F434969

General Info

Members Datasets Scaffolds Average Seq Length
401 182 802 110

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_81153_c1|nmdc:mga08y16_81153_c1_2966_3349
Length 127
Sequence VSRRRPHGNDFIDKETHMGMLDGLLGGIVGAGMVSVVNSVIEKHGGLQGVVSEFEKNGLGATVKSWVGTGPNQAISPDEVHRALGPDLLQQLSAKSGLSVQELTQKLAQVLPQAVDKLTPDGAIPKA

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.73
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 32.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_81153_c1 3300050511 Bacteria 3381
2 Ga0065714_10522771 3300005288 Bacteria 512
3 Ga0065704_10521997 3300005289 Unclassified 635
4 Ga0065712_10071391 3300005290 Bacteria 5297
5 Ga0065712_10188808 3300005290 Bacteria 1157
6 Ga0065715_10128716 3300005293 Bacteria 2060
7 Ga0065715_10166834 3300005293 Bacteria 1579
8 Ga0065715_10298319 3300005293 Bacteria 1047
9 Ga0065715_10515450 3300005293 Bacteria 768
10 Ga0065715_10540626 3300005293 Bacteria 748
11 Ga0065715_11095746 3300005293 Unclassified 521
12 Ga0065707_10023042 3300005295 Bacteria 1614
13 Ga0065707_10134858 3300005295 Bacteria 1859
14 Ga0065707_10391760 3300005295 Bacteria 821
15 Ga0065707_10554345 3300005295 Bacteria 719
16 Ga0070683_100033553 3300005329 Unclassified 4682
17 Ga0070683_100049127 3300005329 Bacteria 3901
18 Ga0070690_100560783 3300005330 Unclassified 862
19 Ga0070690_101479159 3300005330 Unclassified 548
20 Ga0070670_100029779 3300005331 Bacteria 4702
21 Ga0070670_100192851 3300005331 Bacteria 1770
22 Ga0070670_100619557 3300005331 Unclassified 969
23 Ga0070670_101920154 3300005331 Bacteria 545
24 Ga0070677_10791316 3300005333 Bacteria 541
25 Ga0068869_101140449 3300005334 Unclassified 683
26 Ga0070666_10013459 3300005335 Bacteria 5192
27 Ga0070666_10229756 3300005335 Unclassified 1310
28 Ga0070666_10381002 3300005335 Unclassified 1012
29 Ga0070680_101243354 3300005336 Unclassified 644
30 Ga0068868_101454538 3300005338 Unclassified 640
31 Ga0068868_101960610 3300005338 Unclassified 555
32 Ga0068868_102179747 3300005338 Unclassified 528
33 Ga0070689_100075713 3300005340 Bacteria 2636
34 Ga0070689_100533725 3300005340 Bacteria 1009
35 Ga0070689_102045559 3300005340 Bacteria 524
36 Ga0070687_100474217 3300005343 Bacteria 837
37 Ga0070661_100097131 3300005344 Bacteria 2187
38 Ga0070669_100003044 3300005353 Bacteria 12063
39 Ga0070669_100975124 3300005353 Unclassified 726
40 Ga0070669_102013410 3300005353 Unclassified 505
41 Ga0070675_100000189 3300005354 Bacteria 38620
42 Ga0070675_100000508 3300005354 Bacteria 26609
43 Ga0070675_100076685 3300005354 Bacteria 2781
44 Ga0070675_100097211 3300005354 Unclassified 2475
45 Ga0070675_100437560 3300005354 Bacteria 1171
46 Ga0070671_100029809 3300005355 Bacteria 4501
47 Ga0070671_100266438 3300005355 Unclassified 1456
48 Ga0070673_100605886 3300005364 Bacteria 999
49 Ga0070673_101076562 3300005364 Unclassified 750
50 Ga0070673_101269114 3300005364 Unclassified 691
51 Ga0070673_101295736 3300005364 Unclassified 684
52 Ga0070688_100917401 3300005365 Bacteria 692
53 Ga0070659_101680581 3300005366 Bacteria 568
54 Ga0070667_100273540 3300005367 Bacteria 1515
55 Ga0070667_100625289 3300005367 Bacteria 993
56 Ga0070701_10124312 3300005438 Bacteria 1458
57 Ga0070701_10765852 3300005438 Unclassified 655
58 Ga0070711_101424043 3300005439 Unclassified 603
59 Ga0070700_100143605 3300005441 Bacteria 1625
60 Ga0070700_100178732 3300005441 Bacteria 1475
61 Ga0070694_101725820 3300005444 Unclassified 533
62 Ga0070708_100463083 3300005445 Bacteria 1196
63 Ga0070708_100521141 3300005445 Bacteria 1121
64 Ga0070708_102039885 3300005445 Bacteria 531
65 Ga0070663_100072660 3300005455 Unclassified 2507
66 Ga0070663_101585590 3300005455 Unclassified 583
67 Ga0070678_100078177 3300005456 Bacteria 2498
68 Ga0070678_100456161 3300005456 Bacteria 1120
69 Ga0070662_100408087 3300005457 Bacteria 1122
70 Ga0070662_101215296 3300005457 Unclassified 648
71 Ga0068867_100142157 3300005459 Unclassified 1877
72 Ga0068867_100644174 3300005459 Unclassified 929
73 Ga0070685_10199951 3300005466 Bacteria 1298
74 Ga0070685_10290060 3300005466 Bacteria 1099
75 Ga0070685_10830262 3300005466 Bacteria 683
76 Ga0070706_101388210 3300005467 Unclassified 643
77 Ga0070707_101283755 3300005468 Unclassified 698
78 Ga0070698_100108292 3300005471 Bacteria 2746
79 Ga0070698_100229431 3300005471 Bacteria 1790
80 Ga0070698_100326683 3300005471 Unclassified 1465
81 Ga0070698_100333206 3300005471 Bacteria 1449
82 Ga0070699_100233252 3300005518 Bacteria 1641
83 Ga0070699_100514318 3300005518 Unclassified 1088
84 Ga0070699_101986257 3300005518 Unclassified 532
85 Ga0070684_100002832 3300005535 Bacteria 12882
86 Ga0070684_100099172 3300005535 Unclassified 2599
87 Ga0070697_100016754 3300005536 Bacteria 5764
88 Ga0070697_100331190 3300005536 Bacteria 1313
89 Ga0070672_100059727 3300005543 Bacteria 3000
90 Ga0070672_100260924 3300005543 Bacteria 1461
91 Ga0070672_100630043 3300005543 Bacteria 936
92 Ga0070686_100876207 3300005544 Bacteria 729
93 Ga0070686_100958957 3300005544 Bacteria 699
94 Ga0070686_101083507 3300005544 Bacteria 661
95 Ga0070686_101220726 3300005544 Unclassified 625
96 Ga0070695_100798348 3300005545 Bacteria 756
97 Ga0070696_100272179 3300005546 Bacteria 1288
98 Ga0070665_100000623 3300005548 Bacteria 48311
99 Ga0070665_100415493 3300005548 Bacteria 1354
100 Ga0070704_100286496 3300005549 Bacteria 1367
101 Ga0068855_101229569 3300005563 Bacteria 778
102 Ga0070664_100005096 3300005564 Bacteria 10540
103 Ga0070664_100037291 3300005564 Bacteria 4086
104 Ga0070664_102399560 3300005564 Unclassified 500
105 Ga0068857_100129408 3300005577 Bacteria 2276
106 Ga0068852_101189327 3300005616 Bacteria 783
107 Ga0068859_100020430 3300005617 Bacteria 6647
108 Ga0068859_100398574 3300005617 Unclassified 1472
109 Ga0068864_100108105 3300005618 Bacteria 2475
110 Ga0068864_100172485 3300005618 Bacteria 1973
111 Ga0068864_100205193 3300005618 Bacteria 1812
112 Ga0068864_101344670 3300005618 Unclassified 715
113 Ga0068861_100486507 3300005719 Bacteria 1113
114 Ga0068863_100019348 3300005841 Bacteria 6512
115 Ga0068858_100005842 3300005842 Bacteria 12022
116 Ga0068858_100020763 3300005842 Bacteria 6137
117 Ga0068858_100032991 3300005842 Bacteria 4809
118 Ga0068858_102204183 3300005842 Bacteria 545
119 Ga0068860_100009477 3300005843 Bacteria 9669
120 Ga0068860_101828401 3300005843 Bacteria 629
121 Ga0068860_102042212 3300005843 Unclassified 595
122 Ga0068862_100073178 3300005844 Bacteria 2962
123 Ga0068862_101359011 3300005844 Unclassified 713
124 Ga0097621_100001140 3300006237 Bacteria 18437
125 Ga0097621_100051421 3300006237 Bacteria 3354
126 Ga0097621_100054453 3300006237 Bacteria 3263
127 Ga0097621_100057404 3300006237 Bacteria 3183
128 Ga0097621_100099717 3300006237 Bacteria 2442
129 Ga0097621_101109968 3300006237 Unclassified 743
130 Ga0068871_100006462 3300006358 Bacteria 8294
131 Ga0068871_100007813 3300006358 Bacteria 7660
132 Ga0068871_100081324 3300006358 Bacteria 2684
133 Ga0068871_100225354 3300006358 Bacteria 1625
134 Ga0068871_100944833 3300006358 Bacteria 801
135 Ga0068871_101451289 3300006358 Bacteria 647
136 Ga0068871_101603706 3300006358 Unclassified 616
137 Ga0075428_100013110 3300006844 Bacteria 9219
138 Ga0075428_100046795 3300006844 Bacteria 4751
139 Ga0075428_100046835 3300006844 Bacteria 4749
140 Ga0075428_102479539 3300006844 Unclassified 531
141 Ga0075431_100567170 3300006847 Bacteria 1121
142 Ga0075431_100736086 3300006847 Unclassified 962
143 Ga0075431_101147355 3300006847 Bacteria 741
144 Ga0075433_10043470 3300006852 Bacteria 3900
145 Ga0075433_10263265 3300006852 Unclassified 1528
146 Ga0075433_10271322 3300006852 Bacteria 1503
147 Ga0075433_10585796 3300006852 Unclassified 980
148 Ga0075433_11455502 3300006852 Bacteria 592
149 Ga0075434_100059576 3300006871 Bacteria 3796
150 Ga0075434_100164065 3300006871 Bacteria 2242
151 Ga0075434_100294118 3300006871 Unclassified 1644
152 Ga0075434_100340799 3300006871 Bacteria 1520
153 Ga0075434_101027414 3300006871 Bacteria 838
154 Ga0075434_101298613 3300006871 Unclassified 739
155 Ga0075434_101944584 3300006871 Bacteria 594
156 Ga0075429_100316793 3300006880 Bacteria 1365
157 Ga0075429_100344820 3300006880 Bacteria 1304
158 Ga0075429_100620481 3300006880 Bacteria 947
159 Ga0068865_100029962 3300006881 Bacteria 3615
160 Ga0068865_101742398 3300006881 Unclassified 562
161 Ga0075436_100394692 3300006914 Bacteria 1002
162 Ga0075436_100482658 3300006914 Bacteria 905
163 Ga0075436_100605807 3300006914 Bacteria 807
164 Ga0097620_100020430 3300006931 Bacteria 6647
165 Ga0097620_100398606 3300006931 Unclassified 1472
166 Ga0075435_100007106 3300007076 Bacteria 7951
167 Ga0075435_100091390 3300007076 Bacteria 2512
168 Ga0075435_100839773 3300007076 Unclassified 800
169 Ga0105240_11531300 3300009093 Unclassified 699
170 Ga0111539_10029166 3300009094 Bacteria 6726
171 Ga0111539_10033951 3300009094 Bacteria 6190
172 Ga0111539_10062848 3300009094 Bacteria 4394
173 Ga0111539_10681158 3300009094 Bacteria 1197
174 Ga0111539_11448801 3300009094 Bacteria 796
175 Ga0105247_10047382 3300009101 Bacteria 2639
176 Ga0105247_10442916 3300009101 Bacteria 935
177 Ga0114129_10005934 3300009147 Bacteria 17288
178 Ga0114129_10013616 3300009147 Bacteria 11587
179 Ga0114129_10074618 3300009147 Bacteria 4725
180 Ga0114129_10417299 3300009147 Bacteria 1766
181 Ga0114129_12399985 3300009147 Unclassified 632
182 Ga0105243_10368895 3300009148 Unclassified 1324
183 Ga0105241_10690577 3300009174 Bacteria 931
184 Ga0105242_10001902 3300009176 Bacteria 16407
185 Ga0105242_10034987 3300009176 Archaea 4028
186 Ga0105242_12162255 3300009176 Unclassified 601
187 Ga0105242_12846496 3300009176 Unclassified 534
188 Ga0105248_10105178 3300009177 Bacteria 3182
189 Ga0105248_10326219 3300009177 Bacteria 1729
190 Ga0105248_10438575 3300009177 Bacteria 1471
191 Ga0105248_10478609 3300009177 Bacteria 1403
192 Ga0105237_10117108 3300009545 Bacteria 2658
193 Ga0105249_10147271 3300009553 Bacteria 2263
194 Ga0105249_10905239 3300009553 Bacteria 949
195 Ga0105246_10314867 3300011119 Bacteria 1269
196 Ga0105246_10320898 3300011119 Bacteria 1258
197 Ga0105246_10812805 3300011119 Bacteria 830
198 Ga0105246_10915152 3300011119 Bacteria 788
199 Ga0157374_10145392 3300013296 Unclassified 2303
200 Ga0157374_12287632 3300013296 Bacteria 568
201 Ga0157378_10033180 3300013297 Unclassified 4563
202 Ga0163162_10044269 3300013306 Unclassified 4458
203 Ga0163162_12854632 3300013306 Unclassified 556
204 Ga0157375_10900047 3300013308 Unclassified 1029
205 Ga0163163_10148111 3300014325 Bacteria 2391
206 Ga0163163_10215879 3300014325 Unclassified 1967
207 Ga0157380_10494363 3300014326 Bacteria 1187
208 Ga0157380_10672167 3300014326 Bacteria 1036
209 Ga0157377_10098857 3300014745 Bacteria 1735
210 Ga0157377_10620342 3300014745 Bacteria 774
211 Ga0157377_11302660 3300014745 Unclassified 568
212 Ga0157377_11560145 3300014745 Unclassified 527
213 Ga0157379_10041751 3300014968 Unclassified 4094
214 Ga0157379_10197835 3300014968 Bacteria 1817
215 Ga0157376_10239083 3300014969 Unclassified 1691
216 Ga0207666_1035147 3300025271 Bacteria 776
217 Ga0207697_10060088 3300025315 Bacteria 1580
218 Ga0207697_10150940 3300025315 Unclassified 1011
219 Ga0207710_10035874 3300025900 Bacteria 2184
220 Ga0207680_10119275 3300025903 Bacteria 1723
221 Ga0207680_10373375 3300025903 Unclassified 1004
222 Ga0207685_10461760 3300025905 Unclassified 662
223 Ga0207707_10569196 3300025912 Bacteria 961
224 Ga0207671_10381517 3300025914 Bacteria 1120
225 Ga0207663_11285248 3300025916 Unclassified 589
226 Ga0207662_10035024 3300025918 Bacteria 2931
227 Ga0207649_10696306 3300025920 Bacteria 788
228 Ga0207646_10957006 3300025922 Unclassified 758
229 Ga0207646_11217482 3300025922 Bacteria 660
230 Ga0207681_10147976 3300025923 Bacteria 1756
231 Ga0207681_11383534 3300025923 Unclassified 591
232 Ga0207650_10052330 3300025925 Unclassified 3025
233 Ga0207650_10134279 3300025925 Bacteria 1940
234 Ga0207650_10523972 3300025925 Unclassified 992
235 Ga0207659_10000084 3300025926 Bacteria 56518
236 Ga0207659_10089018 3300025926 Unclassified 2301
237 Ga0207687_10177073 3300025927 Unclassified 1649
238 Ga0207687_10309065 3300025927 Bacteria 1276
239 Ga0207644_10009084 3300025931 Bacteria 6517
240 Ga0207644_10244867 3300025931 Unclassified 1429
241 Ga0207690_10259417 3300025932 Bacteria 1346
242 Ga0207690_11544696 3300025932 Unclassified 555
243 Ga0207706_10306655 3300025933 Bacteria 1383
244 Ga0207686_10017899 3300025934 Unclassified 4002
245 Ga0207686_10308833 3300025934 Unclassified 1177
246 Ga0207686_10443303 3300025934 Unclassified 997
247 Ga0207709_10371526 3300025935 Unclassified 1085
248 Ga0207670_10063456 3300025936 Bacteria 2528
249 Ga0207670_10502911 3300025936 Bacteria 984
250 Ga0207669_10432917 3300025937 Unclassified 1038
251 Ga0207704_10009201 3300025938 Unclassified 4756
252 Ga0207691_10062194 3300025940 Bacteria 3389
253 Ga0207691_10213536 3300025940 Bacteria 1675
254 Ga0207691_10251766 3300025940 Bacteria 1525
255 Ga0207711_10093190 3300025941 Unclassified 2653
256 Ga0207711_10216433 3300025941 Bacteria 1751
257 Ga0207711_10257803 3300025941 Bacteria 1602
258 Ga0207711_10642843 3300025941 Bacteria 990
259 Ga0207661_10008840 3300025944 Bacteria 7208
260 Ga0207661_10176336 3300025944 Unclassified 1864
261 Ga0207679_10151973 3300025945 Unclassified 1885
262 Ga0207651_10251548 3300025960 Bacteria 1446
263 Ga0207651_11812532 3300025960 Unclassified 549
264 Ga0207712_10072938 3300025961 Bacteria 2474
265 Ga0207712_11547088 3300025961 Unclassified 594
266 Ga0207640_10893329 3300025981 Unclassified 776
267 Ga0207658_10528573 3300025986 Bacteria 1053
268 Ga0207677_11898120 3300026023 Unclassified 553
269 Ga0207703_10017171 3300026035 Bacteria 5646
270 Ga0207678_10032367 3300026067 Bacteria 4556
271 Ga0207678_11179453 3300026067 Unclassified 678
272 Ga0207708_10138582 3300026075 Bacteria 1907
273 Ga0207708_10799749 3300026075 Bacteria 812
274 Ga0207641_10005092 3300026088 Bacteria 11258
275 Ga0207641_10245072 3300026088 Unclassified 1672
276 Ga0207641_11607014 3300026088 Unclassified 652
277 Ga0207641_11714765 3300026088 Bacteria 630
278 Ga0207641_12310547 3300026088 Bacteria 537
279 Ga0207676_10322201 3300026095 Bacteria 1419
280 Ga0207676_10518777 3300026095 Bacteria 1134
281 Ga0207676_10820361 3300026095 Bacteria 908
282 Ga0207676_12239299 3300026095 Unclassified 544
283 Ga0207674_10149789 3300026116 Bacteria 2290
284 Ga0207675_100565508 3300026118 Bacteria 1137
285 Ga0207683_10146958 3300026121 Bacteria 2126
286 Ga0207683_10332220 3300026121 Bacteria 1393
287 Ga0207683_10928034 3300026121 Unclassified 808
288 Ga0207683_11292502 3300026121 Unclassified 675
289 Ga0207428_10106839 3300027907 Bacteria 2157
290 Ga0207428_10108153 3300027907 Bacteria 2142
291 Ga0207428_10427842 3300027907 Bacteria 967
292 Ga0207428_10658519 3300027907 Bacteria 751
293 Ga0207428_10788811 3300027907 Bacteria 675
294 Ga0268266_10009805 3300028379 Bacteria 8423
295 Ga0268265_10253876 3300028380 Bacteria 1559
296 Ga0268265_11649036 3300028380 Unclassified 647
297 Ga0268265_12190693 3300028380 Bacteria 560
298 Ga0268264_10003103 3300028381 Bacteria 14384
299 Ga0268264_10756485 3300028381 Bacteria 968
300 Ga0268264_10771308 3300028381 Bacteria 959
301 Ga0268264_11034508 3300028381 Bacteria 828
302 Ga0268264_11083621 3300028381 Unclassified 809
303 Ga0268264_11725914 3300028381 Bacteria 636
304 Ga0307416_101836924 3300032002 Unclassified 710
305 Ga0307411_10923157 3300032005 Bacteria 777
306 Ga0373934_0048199 3300035086 Unclassified 1686
307 Ga0373945_0183088 3300035116 Bacteria 863
308 Ga0373956_0031247 3300035119 Unclassified 2333
309 Ga0373956_0157662 3300035119 Bacteria 1069
310 Ga0373946_0460133 3300035171 Unclassified 649
311 Ga0373955_0188447 3300035172 Unclassified 1226
312 Ga0373961_0071091 3300035241 Unclassified 1076
313 Ga0373947_0490661 3300035725 Bacteria 834
314 Ga0373937_0072973 3300036401 Bacteria 3166
315 Ga0373937_0514536 3300036401 Unclassified 1137
316 Ga0373937_0874925 3300036401 Unclassified 847
317 Ga0373937_1394933 3300036401 Bacteria 648
318 Ga0373925_0956201 3300037068 Bacteria 706
319 Ga0373925_1619855 3300037068 Unclassified 529
320 Ga0451576_0228701 3300045051 Bacteria 1942
321 Ga0451576_2112709 3300045051 Unclassified 579
322 Ga0495592_0728394 3300046454 Bacteria 594
323 Ga0495603_0304870 3300046455 Bacteria 915
324 Ga0495582_0145198 3300046473 Bacteria 1346
325 Ga0495662_0511317 3300046476 Unclassified 589
326 Ga0495640_0240437 3300046533 Bacteria 1137
327 Ga0495640_0269244 3300046533 Unclassified 1063
328 Ga0495598_0154399 3300046537 Unclassified 803
329 Ga0495621_0004303 3300046539 Bacteria 3991
330 Ga0495633_0096477 3300046558 Bacteria 1373
331 Ga0495667_0641403 3300046559 Unclassified 660
332 Ga0495659_0004647 3300046664 Bacteria 4324
333 Ga0495647_0089645 3300046681 Bacteria 1259
334 Ga0495647_0299942 3300046681 Bacteria 724
335 Ga0495658_0076441 3300046683 Bacteria 1957
336 Ga0495658_0372933 3300046683 Unclassified 908
337 Ga0495669_0055137 3300046684 Bacteria 1790
338 Ga0495624_0961973 3300046690 Bacteria 501
339 Ga0495604_0376320 3300047317 Bacteria 939
340 Ga0495680_0294752 3300047322 Bacteria 1140
341 Ga0496100_0023277 3300048903 Bacteria 3761
342 Ga0496100_0720391 3300048903 Unclassified 779
343 Ga0496100_0799485 3300048903 Unclassified 739
344 Ga0496101_0044618 3300048904 Bacteria 3172
345 Ga0496101_0133941 3300048904 Bacteria 1884
346 Ga0496101_1075117 3300048904 Bacteria 632
347 Ga0496104_0034947 3300048907 Bacteria 4690
348 Ga0496104_0069296 3300048907 Unclassified 3352
349 Ga0496104_0558106 3300048907 Bacteria 1056
350 Ga0496105_0033717 3300048908 Bacteria 4207
351 Ga0496105_0231843 3300048908 Bacteria 1500
352 Ga0496106_0065859 3300048909 Bacteria 2758
353 Ga0496106_0535950 3300048909 Bacteria 940
354 Ga0496106_0696491 3300048909 Bacteria 810
355 Ga0496108_0027992 3300048911 Bacteria 4661
356 Ga0496108_0381390 3300048911 Bacteria 1231
357 Ga0496109_0012622 3300048912 Bacteria 7296
358 Ga0496110_0013142 3300048913 Bacteria 6835
359 Ga0496111_0003310 3300048914 Bacteria 9971
360 Ga0496112_0166175 3300048915 Unclassified 2172
361 Ga0496112_0437886 3300048915 Bacteria 1245
362 Ga0496112_1385871 3300048915 Bacteria 618
363 Ga0496113_0580905 3300048916 Bacteria 898
364 Ga0496114_0000906 3300048917 Bacteria 22197
365 Ga0496114_0702251 3300048917 Bacteria 887
366 Ga0496114_0987791 3300048917 Unclassified 725
367 Ga0496115_1035602 3300048918 Unclassified 625
368 Ga0501068_0560509 3300049584 Bacteria 743
369 nmdc:mga05p37_1835209_c1 3300050507 Unclassified 583
370 nmdc:mga05p37_205301_c1 3300050507 Bacteria 2384
371 nmdc:mga05p37_21286_c1 3300050507 Bacteria 7851
372 nmdc:mga05p37_44113_c1 3300050507 Bacteria 5486
373 nmdc:mga09592_1112551_c1 3300050508 Unclassified 656
374 nmdc:mga09592_137442_c1 3300050508 Bacteria 2105
375 nmdc:mga09592_281428_c1 3300050508 Unclassified 1442
376 nmdc:mga06r32_471456_c1 3300050510 Bacteria 1234
377 nmdc:mga06r32_681801_c1 3300050510 Unclassified 994
378 nmdc:mga08y16_136903_c1 3300050511 Bacteria 2545
379 nmdc:mga08y16_152796_c1 3300050511 Bacteria 2399
380 nmdc:mga08y16_173930_c1 3300050511 Bacteria 833
381 nmdc:mga08y16_1887141_c1 3300050511 Bacteria 549
382 nmdc:mga08y16_217631_c1 3300050511 Bacteria 1978
383 nmdc:mga08y16_815237_c1 3300050511 Bacteria 925
384 nmdc:mga0n895_1463960_c1 3300050512 Bacteria 650
385 nmdc:mga0n895_2018300_c1 3300050512 Unclassified 534
386 nmdc:mga0n895_276117_c1 3300050512 Bacteria 1704
387 nmdc:mga0n895_327936_c1 3300050512 Bacteria 1551
388 nmdc:mga0n895_347436_c1 3300050512 Bacteria 1502
389 nmdc:mga0n895_479587_c1 3300050512 Unclassified 1254
390 nmdc:mga0n895_54776_c1 3300050512 Bacteria 3924
391 nmdc:mga0rr50_1667011_c1 3300050513 Unclassified 538
392 nmdc:mga0rr50_20956_c1 3300050513 Bacteria 4453
393 nmdc:mga0rr50_589548_c1 3300050513 Bacteria 947
394 nmdc:mga08x19_569609_c1 3300050514 Bacteria 802
395 nmdc:mga0a205_1173592_c1 3300050515 Bacteria 615
396 nmdc:mga0a205_298940_c1 3300050515 Unclassified 1483
397 nmdc:mga0a205_419515_c1 3300050515 Unclassified 1200
398 nmdc:mga0a205_540811_c1 3300050515 Bacteria 1020
399 nmdc:mga0a205_746115_c1 3300050515 Unclassified 828
400 Ga0495601_0088755 3300053077 Unclassified 1988
401 Ga0495601_0148693 3300053077 Bacteria 1529
402 nmdc:mga08y16_81153_c1
403 Ga0065714_10522771
404 Ga0065704_10521997
405 Ga0065712_10071391
406 Ga0065712_10188808
407 Ga0065715_10128716
408 Ga0065715_10166834
409 Ga0065715_10298319
410 Ga0065715_10515450
411 Ga0065715_10540626
412 Ga0065715_11095746
413 Ga0065707_10023042
414 Ga0065707_10134858
415 Ga0065707_10391760
416 Ga0065707_10554345
417 Ga0070683_100033553
418 Ga0070683_100049127
419 Ga0070690_100560783
420 Ga0070690_101479159
421 Ga0070670_100029779
422 Ga0070670_100192851
423 Ga0070670_100619557
424 Ga0070670_101920154
425 Ga0070677_10791316
426 Ga0068869_101140449
427 Ga0070666_10013459
428 Ga0070666_10229756
429 Ga0070666_10381002
430 Ga0070680_101243354
431 Ga0068868_101454538
432 Ga0068868_101960610
433 Ga0068868_102179747
434 Ga0070689_100075713
435 Ga0070689_100533725
436 Ga0070689_102045559
437 Ga0070687_100474217
438 Ga0070661_100097131
439 Ga0070669_100003044
440 Ga0070669_100975124
441 Ga0070669_102013410
442 Ga0070675_100000189
443 Ga0070675_100000508
444 Ga0070675_100076685
445 Ga0070675_100097211
446 Ga0070675_100437560
447 Ga0070671_100029809
448 Ga0070671_100266438
449 Ga0070673_100605886
450 Ga0070673_101076562
451 Ga0070673_101269114
452 Ga0070673_101295736
453 Ga0070688_100917401
454 Ga0070659_101680581
455 Ga0070667_100273540
456 Ga0070667_100625289
457 Ga0070701_10124312
458 Ga0070701_10765852
459 Ga0070711_101424043
460 Ga0070700_100143605
461 Ga0070700_100178732
462 Ga0070694_101725820
463 Ga0070708_100463083
464 Ga0070708_100521141
465 Ga0070708_102039885
466 Ga0070663_100072660
467 Ga0070663_101585590
468 Ga0070678_100078177
469 Ga0070678_100456161
470 Ga0070662_100408087
471 Ga0070662_101215296
472 Ga0068867_100142157
473 Ga0068867_100644174
474 Ga0070685_10199951
475 Ga0070685_10290060
476 Ga0070685_10830262
477 Ga0070706_101388210
478 Ga0070707_101283755
479 Ga0070698_100108292
480 Ga0070698_100229431
481 Ga0070698_100326683
482 Ga0070698_100333206
483 Ga0070699_100233252
484 Ga0070699_100514318
485 Ga0070699_101986257
486 Ga0070684_100002832
487 Ga0070684_100099172
488 Ga0070697_100016754
489 Ga0070697_100331190
490 Ga0070672_100059727
491 Ga0070672_100260924
492 Ga0070672_100630043
493 Ga0070686_100876207
494 Ga0070686_100958957
495 Ga0070686_101083507
496 Ga0070686_101220726
497 Ga0070695_100798348
498 Ga0070696_100272179
499 Ga0070665_100000623
500 Ga0070665_100415493
501 Ga0070704_100286496
502 Ga0068855_101229569
503 Ga0070664_100005096
504 Ga0070664_100037291
505 Ga0070664_102399560
506 Ga0068857_100129408
507 Ga0068852_101189327
508 Ga0068859_100020430
509 Ga0068859_100398574
510 Ga0068864_100108105
511 Ga0068864_100172485
512 Ga0068864_100205193
513 Ga0068864_101344670
514 Ga0068861_100486507
515 Ga0068863_100019348
516 Ga0068858_100005842
517 Ga0068858_100020763
518 Ga0068858_100032991
519 Ga0068858_102204183
520 Ga0068860_100009477
521 Ga0068860_101828401
522 Ga0068860_102042212
523 Ga0068862_100073178
524 Ga0068862_101359011
525 Ga0097621_100001140
526 Ga0097621_100051421
527 Ga0097621_100054453
528 Ga0097621_100057404
529 Ga0097621_100099717
530 Ga0097621_101109968
531 Ga0068871_100006462
532 Ga0068871_100007813
533 Ga0068871_100081324
534 Ga0068871_100225354
535 Ga0068871_100944833
536 Ga0068871_101451289
537 Ga0068871_101603706
538 Ga0075428_100013110
539 Ga0075428_100046795
540 Ga0075428_100046835
541 Ga0075428_102479539
542 Ga0075431_100567170
543 Ga0075431_100736086
544 Ga0075431_101147355
545 Ga0075433_10043470
546 Ga0075433_10263265
547 Ga0075433_10271322
548 Ga0075433_10585796
549 Ga0075433_11455502
550 Ga0075434_100059576
551 Ga0075434_100164065
552 Ga0075434_100294118
553 Ga0075434_100340799
554 Ga0075434_101027414
555 Ga0075434_101298613
556 Ga0075434_101944584
557 Ga0075429_100316793
558 Ga0075429_100344820
559 Ga0075429_100620481
560 Ga0068865_100029962
561 Ga0068865_101742398
562 Ga0075436_100394692
563 Ga0075436_100482658
564 Ga0075436_100605807
565 Ga0097620_100020430
566 Ga0097620_100398606
567 Ga0075435_100007106
568 Ga0075435_100091390
569 Ga0075435_100839773
570 Ga0105240_11531300
571 Ga0111539_10029166
572 Ga0111539_10033951
573 Ga0111539_10062848
574 Ga0111539_10681158
575 Ga0111539_11448801
576 Ga0105247_10047382
577 Ga0105247_10442916
578 Ga0114129_10005934
579 Ga0114129_10013616
580 Ga0114129_10074618
581 Ga0114129_10417299
582 Ga0114129_12399985
583 Ga0105243_10368895
584 Ga0105241_10690577
585 Ga0105242_10001902
586 Ga0105242_10034987
587 Ga0105242_12162255
588 Ga0105242_12846496
589 Ga0105248_10105178
590 Ga0105248_10326219
591 Ga0105248_10438575
592 Ga0105248_10478609
593 Ga0105237_10117108
594 Ga0105249_10147271
595 Ga0105249_10905239
596 Ga0105246_10314867
597 Ga0105246_10320898
598 Ga0105246_10812805
599 Ga0105246_10915152
600 Ga0157374_10145392
601 Ga0157374_12287632
602 Ga0157378_10033180
603 Ga0163162_10044269
604 Ga0163162_12854632
605 Ga0157375_10900047
606 Ga0163163_10148111
607 Ga0163163_10215879
608 Ga0157380_10494363
609 Ga0157380_10672167
610 Ga0157377_10098857
611 Ga0157377_10620342
612 Ga0157377_11302660
613 Ga0157377_11560145
614 Ga0157379_10041751
615 Ga0157379_10197835
616 Ga0157376_10239083
617 Ga0207666_1035147
618 Ga0207697_10060088
619 Ga0207697_10150940
620 Ga0207710_10035874
621 Ga0207680_10119275
622 Ga0207680_10373375
623 Ga0207685_10461760
624 Ga0207707_10569196
625 Ga0207671_10381517
626 Ga0207663_11285248
627 Ga0207662_10035024
628 Ga0207649_10696306
629 Ga0207646_10957006
630 Ga0207646_11217482
631 Ga0207681_10147976
632 Ga0207681_11383534
633 Ga0207650_10052330
634 Ga0207650_10134279
635 Ga0207650_10523972
636 Ga0207659_10000084
637 Ga0207659_10089018
638 Ga0207687_10177073
639 Ga0207687_10309065
640 Ga0207644_10009084
641 Ga0207644_10244867
642 Ga0207690_10259417
643 Ga0207690_11544696
644 Ga0207706_10306655
645 Ga0207686_10017899
646 Ga0207686_10308833
647 Ga0207686_10443303
648 Ga0207709_10371526
649 Ga0207670_10063456
650 Ga0207670_10502911
651 Ga0207669_10432917
652 Ga0207704_10009201
653 Ga0207691_10062194
654 Ga0207691_10213536
655 Ga0207691_10251766
656 Ga0207711_10093190
657 Ga0207711_10216433
658 Ga0207711_10257803
659 Ga0207711_10642843
660 Ga0207661_10008840
661 Ga0207661_10176336
662 Ga0207679_10151973
663 Ga0207651_10251548
664 Ga0207651_11812532
665 Ga0207712_10072938
666 Ga0207712_11547088
667 Ga0207640_10893329
668 Ga0207658_10528573
669 Ga0207677_11898120
670 Ga0207703_10017171
671 Ga0207678_10032367
672 Ga0207678_11179453
673 Ga0207708_10138582
674 Ga0207708_10799749
675 Ga0207641_10005092
676 Ga0207641_10245072
677 Ga0207641_11607014
678 Ga0207641_11714765
679 Ga0207641_12310547
680 Ga0207676_10322201
681 Ga0207676_10518777
682 Ga0207676_10820361
683 Ga0207676_12239299
684 Ga0207674_10149789
685 Ga0207675_100565508
686 Ga0207683_10146958
687 Ga0207683_10332220
688 Ga0207683_10928034
689 Ga0207683_11292502
690 Ga0207428_10106839
691 Ga0207428_10108153
692 Ga0207428_10427842
693 Ga0207428_10658519
694 Ga0207428_10788811
695 Ga0268266_10009805
696 Ga0268265_10253876
697 Ga0268265_11649036
698 Ga0268265_12190693
699 Ga0268264_10003103
700 Ga0268264_10756485
701 Ga0268264_10771308
702 Ga0268264_11034508
703 Ga0268264_11083621
704 Ga0268264_11725914
705 Ga0307416_101836924
706 Ga0307411_10923157
707 Ga0373934_0048199
708 Ga0373945_0183088
709 Ga0373956_0031247
710 Ga0373956_0157662
711 Ga0373946_0460133
712 Ga0373955_0188447
713 Ga0373961_0071091
714 Ga0373947_0490661
715 Ga0373937_0072973
716 Ga0373937_0514536
717 Ga0373937_0874925
718 Ga0373937_1394933
719 Ga0373925_0956201
720 Ga0373925_1619855
721 Ga0451576_0228701
722 Ga0451576_2112709
723 Ga0495592_0728394
724 Ga0495603_0304870
725 Ga0495582_0145198
726 Ga0495662_0511317
727 Ga0495640_0240437
728 Ga0495640_0269244
729 Ga0495598_0154399
730 Ga0495621_0004303
731 Ga0495633_0096477
732 Ga0495667_0641403
733 Ga0495659_0004647
734 Ga0495647_0089645
735 Ga0495647_0299942
736 Ga0495658_0076441
737 Ga0495658_0372933
738 Ga0495669_0055137
739 Ga0495624_0961973
740 Ga0495604_0376320
741 Ga0495680_0294752
742 Ga0496100_0023277
743 Ga0496100_0720391
744 Ga0496100_0799485
745 Ga0496101_0044618
746 Ga0496101_0133941
747 Ga0496101_1075117
748 Ga0496104_0034947
749 Ga0496104_0069296
750 Ga0496104_0558106
751 Ga0496105_0033717
752 Ga0496105_0231843
753 Ga0496106_0065859
754 Ga0496106_0535950
755 Ga0496106_0696491
756 Ga0496108_0027992
757 Ga0496108_0381390
758 Ga0496109_0012622
759 Ga0496110_0013142
760 Ga0496111_0003310
761 Ga0496112_0166175
762 Ga0496112_0437886
763 Ga0496112_1385871
764 Ga0496113_0580905
765 Ga0496114_0000906
766 Ga0496114_0702251
767 Ga0496114_0987791
768 Ga0496115_1035602
769 Ga0501068_0560509
770 nmdc:mga05p37_1835209_c1
771 nmdc:mga05p37_205301_c1
772 nmdc:mga05p37_21286_c1
773 nmdc:mga05p37_44113_c1
774 nmdc:mga09592_1112551_c1
775 nmdc:mga09592_137442_c1
776 nmdc:mga09592_281428_c1
777 nmdc:mga06r32_471456_c1
778 nmdc:mga06r32_681801_c1
779 nmdc:mga08y16_136903_c1
780 nmdc:mga08y16_152796_c1
781 nmdc:mga08y16_173930_c1
782 nmdc:mga08y16_1887141_c1
783 nmdc:mga08y16_217631_c1
784 nmdc:mga08y16_815237_c1
785 nmdc:mga0n895_1463960_c1
786 nmdc:mga0n895_2018300_c1
787 nmdc:mga0n895_276117_c1
788 nmdc:mga0n895_327936_c1
789 nmdc:mga0n895_347436_c1
790 nmdc:mga0n895_479587_c1
791 nmdc:mga0n895_54776_c1
792 nmdc:mga0rr50_1667011_c1
793 nmdc:mga0rr50_20956_c1
794 nmdc:mga0rr50_589548_c1
795 nmdc:mga08x19_569609_c1
796 nmdc:mga0a205_1173592_c1
797 nmdc:mga0a205_298940_c1
798 nmdc:mga0a205_419515_c1
799 nmdc:mga0a205_540811_c1
800 nmdc:mga0a205_746115_c1
801 Ga0495601_0088755
802 Ga0495601_0148693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20159

YidB

YidB-like protein

12

127

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z67-assembly1.cif.gz_A structure of homeodomain-like protein of unknown function s4005 from shigella flexneri 0.9041 14 107
1z67-assembly1.cif.gz_A structure of homeodomain-like protein of unknown function s4005 from shigella flexneri 0.7746 14 107
3nar-assembly2.cif.gz_B crystal structure of zhx1 hd4 (zinc-fingers and homeoboxes protein 1, homeodomain 4) 0.5555 68 103
7qtt-assembly1.cif.gz_A structural organization of a late activated human spliceosome (baqr, core region) 0.3669 30 94
5hy7-assembly1.cif.gz_A sf3b10-sf3b130 from chaetomium thermophilum 0.3631 30 93
ID Description Score Start End Superfamily
af_P09996_1_132_1.10.10.690 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;YidB-like 0.9234 14 109 1.10.10.690
1z67A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;YidB-like 0.9041 14 107 1.10.10.690
af_P09996_1_132_1.10.10.690 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;YidB-like 0.8055 14 109 1.10.10.690
1z67A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;YidB-like 0.7746 14 107 1.10.10.690
af_Q9H4I2_496_559_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6624 68 107 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3S1W3S4-F1-model_v4 deleted 0.9893 28 109
AF-A0A1W7QSW7-F1-model_v4 deleted 0.9893 32 109
AF-A0A659URT5-F1-model_v4 DUF937 domain-containing protein 0.9863 34 110
AF-A0A5E9AZB6-F1-model_v4 DUF937 domain-containing protein 0.9842 28 109
AF-A0A316CUT6-F1-model_v4 Uncharacterized protein YidB (DUF937 family) 0.9835 28 109

Map