F435101

General Info

Members Datasets Scaffolds Average Seq Length
402 248 402 99

Family's Representative Sequence

Representative Sequence 3300025321|Ga0207656_10638439|Ga0207656_106384392
Length 107
Sequence MCGAPAQSPVLPPNVDVTKETVIYGVVSKNDAPVPAAYVRLLDNTGEFTAEVVTSATGDYRFFAAPGAWTLSVLHRDGAVRQPINASRRSRVSRPACSTMRSAALKS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
171 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.28
Metatranscriptomes 5.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.72
Rhizosphere 92.79
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10123441 3300001979 Bacteria 648
2 JGI24739J22299_10214000 3300001989 Bacteria 565
3 JGI24735J21928_10018243 3300002067 Bacteria 2164
4 JGI25404J52841_10108483 3300003659 Bacteria 583
5 Ga0070676_10623199 3300005328 Bacteria 780
6 Ga0070683_100886775 3300005329 Bacteria 855
7 Ga0070690_100039220 3300005330 Bacteria 2992
8 Ga0068869_100110406 3300005334 Bacteria 2091
9 Ga0070666_10066807 3300005335 Bacteria 2441
10 Ga0070666_10137693 3300005335 Bacteria 1699
11 Ga0070680_100684024 3300005336 Bacteria 882
12 Ga0070682_100155589 3300005337 Bacteria 1573
13 Ga0068868_100056468 3300005338 Bacteria 3100
14 Ga0068868_102400112 3300005338 Bacteria 504
15 Ga0070660_100043396 3300005339 Bacteria 3437
16 Ga0070689_100192076 3300005340 Bacteria 1663
17 Ga0070691_10038038 3300005341 Bacteria 2271
18 Ga0070687_100118299 3300005343 Bacteria 1511
19 Ga0070668_100166870 3300005347 Bacteria 1790
20 Ga0070669_100118996 3300005353 Bacteria 2012
21 Ga0070669_100456610 3300005353 Bacteria 1054
22 Ga0070671_100079784 3300005355 Bacteria 2736
23 Ga0070674_100051460 3300005356 Bacteria 2839
24 Ga0070673_100389799 3300005364 Bacteria 1243
25 Ga0070659_100764744 3300005366 Bacteria 838
26 Ga0070667_100025482 3300005367 Bacteria 4917
27 Ga0070667_100083698 3300005367 Bacteria 2733
28 Ga0070709_10240639 3300005434 Bacteria 1299
29 Ga0070714_100000007 3300005435 Bacteria 285654
30 Ga0070714_100043638 3300005435 Bacteria 3793
31 Ga0070714_101059414 3300005435 Bacteria 790
32 Ga0070714_101588573 3300005435 Bacteria 639
33 Ga0070713_100207999 3300005436 Bacteria 1770
34 Ga0070713_100451233 3300005436 Bacteria 1208
35 Ga0070710_10033219 3300005437 Bacteria 2800
36 Ga0070701_10155678 3300005438 Bacteria 1320
37 Ga0070711_100061353 3300005439 Bacteria 2617
38 Ga0070700_100779604 3300005441 Bacteria 768
39 Ga0070694_100123216 3300005444 Bacteria 1862
40 Ga0070663_100334396 3300005455 Bacteria 1222
41 Ga0070663_100871406 3300005455 Bacteria 776
42 Ga0070678_100096135 3300005456 Bacteria 2284
43 Ga0070681_10611974 3300005458 Bacteria 1004
44 Ga0070681_11686540 3300005458 Bacteria 560
45 Ga0068867_100714153 3300005459 Bacteria 886
46 Ga0070685_10993516 3300005466 Bacteria 629
47 Ga0070706_101121590 3300005467 Bacteria 724
48 Ga0070698_101431485 3300005471 Bacteria 642
49 Ga0070679_100357079 3300005530 Bacteria 1409
50 Ga0070684_101002946 3300005535 Bacteria 784
51 Ga0070697_100433471 3300005536 Bacteria 1143
52 Ga0068853_100063660 3300005539 Bacteria 3195
53 Ga0068853_101656731 3300005539 Bacteria 620
54 Ga0070672_100490278 3300005543 Bacteria 1062
55 Ga0070686_100065624 3300005544 Bacteria 2359
56 Ga0070696_100074305 3300005546 Bacteria 2397
57 Ga0070693_100012097 3300005547 Bacteria 4359
58 Ga0070665_100056155 3300005548 Bacteria 3948
59 Ga0070665_100739222 3300005548 Bacteria 997
60 Ga0070704_100134832 3300005549 Bacteria 1919
61 Ga0068855_100021593 3300005563 Bacteria 7721
62 Ga0068855_100098364 3300005563 Bacteria 3371
63 Ga0068855_100695128 3300005563 Bacteria 1089
64 Ga0070664_100042499 3300005564 Bacteria 3836
65 Ga0068857_100052368 3300005577 Bacteria 3622
66 Ga0068854_100375707 3300005578 Bacteria 1170
67 Ga0068856_100047448 3300005614 Bacteria 4231
68 Ga0068856_100097110 3300005614 Bacteria 2935
69 Ga0070702_100018120 3300005615 Bacteria 3646
70 Ga0068852_100026447 3300005616 Bacteria 4717
71 Ga0068852_100313876 3300005616 Bacteria 1521
72 Ga0068859_100001814 3300005617 Bacteria 21752
73 Ga0068859_100215421 3300005617 Bacteria 2008
74 Ga0068864_100263293 3300005618 Bacteria 1604
75 Ga0068866_10103458 3300005718 Bacteria 1575
76 Ga0068861_100073897 3300005719 Bacteria 2650
77 Ga0068851_10126447 3300005834 Bacteria 1379
78 Ga0068863_100015970 3300005841 Bacteria 7202
79 Ga0068863_100310929 3300005841 Bacteria 1529
80 Ga0068858_100031845 3300005842 Bacteria 4901
81 Ga0068858_100261044 3300005842 Bacteria 1646
82 Ga0068860_100000114 3300005843 Bacteria 128789
83 Ga0068860_101687201 3300005843 Bacteria 655
84 Ga0068862_100139496 3300005844 Bacteria 2151
85 Ga0081540_1008747 3300005983 Bacteria 7039
86 Ga0081539_10185474 3300005985 Bacteria 972
87 Ga0070717_10153525 3300006028 Bacteria 1993
88 Ga0070716_100007509 3300006173 Bacteria 5372
89 Ga0070716_100935874 3300006173 Bacteria 681
90 Ga0070712_100062926 3300006175 Bacteria 2625
91 Ga0070712_100491057 3300006175 Bacteria 1028
92 Ga0097621_100027356 3300006237 Bacteria 4483
93 Ga0068871_100802458 3300006358 Bacteria 868
94 Ga0075433_10019681 3300006852 Bacteria 5630
95 Ga0068865_100167848 3300006881 Bacteria 1680
96 Ga0075436_100196571 3300006914 Bacteria 1428
97 Ga0075436_101082314 3300006914 Bacteria 603
98 Ga0097620_100001814 3300006931 Bacteria 21752
99 Ga0097620_100215431 3300006931 Bacteria 2008
100 Ga0075435_100131381 3300007076 Bacteria 2095
101 Ga0075435_100611882 3300007076 Bacteria 945
102 Ga0105251_10208901 3300009011 Bacteria 879
103 Ga0105250_10186504 3300009092 Bacteria 872
104 Ga0105240_10012953 3300009093 Bacteria 11487
105 Ga0105240_10018411 3300009093 Bacteria 9379
106 Ga0105240_10139974 3300009093 Bacteria 2894
107 Ga0105240_10157867 3300009093 Bacteria 2696
108 Ga0105240_10578577 3300009093 Bacteria 1239
109 Ga0111539_10088850 3300009094 Bacteria 3630
110 Ga0105245_10012924 3300009098 Bacteria 7277
111 Ga0105247_10005186 3300009101 Bacteria 8242
112 Ga0105247_10282207 3300009101 Bacteria 1146
113 Ga0105243_10027780 3300009148 Bacteria 4338
114 Ga0105241_10120464 3300009174 Bacteria 2112
115 Ga0105241_11210950 3300009174 Bacteria 716
116 Ga0105242_10303911 3300009176 Bacteria 1457
117 Ga0105248_10031838 3300009177 Bacteria 5893
118 Ga0105248_11057242 3300009177 Bacteria 917
119 Ga0105237_10043626 3300009545 Bacteria 4517
120 Ga0105237_10102967 3300009545 Bacteria 2847
121 Ga0105237_11048878 3300009545 Bacteria 822
122 Ga0105237_12182923 3300009545 Bacteria 563
123 Ga0105238_10220012 3300009551 Bacteria 1875
124 Ga0105238_10438226 3300009551 Bacteria 1303
125 Ga0105238_11235545 3300009551 Bacteria 772
126 Ga0105238_11865196 3300009551 Bacteria 634
127 Ga0105249_10065215 3300009553 Bacteria 3350
128 Ga0105239_10011539 3300010375 Bacteria 9855
129 Ga0157370_10063337 3300013104 Bacteria 3504
130 Ga0157370_10867901 3300013104 Bacteria 820
131 Ga0157369_10649843 3300013105 Bacteria 1087
132 Ga0157369_11703293 3300013105 Bacteria 641
133 Ga0157369_12031485 3300013105 Bacteria 583
134 Ga0157374_10163581 3300013296 Bacteria 2168
135 Ga0157374_10261535 3300013296 Bacteria 1704
136 Ga0157374_11581473 3300013296 Bacteria 679
137 Ga0157378_10046006 3300013297 Bacteria 3880
138 Ga0157378_10307075 3300013297 Bacteria 1537
139 Ga0163162_10031688 3300013306 Bacteria 5245
140 Ga0163162_12118197 3300013306 Bacteria 645
141 Ga0157372_10876019 3300013307 Bacteria 1042
142 Ga0157372_11340087 3300013307 Bacteria 826
143 Ga0157372_11996024 3300013307 Bacteria 667
144 Ga0163163_10059004 3300014325 Bacteria 3794
145 Ga0163163_10567072 3300014325 Bacteria 1198
146 Ga0157380_10086680 3300014326 Bacteria 2573
147 Ga0157377_10158722 3300014745 Bacteria 1404
148 Ga0157379_10137611 3300014968 Bacteria 2201
149 Ga0157379_10191388 3300014968 Bacteria 1849
150 Ga0157379_10754976 3300014968 Bacteria 916
151 Ga0157376_10013982 3300014969 Bacteria 6005
152 Ga0163161_10008261 3300017792 Bacteria 7201
153 Ga0197907_10459964 3300020069 Bacteria 1264
154 Ga0197907_10533094 3300020069 Bacteria 1073
155 Ga0197907_11009689 3300020069 Bacteria 959
156 Ga0197907_11222175 3300020069 Bacteria 2078
157 Ga0206356_10162526 3300020070 Bacteria 997
158 Ga0206351_10238902 3300020077 Bacteria 1408
159 Ga0206352_10839149 3300020078 Bacteria 594
160 Ga0206350_10360878 3300020080 Bacteria 1488
161 Ga0206350_10513969 3300020080 Bacteria 2384
162 Ga0206350_10589506 3300020080 Bacteria 2327
163 Ga0206354_10306350 3300020081 Bacteria 559
164 Ga0206354_10795613 3300020081 Bacteria 1362
165 Ga0206354_10995898 3300020081 Bacteria 632
166 Ga0206354_11004522 3300020081 Bacteria 2063
167 Ga0206353_10845988 3300020082 Bacteria 784
168 Ga0206353_11256512 3300020082 Bacteria 2760
169 Ga0206353_11788172 3300020082 Bacteria 2114
170 Ga0154015_1147703 3300020610 Bacteria 503
171 Ga0154015_1304045 3300020610 Bacteria 1469
172 Ga0154015_1337719 3300020610 Bacteria 1122
173 Ga0224712_10008632 3300022467 Bacteria 3031
174 Ga0224712_10052787 3300022467 Bacteria 1589
175 Ga0207656_10638439 3300025321 Bacteria 544
176 Ga0207713_1118618 3300025735 Bacteria 890
177 Ga0207653_10030595 3300025885 Bacteria 1737
178 Ga0207692_10124600 3300025898 Bacteria 1447
179 Ga0207642_10028631 3300025899 Bacteria 2296
180 Ga0207710_10006182 3300025900 Bacteria 5123
181 Ga0207710_10267724 3300025900 Bacteria 858
182 Ga0207688_10005912 3300025901 Bacteria 6663
183 Ga0207680_10017231 3300025903 Bacteria 3813
184 Ga0207680_10396733 3300025903 Bacteria 974
185 Ga0207647_10154039 3300025904 Bacteria 1342
186 Ga0207647_10327549 3300025904 Bacteria 869
187 Ga0207647_10338426 3300025904 Bacteria 853
188 Ga0207647_10446523 3300025904 Bacteria 725
189 Ga0207645_10780334 3300025907 Bacteria 650
190 Ga0207643_10046453 3300025908 Bacteria 2455
191 Ga0207705_10605472 3300025909 Bacteria 852
192 Ga0207654_10127722 3300025911 Bacteria 1605
193 Ga0207695_10069000 3300025913 Bacteria 3619
194 Ga0207695_10075644 3300025913 Bacteria 3425
195 Ga0207671_10065014 3300025914 Bacteria 2712
196 Ga0207671_10531010 3300025914 Bacteria 938
197 Ga0207693_10000970 3300025915 Bacteria 25775
198 Ga0207693_10589538 3300025915 Bacteria 866
199 Ga0207663_10452761 3300025916 Bacteria 990
200 Ga0207657_10002184 3300025919 Bacteria 21193
201 Ga0207681_10067966 3300025923 Bacteria 2473
202 Ga0207681_10502428 3300025923 Bacteria 993
203 Ga0207694_10084737 3300025924 Bacteria 2493
204 Ga0207694_10429861 3300025924 Bacteria 1101
205 Ga0207687_10027450 3300025927 Bacteria 3820
206 Ga0207687_10079873 3300025927 Bacteria 2359
207 Ga0207700_10190178 3300025928 Bacteria 1724
208 Ga0207700_10412759 3300025928 Bacteria 1185
209 Ga0207664_10000014 3300025929 Bacteria 249865
210 Ga0207664_10087764 3300025929 Bacteria 2543
211 Ga0207664_11025889 3300025929 Bacteria 739
212 Ga0207664_11328273 3300025929 Bacteria 639
213 Ga0207644_10047373 3300025931 Bacteria 3067
214 Ga0207644_10205245 3300025931 Bacteria 1556
215 Ga0207690_10051975 3300025932 Bacteria 2743
216 Ga0207706_10208574 3300025933 Bacteria 1713
217 Ga0207686_10143141 3300025934 Bacteria 1655
218 Ga0207686_10183684 3300025934 Bacteria 1485
219 Ga0207709_11402128 3300025935 Bacteria 579
220 Ga0207670_10323476 3300025936 Bacteria 1214
221 Ga0207669_10356904 3300025937 Bacteria 1131
222 Ga0207665_10000421 3300025939 Bacteria 29232
223 Ga0207691_10107194 3300025940 Bacteria 2488
224 Ga0207711_10023360 3300025941 Bacteria 5177
225 Ga0207711_10713282 3300025941 Bacteria 935
226 Ga0207689_10016884 3300025942 Bacteria 6176
227 Ga0207679_10138174 3300025945 Bacteria 1966
228 Ga0207667_10028583 3300025949 Bacteria 6054
229 Ga0207667_11724425 3300025949 Bacteria 592
230 Ga0207712_10111116 3300025961 Bacteria 2056
231 Ga0207668_10039123 3300025972 Bacteria 3189
232 Ga0207640_10179752 3300025981 Bacteria 1585
233 Ga0207640_10403138 3300025981 Bacteria 1114
234 Ga0207658_10185133 3300025986 Bacteria 1727
235 Ga0207677_10019752 3300026023 Bacteria 4076
236 Ga0207703_10056803 3300026035 Bacteria 3189
237 Ga0207703_10413179 3300026035 Bacteria 1254
238 Ga0207639_10113950 3300026041 Bacteria 2209
239 Ga0207678_10017846 3300026067 Bacteria 6232
240 Ga0207678_10290677 3300026067 Bacteria 1404
241 Ga0207708_10000002 3300026075 Bacteria 411071
242 Ga0207708_10011092 3300026075 Bacteria 6702
243 Ga0207702_10094255 3300026078 Bacteria 2627
244 Ga0207702_10125942 3300026078 Bacteria 2300
245 Ga0207702_12346957 3300026078 Bacteria 521
246 Ga0207641_10051452 3300026088 Bacteria 3488
247 Ga0207641_10372089 3300026088 Bacteria 1366
248 Ga0207676_10060893 3300026095 Bacteria 2987
249 Ga0207674_10485446 3300026116 Bacteria 1194
250 Ga0207674_10897041 3300026116 Bacteria 854
251 Ga0207675_100023881 3300026118 Bacteria 5686
252 Ga0207683_10160117 3300026121 Bacteria 2034
253 Ga0207698_10035745 3300026142 Bacteria 3638
254 Ga0207698_10254895 3300026142 Bacteria 1608
255 Ga0207698_10427009 3300026142 Bacteria 1273
256 Ga0207698_11817396 3300026142 Bacteria 624
257 Ga0207698_12010081 3300026142 Bacteria 592
258 Ga0207428_10333719 3300027907 Bacteria 1118
259 Ga0268266_10001159 3300028379 Bacteria 32594
260 Ga0268265_10397355 3300028380 Bacteria 1273
261 Ga0268264_10000147 3300028381 Bacteria 164790
262 Ga0268264_10087196 3300028381 Bacteria 2683
263 Ga0373930_0007047 3300034816 Bacteria 1922
264 Ga0373948_0154237 3300034817 Bacteria 576
265 Ga0373950_0042826 3300034818 Bacteria 871
266 Ga0373958_0044779 3300034819 Bacteria 917
267 Ga0373959_0054044 3300034820 Bacteria 874
268 Ga0373938_0071901 3300034957 Bacteria 828
269 Ga0373929_0010165 3300035085 Bacteria 1755
270 Ga0373940_0074288 3300035088 Bacteria 995
271 Ga0373949_0039198 3300035090 Bacteria 1159
272 Ga0373951_0016170 3300035091 Bacteria 1682
273 Ga0373952_0215280 3300035092 Bacteria 568
274 Ga0373923_0447620 3300035111 Bacteria 626
275 Ga0373932_0081396 3300035112 Bacteria 1023
276 Ga0373941_0067306 3300035115 Bacteria 1181
277 Ga0373957_0310649 3300035120 Bacteria 670
278 Ga0373960_0026172 3300035121 Bacteria 1592
279 Ga0373942_0037212 3300035207 Bacteria 1314
280 Ga0373961_0065661 3300035241 Bacteria 1112
281 Ga0373962_0059548 3300035242 Bacteria 1119
282 Ga0373931_0004236 3300035691 Bacteria 6525
283 Ga0373927_0187772 3300035695 Bacteria 1356
284 Ga0373927_0706256 3300035695 Bacteria 666
285 Ga0373925_0392746 3300037068 Bacteria 1131
286 Ga0436364_0808363 3300037853 Bacteria 2534
287 Ga0395901_0433023 3300038443 Bacteria 1347
288 Ga0436363_1237544 3300039450 Bacteria 594
289 Ga0466972_0119257 3300044658 Bacteria 1245
290 Ga0466972_0199008 3300044658 Bacteria 938
291 Ga0466972_0220276 3300044658 Bacteria 888
292 Ga0466972_0299360 3300044658 Bacteria 752
293 Ga0466965_0259848 3300044683 Bacteria 933
294 Ga0466965_0552889 3300044683 Bacteria 650
295 Ga0466966_0264582 3300044684 Bacteria 1035
296 Ga0466966_0351655 3300044684 Bacteria 885
297 Ga0466966_0575525 3300044684 Bacteria 678
298 Ga0466966_0908513 3300044684 Bacteria 531
299 Ga0466961_0008147 3300044693 Bacteria 6676
300 Ga0466961_0015988 3300044693 Bacteria 4817
301 Ga0466961_0032955 3300044693 Bacteria 3329
302 Ga0466961_0101346 3300044693 Bacteria 1814
303 Ga0466961_0396013 3300044693 Bacteria 838
304 Ga0466961_0524030 3300044693 Bacteria 715
305 Ga0466963_0027036 3300044694 Bacteria 3671
306 Ga0466963_0042499 3300044694 Bacteria 2985
307 Ga0466963_0229695 3300044694 Bacteria 1300
308 Ga0466963_0280221 3300044694 Bacteria 1172
309 Ga0466963_0418359 3300044694 Bacteria 945
310 Ga0466963_0965987 3300044694 Bacteria 600
311 Ga0466964_0108091 3300044706 Bacteria 1236
312 Ga0466964_0197139 3300044706 Bacteria 964
313 Ga0466964_0517513 3300044706 Bacteria 643
314 Ga0466971_0115084 3300044719 Bacteria 1243
315 Ga0466971_0177396 3300044719 Bacteria 1001
316 Ga0466970_0262261 3300044765 Bacteria 969
317 Ga0466970_0791491 3300044765 Bacteria 555
318 Ga0466957_0005874 3300044842 Bacteria 6916
319 Ga0466960_0131144 3300044901 Bacteria 1323
320 Ga0466960_0343278 3300044901 Bacteria 850
321 Ga0466960_0727814 3300044901 Bacteria 597
322 Ga0466959_0028379 3300045049 Bacteria 4150
323 Ga0466959_0131730 3300045049 Bacteria 1772
324 Ga0466959_0257397 3300045049 Bacteria 1202
325 Ga0466959_0436965 3300045049 Bacteria 888
326 Ga0466958_0003112 3300045836 Bacteria 8524
327 Ga0466958_0008699 3300045836 Bacteria 5636
328 Ga0466958_0016170 3300045836 Bacteria 4293
329 Ga0466958_0040292 3300045836 Bacteria 2808
330 Ga0466958_0217576 3300045836 Bacteria 1218
331 Ga0466958_0247899 3300045836 Bacteria 1139
332 Ga0466958_0834455 3300045836 Bacteria 601
333 Ga0466967_0012072 3300045976 Bacteria 6586
334 Ga0466967_0116428 3300045976 Bacteria 2462
335 Ga0466967_0625481 3300045976 Bacteria 1063
336 Ga0466967_0629737 3300045976 Bacteria 1060
337 Ga0466967_0749122 3300045976 Bacteria 969
338 Ga0466967_0801291 3300045976 Bacteria 935
339 Ga0466967_0893913 3300045976 Bacteria 883
340 Ga0466967_1320217 3300045976 Bacteria 718
341 Ga0466967_1551508 3300045976 Bacteria 659
342 Ga0466967_1880498 3300045976 Bacteria 595
343 Ga0466967_2135316 3300045976 Bacteria 556
344 Ga0495580_0237319 3300046472 Bacteria 1251
345 Ga0495607_0521205 3300046501 Bacteria 525
346 Ga0495624_0250051 3300046690 Bacteria 1072
347 Ga0496100_0103454 3300048903 Bacteria 1966
348 Ga0496100_0612767 3300048903 Bacteria 846
349 Ga0496102_0000013 3300048905 Bacteria 311668
350 Ga0496102_0000727 3300048905 Bacteria 32407
351 Ga0496102_0245894 3300048905 Bacteria 1687
352 Ga0496102_1290980 3300048905 Bacteria 649
353 Ga0496103_0000239 3300048906 Bacteria 53554
354 Ga0496103_0063452 3300048906 Bacteria 2301
355 Ga0496103_0192464 3300048906 Bacteria 1311
356 Ga0496104_0025620 3300048907 Bacteria 5438
357 Ga0496105_0009011 3300048908 Bacteria 7784
358 Ga0496106_0017984 3300048909 Bacteria 5227
359 Ga0496107_0022726 3300048910 Bacteria 4433
360 Ga0496108_0192131 3300048911 Bacteria 1769
361 Ga0496109_0017670 3300048912 Bacteria 6255
362 Ga0496109_1642576 3300048912 Bacteria 577
363 Ga0496110_0065709 3300048913 Bacteria 3207
364 Ga0496112_0177208 3300048915 Bacteria 2096
365 Ga0496112_0242853 3300048915 Bacteria 1753
366 Ga0496113_0086193 3300048916 Bacteria 2413
367 Ga0496113_1250334 3300048916 Bacteria 578
368 Ga0496114_0013901 3300048917 Bacteria 6453
369 Ga0496115_0476484 3300048918 Bacteria 1005
370 Ga0496116_0265734 3300048919 Bacteria 842
371 Ga0496118_0017555 3300048921 Bacteria 6506
372 Ga0496121_0262308 3300048924 Bacteria 1192
373 Ga0496126_0194298 3300048929 Bacteria 1717
374 Ga0501031_0230038 3300049568 Bacteria 1206
375 Ga0501032_0004003 3300049569 Bacteria 11175
376 Ga0501033_0616791 3300049570 Bacteria 743
377 Ga0501033_0640767 3300049570 Bacteria 726
378 Ga0501034_0053584 3300049571 Bacteria 4061
379 Ga0501036_0178764 3300049572 Bacteria 1787
380 Ga0501037_0079441 3300049573 Bacteria 2381
381 Ga0501038_0000399 3300049574 Bacteria 37785
382 Ga0501043_0011695 3300049579 Bacteria 6871
383 Ga0501047_0012995 3300049581 Bacteria 7883
384 Ga0501048_0002723 3300049582 Bacteria 13482
385 Ga0501070_0034307 3300049586 Bacteria 4243
386 Ga0501070_0422129 3300049586 Bacteria 1077
387 Ga0501074_1113212 3300049590 Bacteria 554
388 Ga0501080_1122539 3300049742 Bacteria 678
389 Ga0501080_1611392 3300049742 Bacteria 549
390 Ga0501035_0024453 3300049822 Bacteria 5539
391 Ga0501035_0267034 3300049822 Bacteria 1449
392 Ga0501044_0099703 3300049823 Bacteria 2923
393 Ga0501044_0333039 3300049823 Bacteria 1440
394 nmdc:mga0rr50_11595_c1 3300050513 Bacteria 5652
395 nmdc:mga0rr50_564633_c1 3300050513 Bacteria 969
396 nmdc:mga08x19_29812_c1 3300050514 Bacteria 3424
397 nmdc:mga0a205_12912_c1 3300050515 Bacteria 7748
398 Ga0495595_0329900 3300053084 Bacteria 769
399 Ga0587067_134531 3300059640 Bacteria 607
400 Ga0501082_0542809 3300060353 Bacteria 1017
401 Ga0466962_0001713 3300061719 Bacteria 10296
402 Ga0466962_0352541 3300061719 Bacteria 733

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0247899 Ga0466958_0247899_513_758 81
2 3300037853 Ga0436364_0808363 Ga0436364_0808363_841_1098 85
3 3300009551 Ga0105238_10220012 Ga0105238_102200122 86
4 3300009551 Ga0105238_11235545 Ga0105238_112355451 86
5 3300048915 Ga0496112_0242853 Ga0496112_0242853_1023_1283 86
6 3300048929 Ga0496126_0194298 Ga0496126_0194298_199_459 86
7 3300009093 Ga0105240_10139974 Ga0105240_101399744 89
8 3300013296 Ga0157374_10163581 Ga0157374_101635815 89
9 3300013306 Ga0163162_12118197 Ga0163162_121181971 89
10 3300044658 Ga0466972_0220276 Ga0466972_0220276_517_786 89
11 3300044706 Ga0466964_0517513 Ga0466964_0517513_167_436 89
12 3300045976 Ga0466967_0012072 Ga0466967_0012072_10_279 89
13 3300045976 Ga0466967_0625481 Ga0466967_0625481_92_361 89
14 3300045976 Ga0466967_0749122 Ga0466967_0749122_624_893 89
15 3300045976 Ga0466967_1551508 Ga0466967_1551508_155_424 89
16 3300048916 Ga0496113_0086193 Ga0496113_0086193_2110_2379 89
17 3300045976 Ga0466967_0893913 Ga0466967_0893913_176_448 90
18 3300045976 Ga0466967_2135316 Ga0466967_2135316_248_520 90
19 3300005985 Ga0081539_10185474 Ga0081539_101854741 97
20 3300020078 Ga0206352_10839149 Ga0206352_108391492 98
21 3300025934 Ga0207686_10183684 Ga0207686_101836843 98
22 3300001989 JGI24739J22299_10214000 JGI24739J22299_102140002 99
23 3300003659 JGI25404J52841_10108483 JGI25404J52841_101084832 99
24 3300005328 Ga0070676_10623199 Ga0070676_106231992 99
25 3300005329 Ga0070683_100886775 Ga0070683_1008867752 99
26 3300005330 Ga0070690_100039220 Ga0070690_1000392203 99
27 3300005334 Ga0068869_100110406 Ga0068869_1001104062 99
28 3300005335 Ga0070666_10066807 Ga0070666_100668071 99
29 3300005335 Ga0070666_10137693 Ga0070666_101376932 99
30 3300005336 Ga0070680_100684024 Ga0070680_1006840242 99
31 3300005337 Ga0070682_100155589 Ga0070682_1001555891 99
32 3300005338 Ga0068868_100056468 Ga0068868_1000564682 99
33 3300005338 Ga0068868_102400112 Ga0068868_1024001122 99
34 3300005339 Ga0070660_100043396 Ga0070660_1000433962 99
35 3300005340 Ga0070689_100192076 Ga0070689_1001920762 99
36 3300005341 Ga0070691_10038038 Ga0070691_100380382 99
37 3300005343 Ga0070687_100118299 Ga0070687_1001182992 99
38 3300005347 Ga0070668_100166870 Ga0070668_1001668703 99
39 3300005353 Ga0070669_100118996 Ga0070669_1001189963 99
40 3300005353 Ga0070669_100456610 Ga0070669_1004566101 99
41 3300005355 Ga0070671_100079784 Ga0070671_1000797841 99
42 3300005356 Ga0070674_100051460 Ga0070674_1000514604 99
43 3300005364 Ga0070673_100389799 Ga0070673_1003897992 99
44 3300005366 Ga0070659_100764744 Ga0070659_1007647442 99
45 3300005367 Ga0070667_100025482 Ga0070667_1000254824 99
46 3300005367 Ga0070667_100083698 Ga0070667_1000836984 99
47 3300005434 Ga0070709_10240639 Ga0070709_102406393 99
48 3300005435 Ga0070714_100043638 Ga0070714_1000436384 99
49 3300005435 Ga0070714_101059414 Ga0070714_1010594142 99
50 3300005435 Ga0070714_101588573 Ga0070714_1015885731 99
51 3300005436 Ga0070713_100207999 Ga0070713_1002079993 99
52 3300005436 Ga0070713_100451233 Ga0070713_1004512332 99
53 3300005437 Ga0070710_10033219 Ga0070710_100332193 99
54 3300005438 Ga0070701_10155678 Ga0070701_101556782 99
55 3300005439 Ga0070711_100061353 Ga0070711_1000613533 99
56 3300005441 Ga0070700_100779604 Ga0070700_1007796042 99
57 3300005444 Ga0070694_100123216 Ga0070694_1001232162 99
58 3300005455 Ga0070663_100334396 Ga0070663_1003343962 99
59 3300005455 Ga0070663_100871406 Ga0070663_1008714062 99
60 3300005456 Ga0070678_100096135 Ga0070678_1000961352 99
61 3300005458 Ga0070681_10611974 Ga0070681_106119742 99
62 3300005458 Ga0070681_11686540 Ga0070681_116865401 99
63 3300005459 Ga0068867_100714153 Ga0068867_1007141531 99
64 3300005466 Ga0070685_10993516 Ga0070685_109935161 99
65 3300005467 Ga0070706_101121590 Ga0070706_1011215901 99
66 3300005471 Ga0070698_101431485 Ga0070698_1014314851 99
67 3300005530 Ga0070679_100357079 Ga0070679_1003570792 99
68 3300005535 Ga0070684_101002946 Ga0070684_1010029462 99
69 3300005536 Ga0070697_100433471 Ga0070697_1004334711 99
70 3300005539 Ga0068853_100063660 Ga0068853_1000636605 99
71 3300005539 Ga0068853_101656731 Ga0068853_1016567312 99
72 3300005543 Ga0070672_100490278 Ga0070672_1004902782 99
73 3300005544 Ga0070686_100065624 Ga0070686_1000656244 99
74 3300005546 Ga0070696_100074305 Ga0070696_1000743053 99
75 3300005547 Ga0070693_100012097 Ga0070693_1000120974 99
76 3300005548 Ga0070665_100056155 Ga0070665_1000561556 99
77 3300005548 Ga0070665_100739222 Ga0070665_1007392221 99
78 3300005549 Ga0070704_100134832 Ga0070704_1001348322 99
79 3300005563 Ga0068855_100021593 Ga0068855_10002159311 99
80 3300005563 Ga0068855_100098364 Ga0068855_1000983645 99
81 3300005563 Ga0068855_100695128 Ga0068855_1006951282 99
82 3300005564 Ga0070664_100042499 Ga0070664_1000424997 99
83 3300005577 Ga0068857_100052368 Ga0068857_1000523686 99
84 3300005614 Ga0068856_100047448 Ga0068856_1000474481 99
85 3300005614 Ga0068856_100097110 Ga0068856_1000971102 99
86 3300005615 Ga0070702_100018120 Ga0070702_1000181204 99
87 3300005616 Ga0068852_100313876 Ga0068852_1003138764 99
88 3300005617 Ga0068859_100001814 Ga0068859_10000181422 99
89 3300005617 Ga0068859_100215421 Ga0068859_1002154215 99
90 3300005618 Ga0068864_100263293 Ga0068864_1002632934 99
91 3300005718 Ga0068866_10103458 Ga0068866_101034582 99
92 3300005719 Ga0068861_100073897 Ga0068861_1000738974 99
93 3300005834 Ga0068851_10126447 Ga0068851_101264474 99
94 3300005841 Ga0068863_100015970 Ga0068863_1000159703 99
95 3300005841 Ga0068863_100310929 Ga0068863_1003109292 99
96 3300005842 Ga0068858_100031845 Ga0068858_1000318455 99
97 3300005842 Ga0068858_100261044 Ga0068858_1002610442 99
98 3300005843 Ga0068860_100000114 Ga0068860_100000114120 99
99 3300005843 Ga0068860_101687201 Ga0068860_1016872012 99
100 3300005844 Ga0068862_100139496 Ga0068862_1001394962 99
101 3300005983 Ga0081540_1008747 Ga0081540_10087477 99
102 3300006028 Ga0070717_10153525 Ga0070717_101535252 99
103 3300006173 Ga0070716_100007509 Ga0070716_1000075093 99
104 3300006173 Ga0070716_100935874 Ga0070716_1009358742 99
105 3300006175 Ga0070712_100062926 Ga0070712_1000629263 99
106 3300006175 Ga0070712_100491057 Ga0070712_1004910572 99
107 3300006237 Ga0097621_100027356 Ga0097621_1000273563 99
108 3300006358 Ga0068871_100802458 Ga0068871_1008024581 99
109 3300006852 Ga0075433_10019681 Ga0075433_100196814 99
110 3300006881 Ga0068865_100167848 Ga0068865_1001678482 99
111 3300006914 Ga0075436_100196571 Ga0075436_1001965712 99
112 3300006914 Ga0075436_101082314 Ga0075436_1010823141 99
113 3300006931 Ga0097620_100001814 Ga0097620_10000181422 99
114 3300006931 Ga0097620_100215431 Ga0097620_1002154315 99
115 3300007076 Ga0075435_100131381 Ga0075435_1001313815 99
116 3300007076 Ga0075435_100611882 Ga0075435_1006118822 99
117 3300009011 Ga0105251_10208901 Ga0105251_102089012 99
118 3300009092 Ga0105250_10186504 Ga0105250_101865041 99
119 3300009093 Ga0105240_10018411 Ga0105240_100184115 99
120 3300009093 Ga0105240_10157867 Ga0105240_101578675 99
121 3300009093 Ga0105240_10578577 Ga0105240_105785771 99
122 3300009094 Ga0111539_10088850 Ga0111539_100888504 99
123 3300009101 Ga0105247_10005186 Ga0105247_1000518610 99
124 3300009101 Ga0105247_10282207 Ga0105247_102822072 99
125 3300009148 Ga0105243_10027780 Ga0105243_100277806 99
126 3300009174 Ga0105241_10120464 Ga0105241_101204644 99
127 3300009176 Ga0105242_10303911 Ga0105242_103039114 99
128 3300009177 Ga0105248_10031838 Ga0105248_100318387 99
129 3300009177 Ga0105248_11057242 Ga0105248_110572422 99
130 3300009545 Ga0105237_10043626 Ga0105237_100436264 99
131 3300009545 Ga0105237_10102967 Ga0105237_101029672 99
132 3300009545 Ga0105237_11048878 Ga0105237_110488782 99
133 3300009551 Ga0105238_10438226 Ga0105238_104382262 99
134 3300009551 Ga0105238_11865196 Ga0105238_118651962 99
135 3300009553 Ga0105249_10065215 Ga0105249_100652153 99
136 3300010375 Ga0105239_10011539 Ga0105239_100115399 99
137 3300013104 Ga0157370_10867901 Ga0157370_108679012 99
138 3300013105 Ga0157369_10649843 Ga0157369_106498432 99
139 3300013105 Ga0157369_11703293 Ga0157369_117032932 99
140 3300013105 Ga0157369_12031485 Ga0157369_120314852 99
141 3300013296 Ga0157374_10261535 Ga0157374_102615355 99
142 3300013296 Ga0157374_11581473 Ga0157374_115814732 99
143 3300013297 Ga0157378_10046006 Ga0157378_100460062 99
144 3300013306 Ga0163162_10031688 Ga0163162_100316885 99
145 3300013307 Ga0157372_10876019 Ga0157372_108760192 99
146 3300013307 Ga0157372_11996024 Ga0157372_119960243 99
147 3300014325 Ga0163163_10059004 Ga0163163_100590044 99
148 3300014325 Ga0163163_10567072 Ga0163163_105670722 99
149 3300014326 Ga0157380_10086680 Ga0157380_100866802 99
150 3300014745 Ga0157377_10158722 Ga0157377_101587223 99
151 3300014968 Ga0157379_10137611 Ga0157379_101376112 99
152 3300014968 Ga0157379_10191388 Ga0157379_101913884 99
153 3300014968 Ga0157379_10754976 Ga0157379_107549762 99
154 3300014969 Ga0157376_10013982 Ga0157376_100139826 99
155 3300017792 Ga0163161_10008261 Ga0163161_1000826110 99
156 3300020069 Ga0197907_10459964 Ga0197907_104599642 99
157 3300020069 Ga0197907_10533094 Ga0197907_105330942 99
158 3300020069 Ga0197907_11009689 Ga0197907_110096891 99
159 3300020069 Ga0197907_11222175 Ga0197907_112221753 99
160 3300020070 Ga0206356_10162526 Ga0206356_101625263 99
161 3300020077 Ga0206351_10238902 Ga0206351_102389021 99
162 3300020080 Ga0206350_10360878 Ga0206350_103608782 99
163 3300020080 Ga0206350_10513969 Ga0206350_105139694 99
164 3300020080 Ga0206350_10589506 Ga0206350_105895064 99
165 3300020081 Ga0206354_10306350 Ga0206354_103063502 99
166 3300020081 Ga0206354_10795613 Ga0206354_107956132 99
167 3300020081 Ga0206354_10995898 Ga0206354_109958982 99
168 3300020081 Ga0206354_11004522 Ga0206354_110045222 99
169 3300020082 Ga0206353_10845988 Ga0206353_108459883 99
170 3300020082 Ga0206353_11256512 Ga0206353_112565123 99
171 3300020082 Ga0206353_11788172 Ga0206353_117881724 99
172 3300020610 Ga0154015_1147703 Ga0154015_11477031 99
173 3300020610 Ga0154015_1304045 Ga0154015_13040451 99
174 3300020610 Ga0154015_1337719 Ga0154015_13377191 99
175 3300022467 Ga0224712_10008632 Ga0224712_100086325 99
176 3300022467 Ga0224712_10052787 Ga0224712_100527874 99
177 3300025321 Ga0207656_10638439 Ga0207656_106384392 99
178 3300025735 Ga0207713_1118618 Ga0207713_11186182 99
179 3300025885 Ga0207653_10030595 Ga0207653_100305952 99
180 3300025898 Ga0207692_10124600 Ga0207692_101246004 99
181 3300025899 Ga0207642_10028631 Ga0207642_100286312 99
182 3300025900 Ga0207710_10006182 Ga0207710_100061826 99
183 3300025900 Ga0207710_10267724 Ga0207710_102677242 99
184 3300025901 Ga0207688_10005912 Ga0207688_1000591210 99
185 3300025903 Ga0207680_10017231 Ga0207680_100172313 99
186 3300025903 Ga0207680_10396733 Ga0207680_103967332 99
187 3300025904 Ga0207647_10154039 Ga0207647_101540392 99
188 3300025904 Ga0207647_10327549 Ga0207647_103275492 99
189 3300025904 Ga0207647_10338426 Ga0207647_103384262 99
190 3300025904 Ga0207647_10446523 Ga0207647_104465232 99
191 3300025907 Ga0207645_10780334 Ga0207645_107803341 99
192 3300025908 Ga0207643_10046453 Ga0207643_100464532 99
193 3300025911 Ga0207654_10127722 Ga0207654_101277222 99
194 3300025913 Ga0207695_10075644 Ga0207695_100756445 99
195 3300025914 Ga0207671_10065014 Ga0207671_100650143 99
196 3300025914 Ga0207671_10531010 Ga0207671_105310101 99
197 3300025915 Ga0207693_10000970 Ga0207693_100009703 99
198 3300025915 Ga0207693_10589538 Ga0207693_105895382 99
199 3300025916 Ga0207663_10452761 Ga0207663_104527613 99
200 3300025919 Ga0207657_10002184 Ga0207657_1000218413 99
201 3300025923 Ga0207681_10067966 Ga0207681_100679663 99
202 3300025923 Ga0207681_10502428 Ga0207681_105024283 99
203 3300025924 Ga0207694_10429861 Ga0207694_104298611 99
204 3300025927 Ga0207687_10027450 Ga0207687_100274503 99
205 3300025927 Ga0207687_10079873 Ga0207687_100798733 99
206 3300025928 Ga0207700_10190178 Ga0207700_101901781 99
207 3300025928 Ga0207700_10412759 Ga0207700_104127593 99
208 3300025929 Ga0207664_10087764 Ga0207664_100877645 99
209 3300025929 Ga0207664_11025889 Ga0207664_110258892 99
210 3300025929 Ga0207664_11328273 Ga0207664_113282731 99
211 3300025931 Ga0207644_10047373 Ga0207644_100473732 99
212 3300025931 Ga0207644_10205245 Ga0207644_102052451 99
213 3300025932 Ga0207690_10051975 Ga0207690_100519753 99
214 3300025933 Ga0207706_10208574 Ga0207706_102085742 99
215 3300025934 Ga0207686_10143141 Ga0207686_101431413 99
216 3300025935 Ga0207709_11402128 Ga0207709_114021281 99
217 3300025936 Ga0207670_10323476 Ga0207670_103234762 99
218 3300025937 Ga0207669_10356904 Ga0207669_103569042 99
219 3300025939 Ga0207665_10000421 Ga0207665_1000042126 99
220 3300025940 Ga0207691_10107194 Ga0207691_101071941 99
221 3300025941 Ga0207711_10023360 Ga0207711_100233605 99
222 3300025941 Ga0207711_10713282 Ga0207711_107132821 99
223 3300025942 Ga0207689_10016884 Ga0207689_100168844 99
224 3300025945 Ga0207679_10138174 Ga0207679_101381742 99
225 3300025949 Ga0207667_10028583 Ga0207667_100285836 99
226 3300025949 Ga0207667_11724425 Ga0207667_117244252 99
227 3300025961 Ga0207712_10111116 Ga0207712_101111162 99
228 3300025972 Ga0207668_10039123 Ga0207668_100391233 99
229 3300025981 Ga0207640_10179752 Ga0207640_101797524 99
230 3300025986 Ga0207658_10185133 Ga0207658_101851331 99
231 3300026023 Ga0207677_10019752 Ga0207677_100197526 99
232 3300026035 Ga0207703_10056803 Ga0207703_100568033 99
233 3300026035 Ga0207703_10413179 Ga0207703_104131793 99
234 3300026041 Ga0207639_10113950 Ga0207639_101139503 99
235 3300026067 Ga0207678_10017846 Ga0207678_100178464 99
236 3300026067 Ga0207678_10290677 Ga0207678_102906772 99
237 3300026075 Ga0207708_10000002 Ga0207708_10000002381 99
238 3300026075 Ga0207708_10011092 Ga0207708_100110922 99
239 3300026078 Ga0207702_10094255 Ga0207702_100942552 99
240 3300026078 Ga0207702_10125942 Ga0207702_101259422 99
241 3300026088 Ga0207641_10051452 Ga0207641_100514523 99
242 3300026088 Ga0207641_10372089 Ga0207641_103720892 99
243 3300026095 Ga0207676_10060893 Ga0207676_100608936 99
244 3300026116 Ga0207674_10485446 Ga0207674_104854464 99
245 3300026118 Ga0207675_100023881 Ga0207675_1000238814 99
246 3300026121 Ga0207683_10160117 Ga0207683_101601173 99
247 3300026142 Ga0207698_10427009 Ga0207698_104270092 99
248 3300026142 Ga0207698_11817396 Ga0207698_118173962 99
249 3300026142 Ga0207698_12010081 Ga0207698_120100812 99
250 3300027907 Ga0207428_10333719 Ga0207428_103337192 99
251 3300028379 Ga0268266_10001159 Ga0268266_1000115912 99
252 3300028380 Ga0268265_10397355 Ga0268265_103973552 99
253 3300028381 Ga0268264_10000147 Ga0268264_10000147119 99
254 3300028381 Ga0268264_10087196 Ga0268264_100871962 99
255 3300034816 Ga0373930_0007047 Ga0373930_0007047_1185_1484 99
256 3300034817 Ga0373948_0154237 Ga0373948_0154237_14_313 99
257 3300034818 Ga0373950_0042826 Ga0373950_0042826_228_527 99
258 3300034819 Ga0373958_0044779 Ga0373958_0044779_19_318 99
259 3300034820 Ga0373959_0054044 Ga0373959_0054044_411_710 99
260 3300034957 Ga0373938_0071901 Ga0373938_0071901_158_457 99
261 3300035085 Ga0373929_0010165 Ga0373929_0010165_593_892 99
262 3300035088 Ga0373940_0074288 Ga0373940_0074288_518_817 99
263 3300035090 Ga0373949_0039198 Ga0373949_0039198_798_1097 99
264 3300035091 Ga0373951_0016170 Ga0373951_0016170_1337_1636 99
265 3300035092 Ga0373952_0215280 Ga0373952_0215280_168_467 99
266 3300035111 Ga0373923_0447620 Ga0373923_0447620_217_516 99
267 3300035112 Ga0373932_0081396 Ga0373932_0081396_657_956 99
268 3300035115 Ga0373941_0067306 Ga0373941_0067306_613_912 99
269 3300035120 Ga0373957_0310649 Ga0373957_0310649_231_530 99
270 3300035121 Ga0373960_0026172 Ga0373960_0026172_443_742 99
271 3300035207 Ga0373942_0037212 Ga0373942_0037212_843_1142 99
272 3300035241 Ga0373961_0065661 Ga0373961_0065661_398_697 99
273 3300035242 Ga0373962_0059548 Ga0373962_0059548_780_1079 99
274 3300035691 Ga0373931_0004236 Ga0373931_0004236_5871_6170 99
275 3300035695 Ga0373927_0187772 Ga0373927_0187772_824_1123 99
276 3300035695 Ga0373927_0706256 Ga0373927_0706256_213_512 99
277 3300037068 Ga0373925_0392746 Ga0373925_0392746_420_719 99
278 3300038443 Ga0395901_0433023 Ga0395901_0433023_577_879 99
279 3300039450 Ga0436363_1237544 Ga0436363_1237544_76_375 99
280 3300044658 Ga0466972_0119257 Ga0466972_0119257_676_975 99
281 3300044658 Ga0466972_0199008 Ga0466972_0199008_73_372 99
282 3300044658 Ga0466972_0299360 Ga0466972_0299360_17_316 99
283 3300044683 Ga0466965_0259848 Ga0466965_0259848_46_345 99
284 3300044683 Ga0466965_0552889 Ga0466965_0552889_309_608 99
285 3300044684 Ga0466966_0264582 Ga0466966_0264582_375_674 99
286 3300044684 Ga0466966_0575525 Ga0466966_0575525_313_612 99
287 3300044693 Ga0466961_0008147 Ga0466961_0008147_6323_6622 99
288 3300044693 Ga0466961_0015988 Ga0466961_0015988_718_1017 99
289 3300044693 Ga0466961_0032955 Ga0466961_0032955_183_482 99
290 3300044693 Ga0466961_0101346 Ga0466961_0101346_326_625 99
291 3300044693 Ga0466961_0524030 Ga0466961_0524030_238_537 99
292 3300044694 Ga0466963_0027036 Ga0466963_0027036_2585_2884 99
293 3300044694 Ga0466963_0042499 Ga0466963_0042499_2664_2963 99
294 3300044694 Ga0466963_0229695 Ga0466963_0229695_33_332 99
295 3300044694 Ga0466963_0280221 Ga0466963_0280221_177_476 99
296 3300044694 Ga0466963_0965987 Ga0466963_0965987_112_411 99
297 3300044706 Ga0466964_0108091 Ga0466964_0108091_50_349 99
298 3300044706 Ga0466964_0197139 Ga0466964_0197139_310_609 99
299 3300044719 Ga0466971_0115084 Ga0466971_0115084_303_602 99
300 3300044719 Ga0466971_0177396 Ga0466971_0177396_430_729 99
301 3300044765 Ga0466970_0262261 Ga0466970_0262261_37_336 99
302 3300044765 Ga0466970_0791491 Ga0466970_0791491_152_451 99
303 3300044842 Ga0466957_0005874 Ga0466957_0005874_74_373 99
304 3300044901 Ga0466960_0131144 Ga0466960_0131144_350_649 99
305 3300044901 Ga0466960_0343278 Ga0466960_0343278_294_593 99
306 3300044901 Ga0466960_0727814 Ga0466960_0727814_56_355 99
307 3300045049 Ga0466959_0028379 Ga0466959_0028379_2788_3087 99
308 3300045049 Ga0466959_0131730 Ga0466959_0131730_1119_1418 99
309 3300045049 Ga0466959_0257397 Ga0466959_0257397_559_858 99
310 3300045049 Ga0466959_0436965 Ga0466959_0436965_282_581 99
311 3300045836 Ga0466958_0003112 Ga0466958_0003112_3303_3602 99
312 3300045836 Ga0466958_0008699 Ga0466958_0008699_3573_3872 99
313 3300045836 Ga0466958_0016170 Ga0466958_0016170_1432_1731 99
314 3300045836 Ga0466958_0040292 Ga0466958_0040292_2066_2365 99
315 3300045836 Ga0466958_0217576 Ga0466958_0217576_139_438 99
316 3300045836 Ga0466958_0834455 Ga0466958_0834455_291_590 99
317 3300045976 Ga0466967_0116428 Ga0466967_0116428_1710_2009 99
318 3300045976 Ga0466967_0801291 Ga0466967_0801291_590_889 99
319 3300045976 Ga0466967_1320217 Ga0466967_1320217_277_576 99
320 3300045976 Ga0466967_1880498 Ga0466967_1880498_255_554 99
321 3300046472 Ga0495580_0237319 Ga0495580_0237319_189_488 99
322 3300046501 Ga0495607_0521205 Ga0495607_0521205_20_319 99
323 3300046690 Ga0495624_0250051 Ga0495624_0250051_199_498 99
324 3300048903 Ga0496100_0103454 Ga0496100_0103454_1072_1371 99
325 3300048903 Ga0496100_0612767 Ga0496100_0612767_409_708 99
326 3300048905 Ga0496102_0000013 Ga0496102_0000013_290021_290320 99
327 3300048905 Ga0496102_0000727 Ga0496102_0000727_12120_12419 99
328 3300048905 Ga0496102_0245894 Ga0496102_0245894_333_632 99
329 3300048905 Ga0496102_1290980 Ga0496102_1290980_194_493 99
330 3300048906 Ga0496103_0000239 Ga0496103_0000239_45865_46164 99
331 3300048906 Ga0496103_0063452 Ga0496103_0063452_249_548 99
332 3300048906 Ga0496103_0192464 Ga0496103_0192464_955_1254 99
333 3300048907 Ga0496104_0025620 Ga0496104_0025620_1713_2012 99
334 3300048908 Ga0496105_0009011 Ga0496105_0009011_3682_3981 99
335 3300048909 Ga0496106_0017984 Ga0496106_0017984_3057_3356 99
336 3300048910 Ga0496107_0022726 Ga0496107_0022726_2706_3005 99
337 3300048911 Ga0496108_0192131 Ga0496108_0192131_1406_1705 99
338 3300048912 Ga0496109_0017670 Ga0496109_0017670_4551_4850 99
339 3300048913 Ga0496110_0065709 Ga0496110_0065709_1558_1857 99
340 3300048915 Ga0496112_0177208 Ga0496112_0177208_565_864 99
341 3300048916 Ga0496113_1250334 Ga0496113_1250334_255_554 99
342 3300048917 Ga0496114_0013901 Ga0496114_0013901_4458_4757 99
343 3300048918 Ga0496115_0476484 Ga0496115_0476484_96_395 99
344 3300048919 Ga0496116_0265734 Ga0496116_0265734_186_485 99
345 3300048921 Ga0496118_0017555 Ga0496118_0017555_2913_3212 99
346 3300048924 Ga0496121_0262308 Ga0496121_0262308_381_680 99
347 3300049568 Ga0501031_0230038 Ga0501031_0230038_531_830 99
348 3300049569 Ga0501032_0004003 Ga0501032_0004003_10253_10552 99
349 3300049570 Ga0501033_0616791 Ga0501033_0616791_117_416 99
350 3300049570 Ga0501033_0640767 Ga0501033_0640767_58_357 99
351 3300049571 Ga0501034_0053584 Ga0501034_0053584_2812_3111 99
352 3300049572 Ga0501036_0178764 Ga0501036_0178764_1390_1689 99
353 3300049573 Ga0501037_0079441 Ga0501037_0079441_655_954 99
354 3300049574 Ga0501038_0000399 Ga0501038_0000399_27464_27763 99
355 3300049579 Ga0501043_0011695 Ga0501043_0011695_633_932 99
356 3300049581 Ga0501047_0012995 Ga0501047_0012995_7527_7826 99
357 3300049582 Ga0501048_0002723 Ga0501048_0002723_7387_7686 99
358 3300049586 Ga0501070_0034307 Ga0501070_0034307_192_491 99
359 3300049586 Ga0501070_0422129 Ga0501070_0422129_628_927 99
360 3300049590 Ga0501074_1113212 Ga0501074_1113212_165_464 99
361 3300049742 Ga0501080_1122539 Ga0501080_1122539_100_399 99
362 3300049742 Ga0501080_1611392 Ga0501080_1611392_107_406 99
363 3300049822 Ga0501035_0024453 Ga0501035_0024453_1693_1992 99
364 3300049822 Ga0501035_0267034 Ga0501035_0267034_241_540 99
365 3300049823 Ga0501044_0099703 Ga0501044_0099703_2485_2784 99
366 3300049823 Ga0501044_0333039 Ga0501044_0333039_592_891 99
367 3300050513 nmdc:mga0rr50_11595_c1 nmdc:mga0rr50_11595_c1_1252_1551 99
368 3300050513 nmdc:mga0rr50_564633_c1 nmdc:mga0rr50_564633_c1_180_482 99
369 3300050514 nmdc:mga08x19_29812_c1 nmdc:mga08x19_29812_c1_744_1043 99
370 3300050515 nmdc:mga0a205_12912_c1 nmdc:mga0a205_12912_c1_3033_3332 99
371 3300053084 Ga0495595_0329900 Ga0495595_0329900_205_504 99
372 3300060353 Ga0501082_0542809 Ga0501082_0542809_585_884 99
373 3300061719 Ga0466962_0001713 Ga0466962_0001713_9968_10267 99
374 3300001979 JGI24740J21852_10123441 JGI24740J21852_101234411 100
375 3300002067 JGI24735J21928_10018243 JGI24735J21928_100182432 100
376 3300005435 Ga0070714_100000007 Ga0070714_100000007224 100
377 3300005578 Ga0068854_100375707 Ga0068854_1003757074 100
378 3300005616 Ga0068852_100026447 Ga0068852_1000264475 100
379 3300009093 Ga0105240_10012953 Ga0105240_1001295314 100
380 3300009098 Ga0105245_10012924 Ga0105245_100129249 100
381 3300009174 Ga0105241_11210950 Ga0105241_112109502 100
382 3300009545 Ga0105237_12182923 Ga0105237_121829232 100
383 3300013104 Ga0157370_10063337 Ga0157370_100633373 100
384 3300013297 Ga0157378_10307075 Ga0157378_103070751 100
385 3300013307 Ga0157372_11340087 Ga0157372_113400872 100
386 3300025909 Ga0207705_10605472 Ga0207705_106054722 100
387 3300025913 Ga0207695_10069000 Ga0207695_100690007 100
388 3300025924 Ga0207694_10084737 Ga0207694_100847373 100
389 3300025929 Ga0207664_10000014 Ga0207664_100000148 100
390 3300025981 Ga0207640_10403138 Ga0207640_104031384 100
391 3300026078 Ga0207702_12346957 Ga0207702_123469571 100
392 3300026116 Ga0207674_10897041 Ga0207674_108970412 100
393 3300026142 Ga0207698_10035745 Ga0207698_100357455 100
394 3300026142 Ga0207698_10254895 Ga0207698_102548952 100
395 3300044684 Ga0466966_0351655 Ga0466966_0351655_44_346 100
396 3300044684 Ga0466966_0908513 Ga0466966_0908513_25_327 100
397 3300044693 Ga0466961_0396013 Ga0466961_0396013_472_774 100
398 3300044694 Ga0466963_0418359 Ga0466963_0418359_112_414 100
399 3300045976 Ga0466967_0629737 Ga0466967_0629737_298_600 100
400 3300048912 Ga0496109_1642576 Ga0496109_1642576_132_434 100
401 3300059640 Ga0587067_134531 Ga0587067_134531_286_597 100
402 3300061719 Ga0466962_0352541 Ga0466962_0352541_125_427 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07210

DUF1416

Protein of unknown function (DUF1416)

2

95

0.97

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

22

92

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hif-assembly1.cif.gz_Y kuenenia stuttgartiensis hydrazine dehydrogenase complex 0.9008 18 99
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.8842 19 99
4p0d-assembly1.cif.gz_A the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions 0.8763 20 87
6fwv-assembly1.cif.gz_A the bacillus anthracis tie protein 0.8605 19 98
1qmu-assembly1.cif.gz_A duck carboxypeptidase d domain ii 0.8547 19 100
ID Description Score Start End Superfamily
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9831 24 100 2.60.40.1120
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9587 24 100 2.60.40.1120
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9163 23 99 2.60.40.1120
af_Q9JHW1_795_903_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8957 23 99 2.60.40.1120
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8868 23 99 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A7I7X584-F1-model_v4 DUF1416 domain-containing protein 0.9826 23 100
AF-W7SLE8-F1-model_v4 alpha-amylase (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) 0.9664 20 99 GO:0004556
GO:0005886
GO:0005975
GO:0022857
GO:0030246
AF-H6RCW9-F1-model_v4 Sulphur metabolism protein 0.9663 15 100
AF-A0A7J9WU56-F1-model_v4 DUF1416 domain-containing protein 0.9635 20 100
AF-A0A1H1WHE2-F1-model_v4 Drug resistance transporter, EmrB/QacA subfamily 0.9628 20 99 GO:0005886
GO:0005975
GO:0022857

Feature Viewer

pLDDT pTM Quality
92.36 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map