 | Bacteria | 1485 |
| 219 | Ga0207709_11402128 | 3300025935 | Bacteria | 579 |
| 220 | Ga0207670_10323476 | 3300025936 | Bacteria | 1214 |
| 221 | Ga0207669_10356904 | 3300025937 | Bacteria | 1131 |
| 222 | Ga0207665_10000421 | 3300025939 | Bacteria | 29232 |
| 223 | Ga0207691_10107194 | 3300025940 | Bacteria | 2488 |
| 224 | Ga0207711_10023360 | 3300025941 | Bacteria | 5177 |
| 225 | Ga0207711_10713282 | 3300025941 | Bacteria | 935 |
| 226 | Ga0207689_10016884 | 3300025942 | Bacteria | 6176 |
| 227 | Ga0207679_10138174 | 3300025945 | Bacteria | 1966 |
| 228 | Ga0207667_10028583 | 3300025949 | Bacteria | 6054 |
| 229 | Ga0207667_11724425 | 3300025949 | Bacteria | 592 |
| 230 | Ga0207712_10111116 | 3300025961 | Bacteria | 2056 |
| 231 | Ga0207668_10039123 | 3300025972 | Bacteria | 3189 |
| 232 | Ga0207640_10179752 | 3300025981 | Bacteria | 1585 |
| 233 | Ga0207640_10403138 | 3300025981 | Bacteria | 1114 |
| 234 | Ga0207658_10185133 | 3300025986 | Bacteria | 1727 |
| 235 | Ga0207677_10019752 | 3300026023 | Bacteria | 4076 |
| 236 | Ga0207703_10056803 | 3300026035 | Bacteria | 3189 |
| 237 | Ga0207703_10413179 | 3300026035 | Bacteria | 1254 |
| 238 | Ga0207639_10113950 | 3300026041 | Bacteria | 2209 |
| 239 | Ga0207678_10017846 | 3300026067 | Bacteria | 6232 |
| 240 | Ga0207678_10290677 | 3300026067 | Bacteria | 1404 |
| 241 | Ga0207708_10000002 | 3300026075 | Bacteria | 411071 |
| 242 | Ga0207708_10011092 | 3300026075 | Bacteria | 6702 |
| 243 | Ga0207702_10094255 | 3300026078 | Bacteria | 2627 |
| 244 | Ga0207702_10125942 | 3300026078 | Bacteria | 2300 |
| 245 | Ga0207702_12346957 | 3300026078 | Bacteria | 521 |
| 246 | Ga0207641_10051452 | 3300026088 | Bacteria | 3488 |
| 247 | Ga0207641_10372089 | 3300026088 | Bacteria | 1366 |
| 248 | Ga0207676_10060893 | 3300026095 | Bacteria | 2987 |
| 249 | Ga0207674_10485446 | 3300026116 | Bacteria | 1194 |
| 250 | Ga0207674_10897041 | 3300026116 | Bacteria | 854 |
| 251 | Ga0207675_100023881 | 3300026118 | Bacteria | 5686 |
| 252 | Ga0207683_10160117 | 3300026121 | Bacteria | 2034 |
| 253 | Ga0207698_10035745 | 3300026142 | Bacteria | 3638 |
| 254 | Ga0207698_10254895 | 3300026142 | Bacteria | 1608 |
| 255 | Ga0207698_10427009 | 3300026142 | Bacteria | 1273 |
| 256 | Ga0207698_11817396 | 3300026142 | Bacteria | 624 |
| 257 | Ga0207698_12010081 | 3300026142 | Bacteria | 592 |
| 258 | Ga0207428_10333719 | 3300027907 | Bacteria | 1118 |
| 259 | Ga0268266_10001159 | 3300028379 | Bacteria | 32594 |
| 260 | Ga0268265_10397355 | 3300028380 | Bacteria | 1273 |
| 261 | Ga0268264_10000147 | 3300028381 | Bacteria | 164790 |
| 262 | Ga0268264_10087196 | 3300028381 | Bacteria | 2683 |
| 263 | Ga0373930_0007047 | 3300034816 | Bacteria | 1922 |
| 264 | Ga0373948_0154237 | 3300034817 | Bacteria | 576 |
| 265 | Ga0373950_0042826 | 3300034818 | Bacteria | 871 |
| 266 | Ga0373958_0044779 | 3300034819 | Bacteria | 917 |
| 267 | Ga0373959_0054044 | 3300034820 | Bacteria | 874 |
| 268 | Ga0373938_0071901 | 3300034957 | Bacteria | 828 |
| 269 | Ga0373929_0010165 | 3300035085 | Bacteria | 1755 |
| 270 | Ga0373940_0074288 | 3300035088 | Bacteria | 995 |
| 271 | Ga0373949_0039198 | 3300035090 | Bacteria | 1159 |
| 272 | Ga0373951_0016170 | 3300035091 | Bacteria | 1682 |
| 273 | Ga0373952_0215280 | 3300035092 | Bacteria | 568 |
| 274 | Ga0373923_0447620 | 3300035111 | Bacteria | 626 |
| 275 | Ga0373932_0081396 | 3300035112 | Bacteria | 1023 |
| 276 | Ga0373941_0067306 | 3300035115 | Bacteria | 1181 |
| 277 | Ga0373957_0310649 | 3300035120 | Bacteria | 670 |
| 278 | Ga0373960_0026172 | 3300035121 | Bacteria | 1592 |
| 279 | Ga0373942_0037212 | 3300035207 | Bacteria | 1314 |
| 280 | Ga0373961_0065661 | 3300035241 | Bacteria | 1112 |
| 281 | Ga0373962_0059548 | 3300035242 | Bacteria | 1119 |
| 282 | Ga0373931_0004236 | 3300035691 | Bacteria | 6525 |
| 283 | Ga0373927_0187772 | 3300035695 | Bacteria | 1356 |
| 284 | Ga0373927_0706256 | 3300035695 | Bacteria | 666 |
| 285 | Ga0373925_0392746 | 3300037068 | Bacteria | 1131 |
| 286 | Ga0436364_0808363 | 3300037853 | Bacteria | 2534 |
| 287 | Ga0395901_0433023 | 3300038443 | Bacteria | 1347 |
| 288 | Ga0436363_1237544 | 3300039450 | Bacteria | 594 |
| 289 | Ga0466972_0119257 | 3300044658 | Bacteria | 1245 |
| 290 | Ga0466972_0199008 | 3300044658 | Bacteria | 938 |
| 291 | Ga0466972_0220276 | 3300044658 | Bacteria | 888 |
| 292 | Ga0466972_0299360 | 3300044658 | Bacteria | 752 |
| 293 | Ga0466965_0259848 | 3300044683 | Bacteria | 933 |
| 294 | Ga0466965_0552889 | 3300044683 | Bacteria | 650 |
| 295 | Ga0466966_0264582 | 3300044684 | Bacteria | 1035 |
| 296 | Ga0466966_0351655 | 3300044684 | Bacteria | 885 |
| 297 | Ga0466966_0575525 | 3300044684 | Bacteria | 678 |
| 298 | Ga0466966_0908513 | 3300044684 | Bacteria | 531 |
| 299 | Ga0466961_0008147 | 3300044693 | Bacteria | 6676 |
| 300 | Ga0466961_0015988 | 3300044693 | Bacteria | 4817 |
| 301 | Ga0466961_0032955 | 3300044693 | Bacteria | 3329 |
| 302 | Ga0466961_0101346 | 3300044693 | Bacteria | 1814 |
| 303 | Ga0466961_0396013 | 3300044693 | Bacteria | 838 |
| 304 | Ga0466961_0524030 | 3300044693 | Bacteria | 715 |
| 305 | Ga0466963_0027036 | 3300044694 | Bacteria | 3671 |
| 306 | Ga0466963_0042499 | 3300044694 | Bacteria | 2985 |
| 307 | Ga0466963_0229695 | 3300044694 | Bacteria | 1300 |
| 308 | Ga0466963_0280221 | 3300044694 | Bacteria | 1172 |
| 309 | Ga0466963_0418359 | 3300044694 | Bacteria | 945 |
| 310 | Ga0466963_0965987 | 3300044694 | Bacteria | 600 |
| 311 | Ga0466964_0108091 | 3300044706 | Bacteria | 1236 |
| 312 | Ga0466964_0197139 | 3300044706 | Bacteria | 964 |
| 313 | Ga0466964_0517513 | 3300044706 | Bacteria | 643 |
| 314 | Ga0466971_0115084 | 3300044719 | Bacteria | 1243 |
| 315 | Ga0466971_0177396 | 3300044719 | Bacteria | 1001 |
| 316 | Ga0466970_0262261 | 3300044765 | Bacteria | 969 |
| 317 | Ga0466970_0791491 | 3300044765 | Bacteria | 555 |
| 318 | Ga0466957_0005874 | 3300044842 | Bacteria | 6916 |
| 319 | Ga0466960_0131144 | 3300044901 | Bacteria | 1323 |
| 320 | Ga0466960_0343278 | 3300044901 | Bacteria | 850 |
| 321 | Ga0466960_0727814 | 3300044901 | Bacteria | 597 |
| 322 | Ga0466959_0028379 | 3300045049 | Bacteria | 4150 |
| 323 | Ga0466959_0131730 | 3300045049 | Bacteria | 1772 |
| 324 | Ga0466959_0257397 | 3300045049 | Bacteria | 1202 |
| 325 | Ga0466959_0436965 | 3300045049 | Bacteria | 888 |
| 326 | Ga0466958_0003112 | 3300045836 | Bacteria | 8524 |
| 327 | Ga0466958_0008699 | 3300045836 | Bacteria | 5636 |
| 328 | Ga0466958_0016170 | 3300045836 | Bacteria | 4293 |
| 329 | Ga0466958_0040292 | 3300045836 | Bacteria | 2808 |
| 330 | Ga0466958_0217576 | 3300045836 | Bacteria | 1218 |
| 331 | Ga0466958_0247899 | 3300045836 | Bacteria | 1139 |
| 332 | Ga0466958_0834455 | 3300045836 | Bacteria | 601 |
| 333 | Ga0466967_0012072 | 3300045976 | Bacteria | 6586 |
| 334 | Ga0466967_0116428 | 3300045976 | Bacteria | 2462 |
| 335 | Ga0466967_0625481 | 3300045976 | Bacteria | 1063 |
| 336 | Ga0466967_0629737 | 3300045976 | Bacteria | 1060 |
| 337 | Ga0466967_0749122 | 3300045976 | Bacteria | 969 |
| 338 | Ga0466967_0801291 | 3300045976 | Bacteria | 935 |
| 339 | Ga0466967_0893913 | 3300045976 | Bacteria | 883 |
| 340 | Ga0466967_1320217 | 3300045976 | Bacteria | 718 |
| 341 | Ga0466967_1551508 | 3300045976 | Bacteria | 659 |
| 342 | Ga0466967_1880498 | 3300045976 | Bacteria | 595 |
| 343 | Ga0466967_2135316 | 3300045976 | Bacteria | 556 |
| 344 | Ga0495580_0237319 | 3300046472 | Bacteria | 1251 |
| 345 | Ga0495607_0521205 | 3300046501 | Bacteria | 525 |
| 346 | Ga0495624_0250051 | 3300046690 | Bacteria | 1072 |
| 347 | Ga0496100_0103454 | 3300048903 | Bacteria | 1966 |
| 348 | Ga0496100_0612767 | 3300048903 | Bacteria | 846 |
| 349 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 350 | Ga0496102_0000727 | 3300048905 | Bacteria | 32407 |
| 351 | Ga0496102_0245894 | 3300048905 | Bacteria | 1687 |
| 352 | Ga0496102_1290980 | 3300048905 | Bacteria | 649 |
| 353 | Ga0496103_0000239 | 3300048906 | Bacteria | 53554 |
| 354 | Ga0496103_0063452 | 3300048906 | Bacteria | 2301 |
| 355 | Ga0496103_0192464 | 3300048906 | Bacteria | 1311 |
| 356 | Ga0496104_0025620 | 3300048907 | Bacteria | 5438 |
| 357 | Ga0496105_0009011 | 3300048908 | Bacteria | 7784 |
| 358 | Ga0496106_0017984 | 3300048909 | Bacteria | 5227 |
| 359 | Ga0496107_0022726 | 3300048910 | Bacteria | 4433 |
| 360 | Ga0496108_0192131 | 3300048911 | Bacteria | 1769 |
| 361 | Ga0496109_0017670 | 3300048912 | Bacteria | 6255 |
| 362 | Ga0496109_1642576 | 3300048912 | Bacteria | 577 |
| 363 | Ga0496110_0065709 | 3300048913 | Bacteria | 3207 |
| 364 | Ga0496112_0177208 | 3300048915 | Bacteria | 2096 |
| 365 | Ga0496112_0242853 | 3300048915 | Bacteria | 1753 |
| 366 | Ga0496113_0086193 | 3300048916 | Bacteria | 2413 |
| 367 | Ga0496113_1250334 | 3300048916 | Bacteria | 578 |
| 368 | Ga0496114_0013901 | 3300048917 | Bacteria | 6453 |
| 369 | Ga0496115_0476484 | 3300048918 | Bacteria | 1005 |
| 370 | Ga0496116_0265734 | 3300048919 | Bacteria | 842 |
| 371 | Ga0496118_0017555 | 3300048921 | Bacteria | 6506 |
| 372 | Ga0496121_0262308 | 3300048924 | Bacteria | 1192 |
| 373 | Ga0496126_0194298 | 3300048929 | Bacteria | 1717 |
| 374 | Ga0501031_0230038 | 3300049568 | Bacteria | 1206 |
| 375 | Ga0501032_0004003 | 3300049569 | Bacteria | 11175 |
| 376 | Ga0501033_0616791 | 3300049570 | Bacteria | 743 |
| 377 | Ga0501033_0640767 | 3300049570 | Bacteria | 726 |
| 378 | Ga0501034_0053584 | 3300049571 | Bacteria | 4061 |
| 379 | Ga0501036_0178764 | 3300049572 | Bacteria | 1787 |
| 380 | Ga0501037_0079441 | 3300049573 | Bacteria | 2381 |
| 381 | Ga0501038_0000399 | 3300049574 | Bacteria | 37785 |
| 382 | Ga0501043_0011695 | 3300049579 | Bacteria | 6871 |
| 383 | Ga0501047_0012995 | 3300049581 | Bacteria | 7883 |
| 384 | Ga0501048_0002723 | 3300049582 | Bacteria | 13482 |
| 385 | Ga0501070_0034307 | 3300049586 | Bacteria | 4243 |
| 386 | Ga0501070_0422129 | 3300049586 | Bacteria | 1077 |
| 387 | Ga0501074_1113212 | 3300049590 | Bacteria | 554 |
| 388 | Ga0501080_1122539 | 3300049742 | Bacteria | 678 |
| 389 | Ga0501080_1611392 | 3300049742 | Bacteria | 549 |
| 390 | Ga0501035_0024453 | 3300049822 | Bacteria | 5539 |
| 391 | Ga0501035_0267034 | 3300049822 | Bacteria | 1449 |
| 392 | Ga0501044_0099703 | 3300049823 | Bacteria | 2923 |
| 393 | Ga0501044_0333039 | 3300049823 | Bacteria | 1440 |
| 394 | nmdc:mga0rr50_11595_c1 | 3300050513 | Bacteria | 5652 |
| 395 | nmdc:mga0rr50_564633_c1 | 3300050513 | Bacteria | 969 |
| 396 | nmdc:mga08x19_29812_c1 | 3300050514 | Bacteria | 3424 |
| 397 | nmdc:mga0a205_12912_c1 | 3300050515 | Bacteria | 7748 |
| 398 | Ga0495595_0329900 | 3300053084 | Bacteria | 769 |
| 399 | Ga0587067_134531 | 3300059640 | Bacteria | 607 |
| 400 | Ga0501082_0542809 | 3300060353 | Bacteria | 1017 |
| 401 | Ga0466962_0001713 | 3300061719 | Bacteria | 10296 |
| 402 | Ga0466962_0352541 | 3300061719 | Bacteria | 733 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0247899 | Ga0466958_0247899_513_758 | 81 |
| 2 | 3300037853 | Ga0436364_0808363 | Ga0436364_0808363_841_1098 | 85 |
| 3 | 3300009551 | Ga0105238_10220012 | Ga0105238_102200122 | 86 |
| 4 | 3300009551 | Ga0105238_11235545 | Ga0105238_112355451 | 86 |
| 5 | 3300048915 | Ga0496112_0242853 | Ga0496112_0242853_1023_1283 | 86 |
| 6 | 3300048929 | Ga0496126_0194298 | Ga0496126_0194298_199_459 | 86 |
| 7 | 3300009093 | Ga0105240_10139974 | Ga0105240_101399744 | 89 |
| 8 | 3300013296 | Ga0157374_10163581 | Ga0157374_101635815 | 89 |
| 9 | 3300013306 | Ga0163162_12118197 | Ga0163162_121181971 | 89 |
| 10 | 3300044658 | Ga0466972_0220276 | Ga0466972_0220276_517_786 | 89 |
| 11 | 3300044706 | Ga0466964_0517513 | Ga0466964_0517513_167_436 | 89 |
| 12 | 3300045976 | Ga0466967_0012072 | Ga0466967_0012072_10_279 | 89 |
| 13 | 3300045976 | Ga0466967_0625481 | Ga0466967_0625481_92_361 | 89 |
| 14 | 3300045976 | Ga0466967_0749122 | Ga0466967_0749122_624_893 | 89 |
| 15 | 3300045976 | Ga0466967_1551508 | Ga0466967_1551508_155_424 | 89 |
| 16 | 3300048916 | Ga0496113_0086193 | Ga0496113_0086193_2110_2379 | 89 |
| 17 | 3300045976 | Ga0466967_0893913 | Ga0466967_0893913_176_448 | 90 |
| 18 | 3300045976 | Ga0466967_2135316 | Ga0466967_2135316_248_520 | 90 |
| 19 | 3300005985 | Ga0081539_10185474 | Ga0081539_101854741 | 97 |
| 20 | 3300020078 | Ga0206352_10839149 | Ga0206352_108391492 | 98 |
| 21 | 3300025934 | Ga0207686_10183684 | Ga0207686_101836843 | 98 |
| 22 | 3300001989 | JGI24739J22299_10214000 | JGI24739J22299_102140002 | 99 |
| 23 | 3300003659 | JGI25404J52841_10108483 | JGI25404J52841_101084832 | 99 |
| 24 | 3300005328 | Ga0070676_10623199 | Ga0070676_106231992 | 99 |
| 25 | 3300005329 | Ga0070683_100886775 | Ga0070683_1008867752 | 99 |
| 26 | 3300005330 | Ga0070690_100039220 | Ga0070690_1000392203 | 99 |
| 27 | 3300005334 | Ga0068869_100110406 | Ga0068869_1001104062 | 99 |
| 28 | 3300005335 | Ga0070666_10066807 | Ga0070666_100668071 | 99 |
| 29 | 3300005335 | Ga0070666_10137693 | Ga0070666_101376932 | 99 |
| 30 | 3300005336 | Ga0070680_100684024 | Ga0070680_1006840242 | 99 |
| 31 | 3300005337 | Ga0070682_100155589 | Ga0070682_1001555891 | 99 |
| 32 | 3300005338 | Ga0068868_100056468 | Ga0068868_1000564682 | 99 |
| 33 | 3300005338 | Ga0068868_102400112 | Ga0068868_1024001122 | 99 |
| 34 | 3300005339 | Ga0070660_100043396 | Ga0070660_1000433962 | 99 |
| 35 | 3300005340 | Ga0070689_100192076 | Ga0070689_1001920762 | 99 |
| 36 | 3300005341 | Ga0070691_10038038 | Ga0070691_100380382 | 99 |
| 37 | 3300005343 | Ga0070687_100118299 | Ga0070687_1001182992 | 99 |
| 38 | 3300005347 | Ga0070668_100166870 | Ga0070668_1001668703 | 99 |
| 39 | 3300005353 | Ga0070669_100118996 | Ga0070669_1001189963 | 99 |
| 40 | 3300005353 | Ga0070669_100456610 | Ga0070669_1004566101 | 99 |
| 41 | 3300005355 | Ga0070671_100079784 | Ga0070671_1000797841 | 99 |
| 42 | 3300005356 | Ga0070674_100051460 | Ga0070674_1000514604 | 99 |
| 43 | 3300005364 | Ga0070673_100389799 | Ga0070673_1003897992 | 99 |
| 44 | 3300005366 | Ga0070659_100764744 | Ga0070659_1007647442 | 99 |
| 45 | 3300005367 | Ga0070667_100025482 | Ga0070667_1000254824 | 99 |
| 46 | 3300005367 | Ga0070667_100083698 | Ga0070667_1000836984 | 99 |
| 47 | 3300005434 | Ga0070709_10240639 | Ga0070709_102406393 | 99 |
| 48 | 3300005435 | Ga0070714_100043638 | Ga0070714_1000436384 | 99 |
| 49 | 3300005435 | Ga0070714_101059414 | Ga0070714_1010594142 | 99 |
| 50 | 3300005435 | Ga0070714_101588573 | Ga0070714_1015885731 | 99 |
| 51 | 3300005436 | Ga0070713_100207999 | Ga0070713_1002079993 | 99 |
| 52 | 3300005436 | Ga0070713_100451233 | Ga0070713_1004512332 | 99 |
| 53 | 3300005437 | Ga0070710_10033219 | Ga0070710_100332193 | 99 |
| 54 | 3300005438 | Ga0070701_10155678 | Ga0070701_101556782 | 99 |
| 55 | 3300005439 | Ga0070711_100061353 | Ga0070711_1000613533 | 99 |
| 56 | 3300005441 | Ga0070700_100779604 | Ga0070700_1007796042 | 99 |
| 57 | 3300005444 | Ga0070694_100123216 | Ga0070694_1001232162 | 99 |
| 58 | 3300005455 | Ga0070663_100334396 | Ga0070663_1003343962 | 99 |
| 59 | 3300005455 | Ga0070663_100871406 | Ga0070663_1008714062 | 99 |
| 60 | 3300005456 | Ga0070678_100096135 | Ga0070678_1000961352 | 99 |
| 61 | 3300005458 | Ga0070681_10611974 | Ga0070681_106119742 | 99 |
| 62 | 3300005458 | Ga0070681_11686540 | Ga0070681_116865401 | 99 |
| 63 | 3300005459 | Ga0068867_100714153 | Ga0068867_1007141531 | 99 |
| 64 | 3300005466 | Ga0070685_10993516 | Ga0070685_109935161 | 99 |
| 65 | 3300005467 | Ga0070706_101121590 | Ga0070706_1011215901 | 99 |
| 66 | 3300005471 | Ga0070698_101431485 | Ga0070698_1014314851 | 99 |
| 67 | 3300005530 | Ga0070679_100357079 | Ga0070679_1003570792 | 99 |
| 68 | 3300005535 | Ga0070684_101002946 | Ga0070684_1010029462 | 99 |
| 69 | 3300005536 | Ga0070697_100433471 | Ga0070697_1004334711 | 99 |
| 70 | 3300005539 | Ga0068853_100063660 | Ga0068853_1000636605 | 99 |
| 71 | 3300005539 | Ga0068853_101656731 | Ga0068853_1016567312 | 99 |
| 72 | 3300005543 | Ga0070672_100490278 | Ga0070672_1004902782 | 99 |
| 73 | 3300005544 | Ga0070686_100065624 | Ga0070686_1000656244 | 99 |
| 74 | 3300005546 | Ga0070696_100074305 | Ga0070696_1000743053 | 99 |
| 75 | 3300005547 | Ga0070693_100012097 | Ga0070693_1000120974 | 99 |
| 76 | 3300005548 | Ga0070665_100056155 | Ga0070665_1000561556 | 99 |
| 77 | 3300005548 | Ga0070665_100739222 | Ga0070665_1007392221 | 99 |
| 78 | 3300005549 | Ga0070704_100134832 | Ga0070704_1001348322 | 99 |
| 79 | 3300005563 | Ga0068855_100021593 | Ga0068855_10002159311 | 99 |
| 80 | 3300005563 | Ga0068855_100098364 | Ga0068855_1000983645 | 99 |
| 81 | 3300005563 | Ga0068855_100695128 | Ga0068855_1006951282 | 99 |
| 82 | 3300005564 | Ga0070664_100042499 | Ga0070664_1000424997 | 99 |
| 83 | 3300005577 | Ga0068857_100052368 | Ga0068857_1000523686 | 99 |
| 84 | 3300005614 | Ga0068856_100047448 | Ga0068856_1000474481 | 99 |
| 85 | 3300005614 | Ga0068856_100097110 | Ga0068856_1000971102 | 99 |
| 86 | 3300005615 | Ga0070702_100018120 | Ga0070702_1000181204 | 99 |
| 87 | 3300005616 | Ga0068852_100313876 | Ga0068852_1003138764 | 99 |
| 88 | 3300005617 | Ga0068859_100001814 | Ga0068859_10000181422 | 99 |
| 89 | 3300005617 | Ga0068859_100215421 | Ga0068859_1002154215 | 99 |
| 90 | 3300005618 | Ga0068864_100263293 | Ga0068864_1002632934 | 99 |
| 91 | 3300005718 | Ga0068866_10103458 | Ga0068866_101034582 | 99 |
| 92 | 3300005719 | Ga0068861_100073897 | Ga0068861_1000738974 | 99 |
| 93 | 3300005834 | Ga0068851_10126447 | Ga0068851_101264474 | 99 |
| 94 | 3300005841 | Ga0068863_100015970 | Ga0068863_1000159703 | 99 |
| 95 | 3300005841 | Ga0068863_100310929 | Ga0068863_1003109292 | 99 |
| 96 | 3300005842 | Ga0068858_100031845 | Ga0068858_1000318455 | 99 |
| 97 | 3300005842 | Ga0068858_100261044 | Ga0068858_1002610442 | 99 |
| 98 | 3300005843 | Ga0068860_100000114 | Ga0068860_100000114120 | 99 |
| 99 | 3300005843 | Ga0068860_101687201 | Ga0068860_1016872012 | 99 |
| 100 | 3300005844 | Ga0068862_100139496 | Ga0068862_1001394962 | 99 |
| 101 | 3300005983 | Ga0081540_1008747 | Ga0081540_10087477 | 99 |
| 102 | 3300006028 | Ga0070717_10153525 | Ga0070717_101535252 | 99 |
| 103 | 3300006173 | Ga0070716_100007509 | Ga0070716_1000075093 | 99 |
| 104 | 3300006173 | Ga0070716_100935874 | Ga0070716_1009358742 | 99 |
| 105 | 3300006175 | Ga0070712_100062926 | Ga0070712_1000629263 | 99 |
| 106 | 3300006175 | Ga0070712_100491057 | Ga0070712_1004910572 | 99 |
| 107 | 3300006237 | Ga0097621_100027356 | Ga0097621_1000273563 | 99 |
| 108 | 3300006358 | Ga0068871_100802458 | Ga0068871_1008024581 | 99 |
| 109 | 3300006852 | Ga0075433_10019681 | Ga0075433_100196814 | 99 |
| 110 | 3300006881 | Ga0068865_100167848 | Ga0068865_1001678482 | 99 |
| 111 | 3300006914 | Ga0075436_100196571 | Ga0075436_1001965712 | 99 |
| 112 | 3300006914 | Ga0075436_101082314 | Ga0075436_1010823141 | 99 |
| 113 | 3300006931 | Ga0097620_100001814 | Ga0097620_10000181422 | 99 |
| 114 | 3300006931 | Ga0097620_100215431 | Ga0097620_1002154315 | 99 |
| 115 | 3300007076 | Ga0075435_100131381 | Ga0075435_1001313815 | 99 |
| 116 | 3300007076 | Ga0075435_100611882 | Ga0075435_1006118822 | 99 |
| 117 | 3300009011 | Ga0105251_10208901 | Ga0105251_102089012 | 99 |
| 118 | 3300009092 | Ga0105250_10186504 | Ga0105250_101865041 | 99 |
| 119 | 3300009093 | Ga0105240_10018411 | Ga0105240_100184115 | 99 |
| 120 | 3300009093 | Ga0105240_10157867 | Ga0105240_101578675 | 99 |
| 121 | 3300009093 | Ga0105240_10578577 | Ga0105240_105785771 | 99 |
| 122 | 3300009094 | Ga0111539_10088850 | Ga0111539_100888504 | 99 |
| 123 | 3300009101 | Ga0105247_10005186 | Ga0105247_1000518610 | 99 |
| 124 | 3300009101 | Ga0105247_10282207 | Ga0105247_102822072 | 99 |
| 125 | 3300009148 | Ga0105243_10027780 | Ga0105243_100277806 | 99 |
| 126 | 3300009174 | Ga0105241_10120464 | Ga0105241_101204644 | 99 |
| 127 | 3300009176 | Ga0105242_10303911 | Ga0105242_103039114 | 99 |
| 128 | 3300009177 | Ga0105248_10031838 | Ga0105248_100318387 | 99 |
| 129 | 3300009177 | Ga0105248_11057242 | Ga0105248_110572422 | 99 |
| 130 | 3300009545 | Ga0105237_10043626 | Ga0105237_100436264 | 99 |
| 131 | 3300009545 | Ga0105237_10102967 | Ga0105237_101029672 | 99 |
| 132 | 3300009545 | Ga0105237_11048878 | Ga0105237_110488782 | 99 |
| 133 | 3300009551 | Ga0105238_10438226 | Ga0105238_104382262 | 99 |
| 134 | 3300009551 | Ga0105238_11865196 | Ga0105238_118651962 | 99 |
| 135 | 3300009553 | Ga0105249_10065215 | Ga0105249_100652153 | 99 |
| 136 | 3300010375 | Ga0105239_10011539 | Ga0105239_100115399 | 99 |
| 137 | 3300013104 | Ga0157370_10867901 | Ga0157370_108679012 | 99 |
| 138 | 3300013105 | Ga0157369_10649843 | Ga0157369_106498432 | 99 |
| 139 | 3300013105 | Ga0157369_11703293 | Ga0157369_117032932 | 99 |
| 140 | 3300013105 | Ga0157369_12031485 | Ga0157369_120314852 | 99 |
| 141 | 3300013296 | Ga0157374_10261535 | Ga0157374_102615355 | 99 |
| 142 | 3300013296 | Ga0157374_11581473 | Ga0157374_115814732 | 99 |
| 143 | 3300013297 | Ga0157378_10046006 | Ga0157378_100460062 | 99 |
| 144 | 3300013306 | Ga0163162_10031688 | Ga0163162_100316885 | 99 |
| 145 | 3300013307 | Ga0157372_10876019 | Ga0157372_108760192 | 99 |
| 146 | 3300013307 | Ga0157372_11996024 | Ga0157372_119960243 | 99 |
| 147 | 3300014325 | Ga0163163_10059004 | Ga0163163_100590044 | 99 |
| 148 | 3300014325 | Ga0163163_10567072 | Ga0163163_105670722 | 99 |
| 149 | 3300014326 | Ga0157380_10086680 | Ga0157380_100866802 | 99 |
| 150 | 3300014745 | Ga0157377_10158722 | Ga0157377_101587223 | 99 |
| 151 | 3300014968 | Ga0157379_10137611 | Ga0157379_101376112 | 99 |
| 152 | 3300014968 | Ga0157379_10191388 | Ga0157379_101913884 | 99 |
| 153 | 3300014968 | Ga0157379_10754976 | Ga0157379_107549762 | 99 |
| 154 | 3300014969 | Ga0157376_10013982 | Ga0157376_100139826 | 99 |
| 155 | 3300017792 | Ga0163161_10008261 | Ga0163161_1000826110 | 99 |
| 156 | 3300020069 | Ga0197907_10459964 | Ga0197907_104599642 | 99 |
| 157 | 3300020069 | Ga0197907_10533094 | Ga0197907_105330942 | 99 |
| 158 | 3300020069 | Ga0197907_11009689 | Ga0197907_110096891 | 99 |
| 159 | 3300020069 | Ga0197907_11222175 | Ga0197907_112221753 | 99 |
| 160 | 3300020070 | Ga0206356_10162526 | Ga0206356_101625263 | 99 |
| 161 | 3300020077 | Ga0206351_10238902 | Ga0206351_102389021 | 99 |
| 162 | 3300020080 | Ga0206350_10360878 | Ga0206350_103608782 | 99 |
| 163 | 3300020080 | Ga0206350_10513969 | Ga0206350_105139694 | 99 |
| 164 | 3300020080 | Ga0206350_10589506 | Ga0206350_105895064 | 99 |
| 165 | 3300020081 | Ga0206354_10306350 | Ga0206354_103063502 | 99 |
| 166 | 3300020081 | Ga0206354_10795613 | Ga0206354_107956132 | 99 |
| 167 | 3300020081 | Ga0206354_10995898 | Ga0206354_109958982 | 99 |
| 168 | 3300020081 | Ga0206354_11004522 | Ga0206354_110045222 | 99 |
| 169 | 3300020082 | Ga0206353_10845988 | Ga0206353_108459883 | 99 |
| 170 | 3300020082 | Ga0206353_11256512 | Ga0206353_112565123 | 99 |
| 171 | 3300020082 | Ga0206353_11788172 | Ga0206353_117881724 | 99 |
| 172 | 3300020610 | Ga0154015_1147703 | Ga0154015_11477031 | 99 |
| 173 | 3300020610 | Ga0154015_1304045 | Ga0154015_13040451 | 99 |
| 174 | 3300020610 | Ga0154015_1337719 | Ga0154015_13377191 | 99 |
| 175 | 3300022467 | Ga0224712_10008632 | Ga0224712_100086325 | 99 |
| 176 | 3300022467 | Ga0224712_10052787 | Ga0224712_100527874 | 99 |
| 177 | 3300025321 | Ga0207656_10638439 | Ga0207656_106384392 | 99 |
| 178 | 3300025735 | Ga0207713_1118618 | Ga0207713_11186182 | 99 |
| 179 | 3300025885 | Ga0207653_10030595 | Ga0207653_100305952 | 99 |
| 180 | 3300025898 | Ga0207692_10124600 | Ga0207692_101246004 | 99 |
| 181 | 3300025899 | Ga0207642_10028631 | Ga0207642_100286312 | 99 |
| 182 | 3300025900 | Ga0207710_10006182 | Ga0207710_100061826 | 99 |
| 183 | 3300025900 | Ga0207710_10267724 | Ga0207710_102677242 | 99 |
| 184 | 3300025901 | Ga0207688_10005912 | Ga0207688_1000591210 | 99 |
| 185 | 3300025903 | Ga0207680_10017231 | Ga0207680_100172313 | 99 |
| 186 | 3300025903 | Ga0207680_10396733 | Ga0207680_103967332 | 99 |
| 187 | 3300025904 | Ga0207647_10154039 | Ga0207647_101540392 | 99 |
| 188 | 3300025904 | Ga0207647_10327549 | Ga0207647_103275492 | 99 |
| 189 | 3300025904 | Ga0207647_10338426 | Ga0207647_103384262 | 99 |
| 190 | 3300025904 | Ga0207647_10446523 | Ga0207647_104465232 | 99 |
| 191 | 3300025907 | Ga0207645_10780334 | Ga0207645_107803341 | 99 |
| 192 | 3300025908 | Ga0207643_10046453 | Ga0207643_100464532 | 99 |
| 193 | 3300025911 | Ga0207654_10127722 | Ga0207654_101277222 | 99 |
| 194 | 3300025913 | Ga0207695_10075644 | Ga0207695_100756445 | 99 |
| 195 | 3300025914 | Ga0207671_10065014 | Ga0207671_100650143 | 99 |
| 196 | 3300025914 | Ga0207671_10531010 | Ga0207671_105310101 | 99 |
| 197 | 3300025915 | Ga0207693_10000970 | Ga0207693_100009703 | 99 |
| 198 | 3300025915 | Ga0207693_10589538 | Ga0207693_105895382 | 99 |
| 199 | 3300025916 | Ga0207663_10452761 | Ga0207663_104527613 | 99 |
| 200 | 3300025919 | Ga0207657_10002184 | Ga0207657_1000218413 | 99 |
| 201 | 3300025923 | Ga0207681_10067966 | Ga0207681_100679663 | 99 |
| 202 | 3300025923 | Ga0207681_10502428 | Ga0207681_105024283 | 99 |
| 203 | 3300025924 | Ga0207694_10429861 | Ga0207694_104298611 | 99 |
| 204 | 3300025927 | Ga0207687_10027450 | Ga0207687_100274503 | 99 |
| 205 | 3300025927 | Ga0207687_10079873 | Ga0207687_100798733 | 99 |
| 206 | 3300025928 | Ga0207700_10190178 | Ga0207700_101901781 | 99 |
| 207 | 3300025928 | Ga0207700_10412759 | Ga0207700_104127593 | 99 |
| 208 | 3300025929 | Ga0207664_10087764 | Ga0207664_100877645 | 99 |
| 209 | 3300025929 | Ga0207664_11025889 | Ga0207664_110258892 | 99 |
| 210 | 3300025929 | Ga0207664_11328273 | Ga0207664_113282731 | 99 |
| 211 | 3300025931 | Ga0207644_10047373 | Ga0207644_100473732 | 99 |
| 212 | 3300025931 | Ga0207644_10205245 | Ga0207644_102052451 | 99 |
| 213 | 3300025932 | Ga0207690_10051975 | Ga0207690_100519753 | 99 |
| 214 | 3300025933 | Ga0207706_10208574 | Ga0207706_102085742 | 99 |
| 215 | 3300025934 | Ga0207686_10143141 | Ga0207686_101431413 | 99 |
| 216 | 3300025935 | Ga0207709_11402128 | Ga0207709_114021281 | 99 |
| 217 | 3300025936 | Ga0207670_10323476 | Ga0207670_103234762 | 99 |
| 218 | 3300025937 | Ga0207669_10356904 | Ga0207669_103569042 | 99 |
| 219 | 3300025939 | Ga0207665_10000421 | Ga0207665_1000042126 | 99 |
| 220 | 3300025940 | Ga0207691_10107194 | Ga0207691_101071941 | 99 |
| 221 | 3300025941 | Ga0207711_10023360 | Ga0207711_100233605 | 99 |
| 222 | 3300025941 | Ga0207711_10713282 | Ga0207711_107132821 | 99 |
| 223 | 3300025942 | Ga0207689_10016884 | Ga0207689_100168844 | 99 |
| 224 | 3300025945 | Ga0207679_10138174 | Ga0207679_101381742 | 99 |
| 225 | 3300025949 | Ga0207667_10028583 | Ga0207667_100285836 | 99 |
| 226 | 3300025949 | Ga0207667_11724425 | Ga0207667_117244252 | 99 |
| 227 | 3300025961 | Ga0207712_10111116 | Ga0207712_101111162 | 99 |
| 228 | 3300025972 | Ga0207668_10039123 | Ga0207668_100391233 | 99 |
| 229 | 3300025981 | Ga0207640_10179752 | Ga0207640_101797524 | 99 |
| 230 | 3300025986 | Ga0207658_10185133 | Ga0207658_101851331 | 99 |
| 231 | 3300026023 | Ga0207677_10019752 | Ga0207677_100197526 | 99 |
| 232 | 3300026035 | Ga0207703_10056803 | Ga0207703_100568033 | 99 |
| 233 | 3300026035 | Ga0207703_10413179 | Ga0207703_104131793 | 99 |
| 234 | 3300026041 | Ga0207639_10113950 | Ga0207639_101139503 | 99 |
| 235 | 3300026067 | Ga0207678_10017846 | Ga0207678_100178464 | 99 |
| 236 | 3300026067 | Ga0207678_10290677 | Ga0207678_102906772 | 99 |
| 237 | 3300026075 | Ga0207708_10000002 | Ga0207708_10000002381 | 99 |
| 238 | 3300026075 | Ga0207708_10011092 | Ga0207708_100110922 | 99 |
| 239 | 3300026078 | Ga0207702_10094255 | Ga0207702_100942552 | 99 |
| 240 | 3300026078 | Ga0207702_10125942 | Ga0207702_101259422 | 99 |
| 241 | 3300026088 | Ga0207641_10051452 | Ga0207641_100514523 | 99 |
| 242 | 3300026088 | Ga0207641_10372089 | Ga0207641_103720892 | 99 |
| 243 | 3300026095 | Ga0207676_10060893 | Ga0207676_100608936 | 99 |
| 244 | 3300026116 | Ga0207674_10485446 | Ga0207674_104854464 | 99 |
| 245 | 3300026118 | Ga0207675_100023881 | Ga0207675_1000238814 | 99 |
| 246 | 3300026121 | Ga0207683_10160117 | Ga0207683_101601173 | 99 |
| 247 | 3300026142 | Ga0207698_10427009 | Ga0207698_104270092 | 99 |
| 248 | 3300026142 | Ga0207698_11817396 | Ga0207698_118173962 | 99 |
| 249 | 3300026142 | Ga0207698_12010081 | Ga0207698_120100812 | 99 |
| 250 | 3300027907 | Ga0207428_10333719 | Ga0207428_103337192 | 99 |
| 251 | 3300028379 | Ga0268266_10001159 | Ga0268266_1000115912 | 99 |
| 252 | 3300028380 | Ga0268265_10397355 | Ga0268265_103973552 | 99 |
| 253 | 3300028381 | Ga0268264_10000147 | Ga0268264_10000147119 | 99 |
| 254 | 3300028381 | Ga0268264_10087196 | Ga0268264_100871962 | 99 |
| 255 | 3300034816 | Ga0373930_0007047 | Ga0373930_0007047_1185_1484 | 99 |
| 256 | 3300034817 | Ga0373948_0154237 | Ga0373948_0154237_14_313 | 99 |
| 257 | 3300034818 | Ga0373950_0042826 | Ga0373950_0042826_228_527 | 99 |
| 258 | 3300034819 | Ga0373958_0044779 | Ga0373958_0044779_19_318 | 99 |
| 259 | 3300034820 | Ga0373959_0054044 | Ga0373959_0054044_411_710 | 99 |
| 260 | 3300034957 | Ga0373938_0071901 | Ga0373938_0071901_158_457 | 99 |
| 261 | 3300035085 | Ga0373929_0010165 | Ga0373929_0010165_593_892 | 99 |
| 262 | 3300035088 | Ga0373940_0074288 | Ga0373940_0074288_518_817 | 99 |
| 263 | 3300035090 | Ga0373949_0039198 | Ga0373949_0039198_798_1097 | 99 |
| 264 | 3300035091 | Ga0373951_0016170 | Ga0373951_0016170_1337_1636 | 99 |
| 265 | 3300035092 | Ga0373952_0215280 | Ga0373952_0215280_168_467 | 99 |
| 266 | 3300035111 | Ga0373923_0447620 | Ga0373923_0447620_217_516 | 99 |
| 267 | 3300035112 | Ga0373932_0081396 | Ga0373932_0081396_657_956 | 99 |
| 268 | 3300035115 | Ga0373941_0067306 | Ga0373941_0067306_613_912 | 99 |
| 269 | 3300035120 | Ga0373957_0310649 | Ga0373957_0310649_231_530 | 99 |
| 270 | 3300035121 | Ga0373960_0026172 | Ga0373960_0026172_443_742 | 99 |
| 271 | 3300035207 | Ga0373942_0037212 | Ga0373942_0037212_843_1142 | 99 |
| 272 | 3300035241 | Ga0373961_0065661 | Ga0373961_0065661_398_697 | 99 |
| 273 | 3300035242 | Ga0373962_0059548 | Ga0373962_0059548_780_1079 | 99 |
| 274 | 3300035691 | Ga0373931_0004236 | Ga0373931_0004236_5871_6170 | 99 |
| 275 | 3300035695 | Ga0373927_0187772 | Ga0373927_0187772_824_1123 | 99 |
| 276 | 3300035695 | Ga0373927_0706256 | Ga0373927_0706256_213_512 | 99 |
| 277 | 3300037068 | Ga0373925_0392746 | Ga0373925_0392746_420_719 | 99 |
| 278 | 3300038443 | Ga0395901_0433023 | Ga0395901_0433023_577_879 | 99 |
| 279 | 3300039450 | Ga0436363_1237544 | Ga0436363_1237544_76_375 | 99 |
| 280 | 3300044658 | Ga0466972_0119257 | Ga0466972_0119257_676_975 | 99 |
| 281 | 3300044658 | Ga0466972_0199008 | Ga0466972_0199008_73_372 | 99 |
| 282 | 3300044658 | Ga0466972_0299360 | Ga0466972_0299360_17_316 | 99 |
| 283 | 3300044683 | Ga0466965_0259848 | Ga0466965_0259848_46_345 | 99 |
| 284 | 3300044683 | Ga0466965_0552889 | Ga0466965_0552889_309_608 | 99 |
| 285 | 3300044684 | Ga0466966_0264582 | Ga0466966_0264582_375_674 | 99 |
| 286 | 3300044684 | Ga0466966_0575525 | Ga0466966_0575525_313_612 | 99 |
| 287 | 3300044693 | Ga0466961_0008147 | Ga0466961_0008147_6323_6622 | 99 |
| 288 | 3300044693 | Ga0466961_0015988 | Ga0466961_0015988_718_1017 | 99 |
| 289 | 3300044693 | Ga0466961_0032955 | Ga0466961_0032955_183_482 | 99 |
| 290 | 3300044693 | Ga0466961_0101346 | Ga0466961_0101346_326_625 | 99 |
| 291 | 3300044693 | Ga0466961_0524030 | Ga0466961_0524030_238_537 | 99 |
| 292 | 3300044694 | Ga0466963_0027036 | Ga0466963_0027036_2585_2884 | 99 |
| 293 | 3300044694 | Ga0466963_0042499 | Ga0466963_0042499_2664_2963 | 99 |
| 294 | 3300044694 | Ga0466963_0229695 | Ga0466963_0229695_33_332 | 99 |
| 295 | 3300044694 | Ga0466963_0280221 | Ga0466963_0280221_177_476 | 99 |
| 296 | 3300044694 | Ga0466963_0965987 | Ga0466963_0965987_112_411 | 99 |
| 297 | 3300044706 | Ga0466964_0108091 | Ga0466964_0108091_50_349 | 99 |
| 298 | 3300044706 | Ga0466964_0197139 | Ga0466964_0197139_310_609 | 99 |
| 299 | 3300044719 | Ga0466971_0115084 | Ga0466971_0115084_303_602 | 99 |
| 300 | 3300044719 | Ga0466971_0177396 | Ga0466971_0177396_430_729 | 99 |
| 301 | 3300044765 | Ga0466970_0262261 | Ga0466970_0262261_37_336 | 99 |
| 302 | 3300044765 | Ga0466970_0791491 | Ga0466970_0791491_152_451 | 99 |
| 303 | 3300044842 | Ga0466957_0005874 | Ga0466957_0005874_74_373 | 99 |
| 304 | 3300044901 | Ga0466960_0131144 | Ga0466960_0131144_350_649 | 99 |
| 305 | 3300044901 | Ga0466960_0343278 | Ga0466960_0343278_294_593 | 99 |
| 306 | 3300044901 | Ga0466960_0727814 | Ga0466960_0727814_56_355 | 99 |
| 307 | 3300045049 | Ga0466959_0028379 | Ga0466959_0028379_2788_3087 | 99 |
| 308 | 3300045049 | Ga0466959_0131730 | Ga0466959_0131730_1119_1418 | 99 |
| 309 | 3300045049 | Ga0466959_0257397 | Ga0466959_0257397_559_858 | 99 |
| 310 | 3300045049 | Ga0466959_0436965 | Ga0466959_0436965_282_581 | 99 |
| 311 | 3300045836 | Ga0466958_0003112 | Ga0466958_0003112_3303_3602 | 99 |
| 312 | 3300045836 | Ga0466958_0008699 | Ga0466958_0008699_3573_3872 | 99 |
| 313 | 3300045836 | Ga0466958_0016170 | Ga0466958_0016170_1432_1731 | 99 |
| 314 | 3300045836 | Ga0466958_0040292 | Ga0466958_0040292_2066_2365 | 99 |
| 315 | 3300045836 | Ga0466958_0217576 | Ga0466958_0217576_139_438 | 99 |
| 316 | 3300045836 | Ga0466958_0834455 | Ga0466958_0834455_291_590 | 99 |
| 317 | 3300045976 | Ga0466967_0116428 | Ga0466967_0116428_1710_2009 | 99 |
| 318 | 3300045976 | Ga0466967_0801291 | Ga0466967_0801291_590_889 | 99 |
| 319 | 3300045976 | Ga0466967_1320217 | Ga0466967_1320217_277_576 | 99 |
| 320 | 3300045976 | Ga0466967_1880498 | Ga0466967_1880498_255_554 | 99 |
| 321 | 3300046472 | Ga0495580_0237319 | Ga0495580_0237319_189_488 | 99 |
| 322 | 3300046501 | Ga0495607_0521205 | Ga0495607_0521205_20_319 | 99 |
| 323 | 3300046690 | Ga0495624_0250051 | Ga0495624_0250051_199_498 | 99 |
| 324 | 3300048903 | Ga0496100_0103454 | Ga0496100_0103454_1072_1371 | 99 |
| 325 | 3300048903 | Ga0496100_0612767 | Ga0496100_0612767_409_708 | 99 |
| 326 | 3300048905 | Ga0496102_0000013 | Ga0496102_0000013_290021_290320 | 99 |
| 327 | 3300048905 | Ga0496102_0000727 | Ga0496102_0000727_12120_12419 | 99 |
| 328 | 3300048905 | Ga0496102_0245894 | Ga0496102_0245894_333_632 | 99 |
| 329 | 3300048905 | Ga0496102_1290980 | Ga0496102_1290980_194_493 | 99 |
| 330 | 3300048906 | Ga0496103_0000239 | Ga0496103_0000239_45865_46164 | 99 |
| 331 | 3300048906 | Ga0496103_0063452 | Ga0496103_0063452_249_548 | 99 |
| 332 | 3300048906 | Ga0496103_0192464 | Ga0496103_0192464_955_1254 | 99 |
| 333 | 3300048907 | Ga0496104_0025620 | Ga0496104_0025620_1713_2012 | 99 |
| 334 | 3300048908 | Ga0496105_0009011 | Ga0496105_0009011_3682_3981 | 99 |
| 335 | 3300048909 | Ga0496106_0017984 | Ga0496106_0017984_3057_3356 | 99 |
| 336 | 3300048910 | Ga0496107_0022726 | Ga0496107_0022726_2706_3005 | 99 |
| 337 | 3300048911 | Ga0496108_0192131 | Ga0496108_0192131_1406_1705 | 99 |
| 338 | 3300048912 | Ga0496109_0017670 | Ga0496109_0017670_4551_4850 | 99 |
| 339 | 3300048913 | Ga0496110_0065709 | Ga0496110_0065709_1558_1857 | 99 |
| 340 | 3300048915 | Ga0496112_0177208 | Ga0496112_0177208_565_864 | 99 |
| 341 | 3300048916 | Ga0496113_1250334 | Ga0496113_1250334_255_554 | 99 |
| 342 | 3300048917 | Ga0496114_0013901 | Ga0496114_0013901_4458_4757 | 99 |
| 343 | 3300048918 | Ga0496115_0476484 | Ga0496115_0476484_96_395 | 99 |
| 344 | 3300048919 | Ga0496116_0265734 | Ga0496116_0265734_186_485 | 99 |
| 345 | 3300048921 | Ga0496118_0017555 | Ga0496118_0017555_2913_3212 | 99 |
| 346 | 3300048924 | Ga0496121_0262308 | Ga0496121_0262308_381_680 | 99 |
| 347 | 3300049568 | Ga0501031_0230038 | Ga0501031_0230038_531_830 | 99 |
| 348 | 3300049569 | Ga0501032_0004003 | Ga0501032_0004003_10253_10552 | 99 |
| 349 | 3300049570 | Ga0501033_0616791 | Ga0501033_0616791_117_416 | 99 |
| 350 | 3300049570 | Ga0501033_0640767 | Ga0501033_0640767_58_357 | 99 |
| 351 | 3300049571 | Ga0501034_0053584 | Ga0501034_0053584_2812_3111 | 99 |
| 352 | 3300049572 | Ga0501036_0178764 | Ga0501036_0178764_1390_1689 | 99 |
| 353 | 3300049573 | Ga0501037_0079441 | Ga0501037_0079441_655_954 | 99 |
| 354 | 3300049574 | Ga0501038_0000399 | Ga0501038_0000399_27464_27763 | 99 |
| 355 | 3300049579 | Ga0501043_0011695 | Ga0501043_0011695_633_932 | 99 |
| 356 | 3300049581 | Ga0501047_0012995 | Ga0501047_0012995_7527_7826 | 99 |
| 357 | 3300049582 | Ga0501048_0002723 | Ga0501048_0002723_7387_7686 | 99 |
| 358 | 3300049586 | Ga0501070_0034307 | Ga0501070_0034307_192_491 | 99 |
| 359 | 3300049586 | Ga0501070_0422129 | Ga0501070_0422129_628_927 | 99 |
| 360 | 3300049590 | Ga0501074_1113212 | Ga0501074_1113212_165_464 | 99 |
| 361 | 3300049742 | Ga0501080_1122539 | Ga0501080_1122539_100_399 | 99 |
| 362 | 3300049742 | Ga0501080_1611392 | Ga0501080_1611392_107_406 | 99 |
| 363 | 3300049822 | Ga0501035_0024453 | Ga0501035_0024453_1693_1992 | 99 |
| 364 | 3300049822 | Ga0501035_0267034 | Ga0501035_0267034_241_540 | 99 |
| 365 | 3300049823 | Ga0501044_0099703 | Ga0501044_0099703_2485_2784 | 99 |
| 366 | 3300049823 | Ga0501044_0333039 | Ga0501044_0333039_592_891 | 99 |
| 367 | 3300050513 | nmdc:mga0rr50_11595_c1 | nmdc:mga0rr50_11595_c1_1252_1551 | 99 |
| 368 | 3300050513 | nmdc:mga0rr50_564633_c1 | nmdc:mga0rr50_564633_c1_180_482 | 99 |
| 369 | 3300050514 | nmdc:mga08x19_29812_c1 | nmdc:mga08x19_29812_c1_744_1043 | 99 |
| 370 | 3300050515 | nmdc:mga0a205_12912_c1 | nmdc:mga0a205_12912_c1_3033_3332 | 99 |
| 371 | 3300053084 | Ga0495595_0329900 | Ga0495595_0329900_205_504 | 99 |
| 372 | 3300060353 | Ga0501082_0542809 | Ga0501082_0542809_585_884 | 99 |
| 373 | 3300061719 | Ga0466962_0001713 | Ga0466962_0001713_9968_10267 | 99 |
| 374 | 3300001979 | JGI24740J21852_10123441 | JGI24740J21852_101234411 | 100 |
| 375 | 3300002067 | JGI24735J21928_10018243 | JGI24735J21928_100182432 | 100 |
| 376 | 3300005435 | Ga0070714_100000007 | Ga0070714_100000007224 | 100 |
| 377 | 3300005578 | Ga0068854_100375707 | Ga0068854_1003757074 | 100 |
| 378 | 3300005616 | Ga0068852_100026447 | Ga0068852_1000264475 | 100 |
| 379 | 3300009093 | Ga0105240_10012953 | Ga0105240_1001295314 | 100 |
| 380 | 3300009098 | Ga0105245_10012924 | Ga0105245_100129249 | 100 |
| 381 | 3300009174 | Ga0105241_11210950 | Ga0105241_112109502 | 100 |
| 382 | 3300009545 | Ga0105237_12182923 | Ga0105237_121829232 | 100 |
| 383 | 3300013104 | Ga0157370_10063337 | Ga0157370_100633373 | 100 |
| 384 | 3300013297 | Ga0157378_10307075 | Ga0157378_103070751 | 100 |
| 385 | 3300013307 | Ga0157372_11340087 | Ga0157372_113400872 | 100 |
| 386 | 3300025909 | Ga0207705_10605472 | Ga0207705_106054722 | 100 |
| 387 | 3300025913 | Ga0207695_10069000 | Ga0207695_100690007 | 100 |
| 388 | 3300025924 | Ga0207694_10084737 | Ga0207694_100847373 | 100 |
| 389 | 3300025929 | Ga0207664_10000014 | Ga0207664_100000148 | 100 |
| 390 | 3300025981 | Ga0207640_10403138 | Ga0207640_104031384 | 100 |
| 391 | 3300026078 | Ga0207702_12346957 | Ga0207702_123469571 | 100 |
| 392 | 3300026116 | Ga0207674_10897041 | Ga0207674_108970412 | 100 |
| 393 | 3300026142 | Ga0207698_10035745 | Ga0207698_100357455 | 100 |
| 394 | 3300026142 | Ga0207698_10254895 | Ga0207698_102548952 | 100 |
| 395 | 3300044684 | Ga0466966_0351655 | Ga0466966_0351655_44_346 | 100 |
| 396 | 3300044684 | Ga0466966_0908513 | Ga0466966_0908513_25_327 | 100 |
| 397 | 3300044693 | Ga0466961_0396013 | Ga0466961_0396013_472_774 | 100 |
| 398 | 3300044694 | Ga0466963_0418359 | Ga0466963_0418359_112_414 | 100 |
| 399 | 3300045976 | Ga0466967_0629737 | Ga0466967_0629737_298_600 | 100 |
| 400 | 3300048912 | Ga0496109_1642576 | Ga0496109_1642576_132_434 | 100 |
| 401 | 3300059640 | Ga0587067_134531 | Ga0587067_134531_286_597 | 100 |
| 402 | 3300061719 | Ga0466962_0352541 | Ga0466962_0352541_125_427 | 100 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hif-assembly1.cif.gz_Y | kuenenia stuttgartiensis hydrazine dehydrogenase complex | 0.9008 | 18 | 99 |
| 4v4c-assembly3.cif.gz_F | crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici | 0.8842 | 19 | 99 |
| 4p0d-assembly1.cif.gz_A | the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions | 0.8763 | 20 | 87 |
| 6fwv-assembly1.cif.gz_A | the bacillus anthracis tie protein | 0.8605 | 19 | 98 |
| 1qmu-assembly1.cif.gz_A | duck carboxypeptidase d domain ii | 0.8547 | 19 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0CG96_23_100_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9831 | 24 | 100 | 2.60.40.1120 |
| af_P0CG96_23_100_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9587 | 24 | 100 | 2.60.40.1120 |
| af_Q9JHW1_1212_1304_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.9163 | 23 | 99 | 2.60.40.1120 |
| af_Q9JHW1_795_903_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.8957 | 23 | 99 | 2.60.40.1120 |
| af_P15087_375_469_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.8868 | 23 | 99 | 2.60.40.1120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I7X584-F1-model_v4 | DUF1416 domain-containing protein | 0.9826 | 23 | 100 |
|
| AF-W7SLE8-F1-model_v4 | alpha-amylase (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) | 0.9664 | 20 | 99 |
GO:0004556
GO:0005886 GO:0005975 GO:0022857 GO:0030246 |
| AF-H6RCW9-F1-model_v4 | Sulphur metabolism protein | 0.9663 | 15 | 100 |
|
| AF-A0A7J9WU56-F1-model_v4 | DUF1416 domain-containing protein | 0.9635 | 20 | 100 |
|
| AF-A0A1H1WHE2-F1-model_v4 | Drug resistance transporter, EmrB/QacA subfamily | 0.9628 | 20 | 99 |
GO:0005886
GO:0005975 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar