F434874

General Info

Members Datasets Scaffolds Average Seq Length
401 194 802 179

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10038755|Ga0265320_100387552
Length 196
Sequence MLPNPGLGAAQRTYMKTTKLFVILLTMVAIGTVVGCSRFSAKSPDVSDSIRKSLDQAGLKDVTVSQDRDKGIVTLGGQVATDDQKAQAESLAKSFAGTEVVADQIAVISVGQEKEAKAVNSDLDQAIEKNLDAALIQNKMHNNVKYSVKSGVVTLTGEVNSQDKRTRAEKVAAGVPNVQQVVNNLQVKNQKATSQQ

Samples

Sample ID Description Type Environment
1 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
112 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
139 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 6.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.25
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 27.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265320_10038755 3300031240 Unclassified 2389
2 Ga0058863_11371726 3300004799 Unclassified 817
3 Ga0058861_10952810 3300004800 Bacteria 905
4 Ga0058862_11724197 3300004803 Bacteria 795
5 Ga0070658_10095617 3300005327 Bacteria 2452
6 Ga0070683_100002650 3300005329 Bacteria 14309
7 Ga0068869_100550003 3300005334 Bacteria 969
8 Ga0070680_100004543 3300005336 Bacteria 10440
9 Ga0070680_100615281 3300005336 Unclassified 933
10 Ga0070682_100091273 3300005337 Unclassified 1993
11 Ga0070660_100001145 3300005339 Bacteria 17888
12 Ga0070660_100613048 3300005339 Bacteria 910
13 Ga0070689_100173270 3300005340 Bacteria 1749
14 Ga0070689_100692573 3300005340 Bacteria 889
15 Ga0070661_100072241 3300005344 Unclassified 2539
16 Ga0070661_100300289 3300005344 Unclassified 1250
17 Ga0070675_100918868 3300005354 Bacteria 802
18 Ga0070674_100522928 3300005356 Bacteria 991
19 Ga0070673_101428663 3300005364 Unclassified 651
20 Ga0070714_100323569 3300005435 Bacteria 1442
21 Ga0070713_100299108 3300005436 Bacteria 1481
22 Ga0070713_100671904 3300005436 Unclassified 988
23 Ga0070713_101114766 3300005436 Unclassified 763
24 Ga0070710_10527771 3300005437 Bacteria 812
25 Ga0070711_100323078 3300005439 Bacteria 1234
26 Ga0070711_100799036 3300005439 Unclassified 800
27 Ga0070708_100008831 3300005445 Bacteria 8110
28 Ga0070678_100333111 3300005456 Unclassified 1300
29 Ga0070681_10000538 3300005458 Bacteria 31151
30 Ga0070681_10014586 3300005458 Bacteria 7820
31 Ga0070681_10071729 3300005458 Plasmid 3428
32 Ga0070681_10271994 3300005458 Bacteria 1606
33 Ga0068867_100196198 3300005459 Bacteria 1614
34 Ga0070685_10622320 3300005466 Bacteria 779
35 Ga0070679_100008345 3300005530 Bacteria 9746
36 Ga0070679_100565364 3300005530 Bacteria 1081
37 Ga0070684_100001024 3300005535 Bacteria 19931
38 Ga0070684_100909610 3300005535 Bacteria 824
39 Ga0070672_100066897 3300005543 Bacteria 2846
40 Ga0070695_100047492 3300005545 Bacteria 2742
41 Ga0070695_100178869 3300005545 Bacteria 1501
42 Ga0070665_100079258 3300005548 Bacteria 3291
43 Ga0070665_100584048 3300005548 Unclassified 1130
44 Ga0068855_100012488 3300005563 Bacteria 10252
45 Ga0068855_100081174 3300005563 Unclassified 3759
46 Ga0068855_100105949 3300005563 Bacteria 3232
47 Ga0068855_100241872 3300005563 Bacteria 2016
48 Ga0070664_100215544 3300005564 Unclassified 1716
49 Ga0068857_100002376 3300005577 Bacteria 15344
50 Ga0068854_100103134 3300005578 Bacteria 2141
51 Ga0068856_100001387 3300005614 Bacteria 25456
52 Ga0068856_100015428 3300005614 Bacteria 7383
53 Ga0068856_100027974 3300005614 Bacteria 5500
54 Ga0068856_100164939 3300005614 Bacteria 2226
55 Ga0068852_100000734 3300005616 Bacteria 21507
56 Ga0068852_100076953 3300005616 Bacteria 2947
57 Ga0068852_100227092 3300005616 Bacteria 1778
58 Ga0068852_100322110 3300005616 Bacteria 1501
59 Ga0068859_100766539 3300005617 Bacteria 1053
60 Ga0068864_100007120 3300005618 Bacteria 9187
61 Ga0068863_100042269 3300005841 Unclassified 4331
62 Ga0068863_100176535 3300005841 Bacteria 2050
63 Ga0068863_100375689 3300005841 Bacteria 1387
64 Ga0068858_100001977 3300005842 Bacteria 20940
65 Ga0068858_100002635 3300005842 Bacteria 18074
66 Ga0068858_100089878 3300005842 Bacteria 2857
67 Ga0068858_100628631 3300005842 Unclassified 1043
68 Ga0068858_100752002 3300005842 Unclassified 950
69 Ga0068860_100064996 3300005843 Bacteria 3465
70 Ga0068860_100536302 3300005843 Bacteria 1171
71 Ga0068860_100782282 3300005843 Unclassified 967
72 Ga0097621_100002357 3300006237 Bacteria 12949
73 Ga0097621_100150164 3300006237 Bacteria 1998
74 Ga0097621_100183256 3300006237 Unclassified 1810
75 Ga0097621_100183658 3300006237 Bacteria 1808
76 Ga0097621_100360465 3300006237 Unclassified 1295
77 Ga0097621_100417623 3300006237 Unclassified 1203
78 Ga0068871_100024815 3300006358 Bacteria 4654
79 Ga0068871_100031805 3300006358 Bacteria 4163
80 Ga0068871_100232883 3300006358 Bacteria 1599
81 Ga0068871_101308921 3300006358 Unclassified 682
82 Ga0097620_100147581 3300006931 Bacteria 2427
83 Ga0097620_100766544 3300006931 Bacteria 1053
84 Ga0105240_10001736 3300009093 Bacteria 36803
85 Ga0105240_10030474 3300009093 Bacteria 7012
86 Ga0105240_10102956 3300009093 Bacteria 3469
87 Ga0105240_10425731 3300009093 Bacteria 1490
88 Ga0105245_10008991 3300009098 Bacteria 8714
89 Ga0105245_10029033 3300009098 Bacteria 4885
90 Ga0105245_10118000 3300009098 Bacteria 2476
91 Ga0105245_10469972 3300009098 Unclassified 1269
92 Ga0105245_10951370 3300009098 Bacteria 902
93 Ga0105247_10269414 3300009101 Unclassified 1171
94 Ga0105243_10692246 3300009148 Bacteria 992
95 Ga0105241_10001793 3300009174 Bacteria 16305
96 Ga0105241_10034281 3300009174 Unclassified 3813
97 Ga0105241_10057364 3300009174 Bacteria 2987
98 Ga0105241_10121364 3300009174 Unclassified 2105
99 Ga0105242_10119615 3300009176 Bacteria 2258
100 Ga0105242_10127081 3300009176 Unclassified 2195
101 Ga0105242_10372940 3300009176 Bacteria 1324
102 Ga0105242_10916680 3300009176 Bacteria 878
103 Ga0105242_11110217 3300009176 Bacteria 805
104 Ga0105248_10003545 3300009177 Bacteria 17298
105 Ga0105248_10015043 3300009177 Bacteria 8519
106 Ga0105248_10156610 3300009177 Bacteria 2571
107 Ga0105248_10213283 3300009177 Unclassified 2175
108 Ga0105248_10219222 3300009177 Bacteria 2142
109 Ga0105248_10739969 3300009177 Bacteria 1109
110 Ga0105248_11025827 3300009177 Bacteria 932
111 Ga0105237_10001210 3300009545 Bacteria 34539
112 Ga0105237_10123999 3300009545 Unclassified 2578
113 Ga0105237_10195275 3300009545 Bacteria 2023
114 Ga0105237_10589701 3300009545 Bacteria 1118
115 Ga0105237_11364063 3300009545 Unclassified 715
116 Ga0105238_10000215 3300009551 Bacteria 64004
117 Ga0105238_10026771 3300009551 Bacteria 5878
118 Ga0105238_10088180 3300009551 Bacteria 3089
119 Ga0105238_10123321 3300009551 Bacteria 2570
120 Ga0105238_11234129 3300009551 Unclassified 772
121 Ga0105249_10525861 3300009553 Bacteria 1231
122 Ga0105239_10005525 3300010375 Bacteria 14805
123 Ga0105239_10013336 3300010375 Bacteria 9132
124 Ga0105239_10028283 3300010375 Bacteria 6167
125 Ga0105239_10055261 3300010375 Bacteria 4354
126 Ga0105239_10139643 3300010375 Bacteria 2699
127 Ga0105239_10512705 3300010375 Bacteria 1364
128 Ga0105246_10102074 3300011119 Bacteria 2091
129 Ga0157373_10092725 3300013100 Unclassified 2127
130 Ga0157373_10392407 3300013100 Unclassified 994
131 Ga0157370_10006603 3300013104 Bacteria 12754
132 Ga0157370_10032357 3300013104 Bacteria 5107
133 Ga0157370_10046934 3300013104 Bacteria 4141
134 Ga0157370_10151045 3300013104 Bacteria 2161
135 Ga0157369_10002765 3300013105 Bacteria 20952
136 Ga0157369_10022296 3300013105 Bacteria 7070
137 Ga0157369_10038924 3300013105 Bacteria 5198
138 Ga0157369_10070704 3300013105 Unclassified 3749
139 Ga0157369_10102960 3300013105 Bacteria 3041
140 Ga0157374_10134732 3300013296 Unclassified 2393
141 Ga0157374_10327709 3300013296 Bacteria 1518
142 Ga0157374_10372767 3300013296 Unclassified 1421
143 Ga0157374_10467168 3300013296 Bacteria 1264
144 Ga0157374_10848511 3300013296 Unclassified 930
145 Ga0157378_10002179 3300013297 Bacteria 17362
146 Ga0157378_10190334 3300013297 Bacteria 1935
147 Ga0163162_10008251 3300013306 Bacteria 10167
148 Ga0163162_10016432 3300013306 Bacteria 7231
149 Ga0163162_10539924 3300013306 Unclassified 1295
150 Ga0157372_10002416 3300013307 Bacteria 20223
151 Ga0157372_10004717 3300013307 Bacteria 14483
152 Ga0157372_10033685 3300013307 Bacteria 5628
153 Ga0157372_10097683 3300013307 Bacteria 3350
154 Ga0157372_10098432 3300013307 Unclassified 3337
155 Ga0157375_10033573 3300013308 Bacteria 4877
156 Ga0157375_10105878 3300013308 Bacteria 2904
157 Ga0157375_10588668 3300013308 Bacteria 1272
158 Ga0163163_10000013 3300014325 Bacteria 242522
159 Ga0163163_10003294 3300014325 Bacteria 13699
160 Ga0163163_10390206 3300014325 Unclassified 1450
161 Ga0157377_10615792 3300014745 Unclassified 777
162 Ga0157379_10133370 3300014968 Bacteria 2237
163 Ga0157379_10240432 3300014968 Bacteria 1642
164 Ga0157376_10088090 3300014969 Unclassified 2680
165 Ga0157376_10089645 3300014969 Bacteria 2659
166 Ga0157376_10614024 3300014969 Bacteria 1084
167 Ga0182005_1074267 3300015265 Unclassified 935
168 Ga0197907_10278228 3300020069 Bacteria 1346
169 Ga0206356_10618134 3300020070 Bacteria 5760
170 Ga0206355_1149535 3300020076 Unclassified 1061
171 Ga0206355_1272373 3300020076 Bacteria 853
172 Ga0206351_10605603 3300020077 Bacteria 771
173 Ga0206352_10909494 3300020078 Bacteria 5773
174 Ga0206350_11534743 3300020080 Bacteria 1494
175 Ga0206354_10443071 3300020081 Bacteria 1423
176 Ga0206353_11608898 3300020082 Bacteria 1364
177 Ga0224712_10014327 3300022467 Unclassified 2549
178 Ga0207699_10100879 3300025906 Bacteria 1831
179 Ga0207705_10025157 3300025909 Bacteria 4250
180 Ga0207705_10279765 3300025909 Unclassified 1277
181 Ga0207654_10015183 3300025911 Bacteria 3992
182 Ga0207654_10015975 3300025911 Unclassified 3903
183 Ga0207654_10134885 3300025911 Bacteria 1567
184 Ga0207654_10516988 3300025911 Unclassified 845
185 Ga0207707_10000219 3300025912 Bacteria 61663
186 Ga0207707_10024835 3300025912 Bacteria 5242
187 Ga0207707_10091893 3300025912 Bacteria 2652
188 Ga0207707_10225941 3300025912 Bacteria 1629
189 Ga0207707_10291904 3300025912 Bacteria 1411
190 Ga0207695_10000302 3300025913 Bacteria 121140
191 Ga0207695_10014492 3300025913 Bacteria 9332
192 Ga0207695_10031391 3300025913 Bacteria 5826
193 Ga0207695_10080935 3300025913 Unclassified 3288
194 Ga0207695_10168016 3300025913 Bacteria 2121
195 Ga0207671_10022854 3300025914 Unclassified 4722
196 Ga0207671_10146442 3300025914 Unclassified 1822
197 Ga0207671_10578701 3300025914 Bacteria 895
198 Ga0207663_10544386 3300025916 Bacteria 907
199 Ga0207660_10003568 3300025917 Bacteria 10135
200 Ga0207660_10426951 3300025917 Unclassified 1070
201 Ga0207660_10497079 3300025917 Unclassified 989
202 Ga0207657_10002777 3300025919 Bacteria 18861
203 Ga0207657_10036965 3300025919 Bacteria 4366
204 Ga0207649_10213332 3300025920 Unclassified 1371
205 Ga0207652_10004390 3300025921 Bacteria 11486
206 Ga0207652_10018402 3300025921 Bacteria 5729
207 Ga0207652_10060641 3300025921 Bacteria 3264
208 Ga0207652_10664102 3300025921 Bacteria 932
209 Ga0207694_10004081 3300025924 Bacteria 11480
210 Ga0207694_10012732 3300025924 Bacteria 6336
211 Ga0207694_10075864 3300025924 Bacteria 2632
212 Ga0207694_10088901 3300025924 Unclassified 2435
213 Ga0207659_10742207 3300025926 Bacteria 842
214 Ga0207687_10015122 3300025927 Bacteria 5057
215 Ga0207687_10045867 3300025927 Bacteria 3023
216 Ga0207687_10068983 3300025927 Bacteria 2520
217 Ga0207700_10158634 3300025928 Bacteria 1877
218 Ga0207664_10436308 3300025929 Bacteria 1168
219 Ga0207686_10004566 3300025934 Bacteria 7419
220 Ga0207686_10318617 3300025934 Bacteria 1161
221 Ga0207686_10777896 3300025934 Bacteria 766
222 Ga0207709_10059508 3300025935 Bacteria 2378
223 Ga0207670_10076237 3300025936 Bacteria 2333
224 Ga0207691_10088512 3300025940 Bacteria 2777
225 Ga0207711_10000770 3300025941 Bacteria 31501
226 Ga0207711_10005484 3300025941 Bacteria 10723
227 Ga0207711_10011066 3300025941 Bacteria 7498
228 Ga0207711_10132227 3300025941 Bacteria 2238
229 Ga0207711_10848716 3300025941 Unclassified 850
230 Ga0207711_11273830 3300025941 Bacteria 677
231 Ga0207661_10009464 3300025944 Bacteria 6987
232 Ga0207667_10000265 3300025949 Bacteria 72799
233 Ga0207667_10049529 3300025949 Bacteria 4436
234 Ga0207667_10255473 3300025949 Bacteria 1792
235 Ga0207667_10464426 3300025949 Bacteria 1285
236 Ga0207658_10089008 3300025986 Bacteria 2389
237 Ga0207703_10001119 3300026035 Bacteria 25314
238 Ga0207703_10005876 3300026035 Bacteria 9831
239 Ga0207703_10444405 3300026035 Bacteria 1210
240 Ga0207703_10451215 3300026035 Unclassified 1201
241 Ga0207703_10672733 3300026035 Bacteria 983
242 Ga0207639_10456767 3300026041 Unclassified 1160
243 Ga0207702_10005730 3300026078 Bacteria 10826
244 Ga0207702_10101527 3300026078 Bacteria 2540
245 Ga0207641_10100995 3300026088 Unclassified 2541
246 Ga0207641_10298596 3300026088 Bacteria 1521
247 Ga0207648_10016908 3300026089 Bacteria 6648
248 Ga0207676_10012040 3300026095 Bacteria 6190
249 Ga0207674_10000659 3300026116 Bacteria 44890
250 Ga0207674_10577314 3300026116 Unclassified 1086
251 Ga0207683_10375377 3300026121 Unclassified 1307
252 Ga0207698_10038769 3300026142 Bacteria 3524
253 Ga0207698_10109064 3300026142 Bacteria 2315
254 Ga0207698_10185798 3300026142 Bacteria 1846
255 Ga0207698_10524869 3300026142 Unclassified 1156
256 Ga0265354_1002087 3300028016 Bacteria 2592
257 Ga0265357_1000992 3300028023 Bacteria 1939
258 Ga0265357_1018864 3300028023 Bacteria 746
259 Ga0268266_10704585 3300028379 Bacteria 973
260 Ga0268264_10139783 3300028381 Unclassified 2158
261 Ga0268264_10291789 3300028381 Bacteria 1532
262 Ga0265323_10002017 3300028653 Bacteria 9559
263 Ga0265336_10004100 3300028666 Bacteria 5549
264 Ga0265338_10002847 3300028800 Bacteria 25282
265 Ga0265338_10007559 3300028800 Bacteria 13437
266 Ga0265338_10030754 3300028800 Bacteria 5279
267 Ga0265338_10053721 3300028800 Unclassified 3600
268 Ga0265338_10053809 3300028800 Unclassified 3596
269 Ga0265338_10083607 3300028800 Bacteria 2669
270 Ga0265338_10107231 3300028800 Bacteria 2259
271 Ga0265338_10132035 3300028800 Bacteria 1970
272 Ga0265338_10301631 3300028800 Bacteria 1164
273 Ga0265338_10444308 3300028800 Unclassified 919
274 Ga0265338_10518728 3300028800 Unclassified 837
275 Ga0265338_10579021 3300028800 Bacteria 783
276 Ga0265324_10074748 3300029957 Unclassified 1153
277 Ga0265762_1052249 3300030760 Bacteria 823
278 Ga0265762_1056305 3300030760 Unclassified 799
279 Ga0265775_101636 3300030762 Unclassified 1090
280 Ga0265770_1005235 3300030878 Unclassified 1782
281 Ga0265770_1012424 3300030878 Unclassified 1262
282 Ga0265765_1005027 3300030879 Unclassified 1376
283 Ga0265776_100297 3300030880 Unclassified 1710
284 Ga0265779_103664 3300031043 Unclassified 791
285 Ga0265760_10010207 3300031090 Unclassified 2678
286 Ga0265760_10014130 3300031090 Unclassified 2285
287 Ga0265760_10018505 3300031090 Bacteria 2007
288 Ga0265760_10055975 3300031090 Unclassified 1193
289 Ga0265330_10000634 3300031235 Bacteria 22572
290 Ga0265332_10082618 3300031238 Bacteria 1362
291 Ga0265328_10043906 3300031239 Unclassified 1644
292 Ga0265328_10240165 3300031239 Bacteria 692
293 Ga0265320_10240866 3300031240 Unclassified 803
294 Ga0265325_10000405 3300031241 Bacteria 30621
295 Ga0265325_10001212 3300031241 Bacteria 18356
296 Ga0265325_10010463 3300031241 Bacteria 5371
297 Ga0265329_10021039 3300031242 Bacteria 2195
298 Ga0265329_10084684 3300031242 Bacteria 1004
299 Ga0265340_10007309 3300031247 Bacteria 6002
300 Ga0265340_10072683 3300031247 Unclassified 1628
301 Ga0265339_10000722 3300031249 Bacteria 25649
302 Ga0265339_10002496 3300031249 Bacteria 13140
303 Ga0265339_10113032 3300031249 Bacteria 1403
304 Ga0265339_10184915 3300031249 Bacteria 1036
305 Ga0265339_10285000 3300031249 Bacteria 791
306 Ga0265316_10004235 3300031344 Bacteria 14336
307 Ga0265316_10014810 3300031344 Bacteria 6844
308 Ga0265316_10017604 3300031344 Bacteria 6168
309 Ga0265316_10029078 3300031344 Bacteria 4549
310 Ga0265316_10065600 3300031344 Unclassified 2811
311 Ga0265316_10173510 3300031344 Bacteria 1607
312 Ga0265316_10804529 3300031344 Bacteria 659
313 Ga0265313_10000786 3300031595 Bacteria 32033
314 Ga0265313_10007549 3300031595 Bacteria 7394
315 Ga0265314_10007592 3300031711 Bacteria 9389
316 Ga0265314_10031880 3300031711 Bacteria 3885
317 Ga0265314_10091119 3300031711 Unclassified 1984
318 Ga0265314_10104268 3300031711 Bacteria 1816
319 Ga0265342_10000730 3300031712 Bacteria 33842
320 Ga0265342_10001626 3300031712 Bacteria 20734
321 Ga0265342_10027551 3300031712 Bacteria 3549
322 Ga0265342_10365629 3300031712 Unclassified 749
323 Ga0307516_10701841 3300031730 Unclassified 669
324 Ga0316215_1018060 3300033544 Unclassified 713
325 Ga0316212_1005144 3300033547 Unclassified 1902
326 Ga0373953_0062110 3300035117 Bacteria 1529
327 Ga0373954_0159229 3300035118 Bacteria 1104
328 Ga0373935_0193888 3300035692 Bacteria 1401
329 Ga0373935_0546030 3300035692 Unclassified 844
330 Ga0373947_1006663 3300035725 Unclassified 568
331 Ga0373937_0570437 3300036401 Unclassified 1075
332 Ga0265778_007635 3300036457 Unclassified 1190
333 Ga0436364_0691216 3300037853 Unclassified 2908
334 Ga0436364_0697091 3300037853 Bacteria 5685
335 Ga0451577_0476486 3300042876 Bacteria 1133
336 Ga0453684_0455782 3300044712 Bacteria 1423
337 Ga0451576_0019929 3300045051 Bacteria 7311
338 Ga0495592_0012278 3300046454 Bacteria 6502
339 Ga0495592_0210745 3300046454 Bacteria 1305
340 Ga0495629_0361433 3300046459 Bacteria 989
341 Ga0495641_0054021 3300046461 Bacteria 1826
342 Ga0495651_0018393 3300046462 Bacteria 5412
343 Ga0495653_0024189 3300046463 Bacteria 4898
344 Ga0495580_0027969 3300046472 Bacteria 4101
345 Ga0495580_0127656 3300046472 Bacteria 1765
346 Ga0495580_0127817 3300046472 Bacteria 1764
347 Ga0495580_0208397 3300046472 Unclassified 1345
348 Ga0495580_0353773 3300046472 Unclassified 994
349 Ga0495580_0365948 3300046472 Unclassified 975
350 Ga0495580_0944820 3300046472 Unclassified 552
351 Ga0495582_0009725 3300046473 Bacteria 5297
352 Ga0495582_0177717 3300046473 Bacteria 1212
353 Ga0495582_0222552 3300046473 Unclassified 1080
354 Ga0495639_0035791 3300046475 Bacteria 2222
355 Ga0495662_0043352 3300046476 Unclassified 2172
356 Ga0495664_0326432 3300046477 Unclassified 925
357 Ga0495594_0042778 3300046499 Bacteria 2481
358 Ga0495618_0016891 3300046514 Bacteria 4472
359 Ga0495628_0003428 3300046516 Bacteria 14193
360 Ga0495628_0277744 3300046516 Bacteria 1245
361 Ga0495630_0090420 3300046517 Bacteria 2313
362 Ga0495630_0124802 3300046517 Bacteria 1953
363 Ga0495666_0025423 3300046526 Unclassified 2923
364 Ga0495652_0003457 3300046529 Bacteria 15585
365 Ga0495665_0052027 3300046531 Bacteria 2168
366 Ga0495640_0038142 3300046533 Bacteria 3381
367 Ga0495586_0007286 3300046535 Bacteria 5905
368 Ga0495587_0000962 3300046536 Bacteria 18881
369 Ga0495645_0074662 3300046543 Bacteria 2441
370 Ga0495622_0192491 3300046557 Bacteria 911
371 Ga0495667_0008119 3300046559 Bacteria 7126
372 Ga0495634_0102556 3300046642 Unclassified 1848
373 Ga0495634_0198245 3300046642 Bacteria 1248
374 Ga0495634_0318465 3300046642 Unclassified 937
375 Ga0495635_0030611 3300046663 Bacteria 3739
376 Ga0495657_0011844 3300046675 Bacteria 6501
377 Ga0495599_0077064 3300046678 Bacteria 2082
378 Ga0495623_0397408 3300046679 Unclassified 742
379 Ga0495647_0021135 3300046681 Unclassified 2341
380 Ga0495647_0174689 3300046681 Bacteria 932
381 Ga0495658_0179342 3300046683 Unclassified 1314
382 Ga0495613_0005346 3300046689 Bacteria 9645
383 Ga0495624_0073648 3300046690 Bacteria 2123
384 Ga0495581_0091551 3300047315 Unclassified 1764
385 Ga0495604_0000617 3300047317 Bacteria 30546
386 Ga0495674_0005014 3300047319 Bacteria 12737
387 Ga0495674_0107465 3300047319 Unclassified 2368
388 Ga0495676_0215569 3300047321 Bacteria 1325
389 Ga0495680_0011742 3300047322 Bacteria 7738
390 Ga0495680_0039551 3300047322 Bacteria 3761
391 Ga0495680_0093697 3300047322 Bacteria 2248
392 Ga0495675_0000013 3300047444 Bacteria 139190
393 Ga0495684_0002370 3300047471 Bacteria 15058
394 Ga0495684_0024820 3300047471 Bacteria 4610
395 Ga0495602_0730524 3300048088 Unclassified 670
396 Ga0496102_0590121 3300048905 Bacteria 1034
397 Ga0496104_0841624 3300048907 Unclassified 823
398 Ga0496105_0161102 3300048908 Unclassified 1842
399 Ga0496105_0545930 3300048908 Unclassified 905
400 Ga0496114_0430918 3300048917 Bacteria 1168
401 Ga0495601_0479235 3300053077 Unclassified 804
402 Ga0265320_10038755
403 Ga0058863_11371726
404 Ga0058861_10952810
405 Ga0058862_11724197
406 Ga0070658_10095617
407 Ga0070683_100002650
408 Ga0068869_100550003
409 Ga0070680_100004543
410 Ga0070680_100615281
411 Ga0070682_100091273
412 Ga0070660_100001145
413 Ga0070660_100613048
414 Ga0070689_100173270
415 Ga0070689_100692573
416 Ga0070661_100072241
417 Ga0070661_100300289
418 Ga0070675_100918868
419 Ga0070674_100522928
420 Ga0070673_101428663
421 Ga0070714_100323569
422 Ga0070713_100299108
423 Ga0070713_100671904
424 Ga0070713_101114766
425 Ga0070710_10527771
426 Ga0070711_100323078
427 Ga0070711_100799036
428 Ga0070708_100008831
429 Ga0070678_100333111
430 Ga0070681_10000538
431 Ga0070681_10014586
432 Ga0070681_10071729
433 Ga0070681_10271994
434 Ga0068867_100196198
435 Ga0070685_10622320
436 Ga0070679_100008345
437 Ga0070679_100565364
438 Ga0070684_100001024
439 Ga0070684_100909610
440 Ga0070672_100066897
441 Ga0070695_100047492
442 Ga0070695_100178869
443 Ga0070665_100079258
444 Ga0070665_100584048
445 Ga0068855_100012488
446 Ga0068855_100081174
447 Ga0068855_100105949
448 Ga0068855_100241872
449 Ga0070664_100215544
450 Ga0068857_100002376
451 Ga0068854_100103134
452 Ga0068856_100001387
453 Ga0068856_100015428
454 Ga0068856_100027974
455 Ga0068856_100164939
456 Ga0068852_100000734
457 Ga0068852_100076953
458 Ga0068852_100227092
459 Ga0068852_100322110
460 Ga0068859_100766539
461 Ga0068864_100007120
462 Ga0068863_100042269
463 Ga0068863_100176535
464 Ga0068863_100375689
465 Ga0068858_100001977
466 Ga0068858_100002635
467 Ga0068858_100089878
468 Ga0068858_100628631
469 Ga0068858_100752002
470 Ga0068860_100064996
471 Ga0068860_100536302
472 Ga0068860_100782282
473 Ga0097621_100002357
474 Ga0097621_100150164
475 Ga0097621_100183256
476 Ga0097621_100183658
477 Ga0097621_100360465
478 Ga0097621_100417623
479 Ga0068871_100024815
480 Ga0068871_100031805
481 Ga0068871_100232883
482 Ga0068871_101308921
483 Ga0097620_100147581
484 Ga0097620_100766544
485 Ga0105240_10001736
486 Ga0105240_10030474
487 Ga0105240_10102956
488 Ga0105240_10425731
489 Ga0105245_10008991
490 Ga0105245_10029033
491 Ga0105245_10118000
492 Ga0105245_10469972
493 Ga0105245_10951370
494 Ga0105247_10269414
495 Ga0105243_10692246
496 Ga0105241_10001793
497 Ga0105241_10034281
498 Ga0105241_10057364
499 Ga0105241_10121364
500 Ga0105242_10119615
501 Ga0105242_10127081
502 Ga0105242_10372940
503 Ga0105242_10916680
504 Ga0105242_11110217
505 Ga0105248_10003545
506 Ga0105248_10015043
507 Ga0105248_10156610
508 Ga0105248_10213283
509 Ga0105248_10219222
510 Ga0105248_10739969
511 Ga0105248_11025827
512 Ga0105237_10001210
513 Ga0105237_10123999
514 Ga0105237_10195275
515 Ga0105237_10589701
516 Ga0105237_11364063
517 Ga0105238_10000215
518 Ga0105238_10026771
519 Ga0105238_10088180
520 Ga0105238_10123321
521 Ga0105238_11234129
522 Ga0105249_10525861
523 Ga0105239_10005525
524 Ga0105239_10013336
525 Ga0105239_10028283
526 Ga0105239_10055261
527 Ga0105239_10139643
528 Ga0105239_10512705
529 Ga0105246_10102074
530 Ga0157373_10092725
531 Ga0157373_10392407
532 Ga0157370_10006603
533 Ga0157370_10032357
534 Ga0157370_10046934
535 Ga0157370_10151045
536 Ga0157369_10002765
537 Ga0157369_10022296
538 Ga0157369_10038924
539 Ga0157369_10070704
540 Ga0157369_10102960
541 Ga0157374_10134732
542 Ga0157374_10327709
543 Ga0157374_10372767
544 Ga0157374_10467168
545 Ga0157374_10848511
546 Ga0157378_10002179
547 Ga0157378_10190334
548 Ga0163162_10008251
549 Ga0163162_10016432
550 Ga0163162_10539924
551 Ga0157372_10002416
552 Ga0157372_10004717
553 Ga0157372_10033685
554 Ga0157372_10097683
555 Ga0157372_10098432
556 Ga0157375_10033573
557 Ga0157375_10105878
558 Ga0157375_10588668
559 Ga0163163_10000013
560 Ga0163163_10003294
561 Ga0163163_10390206
562 Ga0157377_10615792
563 Ga0157379_10133370
564 Ga0157379_10240432
565 Ga0157376_10088090
566 Ga0157376_10089645
567 Ga0157376_10614024
568 Ga0182005_1074267
569 Ga0197907_10278228
570 Ga0206356_10618134
571 Ga0206355_1149535
572 Ga0206355_1272373
573 Ga0206351_10605603
574 Ga0206352_10909494
575 Ga0206350_11534743
576 Ga0206354_10443071
577 Ga0206353_11608898
578 Ga0224712_10014327
579 Ga0207699_10100879
580 Ga0207705_10025157
581 Ga0207705_10279765
582 Ga0207654_10015183
583 Ga0207654_10015975
584 Ga0207654_10134885
585 Ga0207654_10516988
586 Ga0207707_10000219
587 Ga0207707_10024835
588 Ga0207707_10091893
589 Ga0207707_10225941
590 Ga0207707_10291904
591 Ga0207695_10000302
592 Ga0207695_10014492
593 Ga0207695_10031391
594 Ga0207695_10080935
595 Ga0207695_10168016
596 Ga0207671_10022854
597 Ga0207671_10146442
598 Ga0207671_10578701
599 Ga0207663_10544386
600 Ga0207660_10003568
601 Ga0207660_10426951
602 Ga0207660_10497079
603 Ga0207657_10002777
604 Ga0207657_10036965
605 Ga0207649_10213332
606 Ga0207652_10004390
607 Ga0207652_10018402
608 Ga0207652_10060641
609 Ga0207652_10664102
610 Ga0207694_10004081
611 Ga0207694_10012732
612 Ga0207694_10075864
613 Ga0207694_10088901
614 Ga0207659_10742207
615 Ga0207687_10015122
616 Ga0207687_10045867
617 Ga0207687_10068983
618 Ga0207700_10158634
619 Ga0207664_10436308
620 Ga0207686_10004566
621 Ga0207686_10318617
622 Ga0207686_10777896
623 Ga0207709_10059508
624 Ga0207670_10076237
625 Ga0207691_10088512
626 Ga0207711_10000770
627 Ga0207711_10005484
628 Ga0207711_10011066
629 Ga0207711_10132227
630 Ga0207711_10848716
631 Ga0207711_11273830
632 Ga0207661_10009464
633 Ga0207667_10000265
634 Ga0207667_10049529
635 Ga0207667_10255473
636 Ga0207667_10464426
637 Ga0207658_10089008
638 Ga0207703_10001119
639 Ga0207703_10005876
640 Ga0207703_10444405
641 Ga0207703_10451215
642 Ga0207703_10672733
643 Ga0207639_10456767
644 Ga0207702_10005730
645 Ga0207702_10101527
646 Ga0207641_10100995
647 Ga0207641_10298596
648 Ga0207648_10016908
649 Ga0207676_10012040
650 Ga0207674_10000659
651 Ga0207674_10577314
652 Ga0207683_10375377
653 Ga0207698_10038769
654 Ga0207698_10109064
655 Ga0207698_10185798
656 Ga0207698_10524869
657 Ga0265354_1002087
658 Ga0265357_1000992
659 Ga0265357_1018864
660 Ga0268266_10704585
661 Ga0268264_10139783
662 Ga0268264_10291789
663 Ga0265323_10002017
664 Ga0265336_10004100
665 Ga0265338_10002847
666 Ga0265338_10007559
667 Ga0265338_10030754
668 Ga0265338_10053721
669 Ga0265338_10053809
670 Ga0265338_10083607
671 Ga0265338_10107231
672 Ga0265338_10132035
673 Ga0265338_10301631
674 Ga0265338_10444308
675 Ga0265338_10518728
676 Ga0265338_10579021
677 Ga0265324_10074748
678 Ga0265762_1052249
679 Ga0265762_1056305
680 Ga0265775_101636
681 Ga0265770_1005235
682 Ga0265770_1012424
683 Ga0265765_1005027
684 Ga0265776_100297
685 Ga0265779_103664
686 Ga0265760_10010207
687 Ga0265760_10014130
688 Ga0265760_10018505
689 Ga0265760_10055975
690 Ga0265330_10000634
691 Ga0265332_10082618
692 Ga0265328_10043906
693 Ga0265328_10240165
694 Ga0265320_10240866
695 Ga0265325_10000405
696 Ga0265325_10001212
697 Ga0265325_10010463
698 Ga0265329_10021039
699 Ga0265329_10084684
700 Ga0265340_10007309
701 Ga0265340_10072683
702 Ga0265339_10000722
703 Ga0265339_10002496
704 Ga0265339_10113032
705 Ga0265339_10184915
706 Ga0265339_10285000
707 Ga0265316_10004235
708 Ga0265316_10014810
709 Ga0265316_10017604
710 Ga0265316_10029078
711 Ga0265316_10065600
712 Ga0265316_10173510
713 Ga0265316_10804529
714 Ga0265313_10000786
715 Ga0265313_10007549
716 Ga0265314_10007592
717 Ga0265314_10031880
718 Ga0265314_10091119
719 Ga0265314_10104268
720 Ga0265342_10000730
721 Ga0265342_10001626
722 Ga0265342_10027551
723 Ga0265342_10365629
724 Ga0307516_10701841
725 Ga0316215_1018060
726 Ga0316212_1005144
727 Ga0373953_0062110
728 Ga0373954_0159229
729 Ga0373935_0193888
730 Ga0373935_0546030
731 Ga0373947_1006663
732 Ga0373937_0570437
733 Ga0265778_007635
734 Ga0436364_0691216
735 Ga0436364_0697091
736 Ga0451577_0476486
737 Ga0453684_0455782
738 Ga0451576_0019929
739 Ga0495592_0012278
740 Ga0495592_0210745
741 Ga0495629_0361433
742 Ga0495641_0054021
743 Ga0495651_0018393
744 Ga0495653_0024189
745 Ga0495580_0027969
746 Ga0495580_0127656
747 Ga0495580_0127817
748 Ga0495580_0208397
749 Ga0495580_0353773
750 Ga0495580_0365948
751 Ga0495580_0944820
752 Ga0495582_0009725
753 Ga0495582_0177717
754 Ga0495582_0222552
755 Ga0495639_0035791
756 Ga0495662_0043352
757 Ga0495664_0326432
758 Ga0495594_0042778
759 Ga0495618_0016891
760 Ga0495628_0003428
761 Ga0495628_0277744
762 Ga0495630_0090420
763 Ga0495630_0124802
764 Ga0495666_0025423
765 Ga0495652_0003457
766 Ga0495665_0052027
767 Ga0495640_0038142
768 Ga0495586_0007286
769 Ga0495587_0000962
770 Ga0495645_0074662
771 Ga0495622_0192491
772 Ga0495667_0008119
773 Ga0495634_0102556
774 Ga0495634_0198245
775 Ga0495634_0318465
776 Ga0495635_0030611
777 Ga0495657_0011844
778 Ga0495599_0077064
779 Ga0495623_0397408
780 Ga0495647_0021135
781 Ga0495647_0174689
782 Ga0495658_0179342
783 Ga0495613_0005346
784 Ga0495624_0073648
785 Ga0495581_0091551
786 Ga0495604_0000617
787 Ga0495674_0005014
788 Ga0495674_0107465
789 Ga0495676_0215569
790 Ga0495680_0011742
791 Ga0495680_0039551
792 Ga0495680_0093697
793 Ga0495675_0000013
794 Ga0495684_0002370
795 Ga0495684_0024820
796 Ga0495602_0730524
797 Ga0496102_0590121
798 Ga0496104_0841624
799 Ga0496105_0161102
800 Ga0496105_0545930
801 Ga0496114_0430918
802 Ga0495601_0479235

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04972

BON

BON domain

122

189

0.96

PF04972

BON

BON domain

44

109

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcm-assembly1.cif.gz_A crystal structure of ginko1 0.814 26 86
7vcm-assembly2.cif.gz_B crystal structure of ginko1 0.8133 26 86
7pvc-assembly1.cif.gz_A the structure of kbp.k from e. coli with potassium bound. 0.7687 26 89
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.7535 106 168
7pda-assembly1.cif.gz_A crystal structure of phenazine 1-carboxylic acid decarboxylase from mycobacterium fortuitum 0.7321 26 77
ID Description Score Start End Superfamily
af_P0AFH8_57_122_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.9623 105 165 3.30.1340.30
af_P0AFH8_137_201_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.9579 106 165 3.30.1340.30
af_P64596_124_191_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9478 103 165 3.30.70.330
af_P64596_46_115_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.9437 103 165 3.30.1340.30
af_P0AFH8_57_122_3.30.1340.30 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; 0.8784 105 165 3.30.1340.30
ID Description Score Start End GO Terms
AF-A0A7K1QGQ6-F1-model_v4 deleted 0.9764 103 165
AF-A0A6I1QRK5-F1-model_v4 AAA family ATPase 0.9762 103 165 GO:0016020
GO:0016887
AF-A0A3N5HQZ4-F1-model_v4 BON domain-containing protein 0.9619 103 165 GO:0016887
AF-A0A7C5VBW6-F1-model_v4 OmpA-like domain-containing protein 0.9589 93 165 GO:0009279
AF-A0A7C7Y1U3-F1-model_v4 BON domain-containing protein 0.9582 99 165

Map