F434874
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 401 | 194 | 802 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300031240|Ga0265320_10038755|Ga0265320_100387552 |
| Length | 196 |
| Sequence | MLPNPGLGAAQRTYMKTTKLFVILLTMVAIGTVVGCSRFSAKSPDVSDSIRKSLDQAGLKDVTVSQDRDKGIVTLGGQVATDDQKAQAESLAKSFAGTEVVADQIAVISVGQEKEAKAVNSDLDQAIEKNLDAALIQNKMHNNVKYSVKSGVVTLTGEVNSQDKRTRAEKVAAGVPNVQQVVNNLQVKNQKATSQQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 72 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 112 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 116 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 132 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 138 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 139 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 140 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 141 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.52 |
| Metatranscriptomes | 6.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.25 |
| Rhizosphere | 97.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265320_10038755 | 3300031240 | Unclassified | 2389 |
| 2 | Ga0058863_11371726 | 3300004799 | Unclassified | 817 |
| 3 | Ga0058861_10952810 | 3300004800 | Bacteria | 905 |
| 4 | Ga0058862_11724197 | 3300004803 | Bacteria | 795 |
| 5 | Ga0070658_10095617 | 3300005327 | Bacteria | 2452 |
| 6 | Ga0070683_100002650 | 3300005329 | Bacteria | 14309 |
| 7 | Ga0068869_100550003 | 3300005334 | Bacteria | 969 |
| 8 | Ga0070680_100004543 | 3300005336 | Bacteria | 10440 |
| 9 | Ga0070680_100615281 | 3300005336 | Unclassified | 933 |
| 10 | Ga0070682_100091273 | 3300005337 | Unclassified | 1993 |
| 11 | Ga0070660_100001145 | 3300005339 | Bacteria | 17888 |
| 12 | Ga0070660_100613048 | 3300005339 | Bacteria | 910 |
| 13 | Ga0070689_100173270 | 3300005340 | Bacteria | 1749 |
| 14 | Ga0070689_100692573 | 3300005340 | Bacteria | 889 |
| 15 | Ga0070661_100072241 | 3300005344 | Unclassified | 2539 |
| 16 | Ga0070661_100300289 | 3300005344 | Unclassified | 1250 |
| 17 | Ga0070675_100918868 | 3300005354 | Bacteria | 802 |
| 18 | Ga0070674_100522928 | 3300005356 | Bacteria | 991 |
| 19 | Ga0070673_101428663 | 3300005364 | Unclassified | 651 |
| 20 | Ga0070714_100323569 | 3300005435 | Bacteria | 1442 |
| 21 | Ga0070713_100299108 | 3300005436 | Bacteria | 1481 |
| 22 | Ga0070713_100671904 | 3300005436 | Unclassified | 988 |
| 23 | Ga0070713_101114766 | 3300005436 | Unclassified | 763 |
| 24 | Ga0070710_10527771 | 3300005437 | Bacteria | 812 |
| 25 | Ga0070711_100323078 | 3300005439 | Bacteria | 1234 |
| 26 | Ga0070711_100799036 | 3300005439 | Unclassified | 800 |
| 27 | Ga0070708_100008831 | 3300005445 | Bacteria | 8110 |
| 28 | Ga0070678_100333111 | 3300005456 | Unclassified | 1300 |
| 29 | Ga0070681_10000538 | 3300005458 | Bacteria | 31151 |
| 30 | Ga0070681_10014586 | 3300005458 | Bacteria | 7820 |
| 31 | Ga0070681_10071729 | 3300005458 | Plasmid | 3428 |
| 32 | Ga0070681_10271994 | 3300005458 | Bacteria | 1606 |
| 33 | Ga0068867_100196198 | 3300005459 | Bacteria | 1614 |
| 34 | Ga0070685_10622320 | 3300005466 | Bacteria | 779 |
| 35 | Ga0070679_100008345 | 3300005530 | Bacteria | 9746 |
| 36 | Ga0070679_100565364 | 3300005530 | Bacteria | 1081 |
| 37 | Ga0070684_100001024 | 3300005535 | Bacteria | 19931 |
| 38 | Ga0070684_100909610 | 3300005535 | Bacteria | 824 |
| 39 | Ga0070672_100066897 | 3300005543 | Bacteria | 2846 |
| 40 | Ga0070695_100047492 | 3300005545 | Bacteria | 2742 |
| 41 | Ga0070695_100178869 | 3300005545 | Bacteria | 1501 |
| 42 | Ga0070665_100079258 | 3300005548 | Bacteria | 3291 |
| 43 | Ga0070665_100584048 | 3300005548 | Unclassified | 1130 |
| 44 | Ga0068855_100012488 | 3300005563 | Bacteria | 10252 |
| 45 | Ga0068855_100081174 | 3300005563 | Unclassified | 3759 |
| 46 | Ga0068855_100105949 | 3300005563 | Bacteria | 3232 |
| 47 | Ga0068855_100241872 | 3300005563 | Bacteria | 2016 |
| 48 | Ga0070664_100215544 | 3300005564 | Unclassified | 1716 |
| 49 | Ga0068857_100002376 | 3300005577 | Bacteria | 15344 |
| 50 | Ga0068854_100103134 | 3300005578 | Bacteria | 2141 |
| 51 | Ga0068856_100001387 | 3300005614 | Bacteria | 25456 |
| 52 | Ga0068856_100015428 | 3300005614 | Bacteria | 7383 |
| 53 | Ga0068856_100027974 | 3300005614 | Bacteria | 5500 |
| 54 | Ga0068856_100164939 | 3300005614 | Bacteria | 2226 |
| 55 | Ga0068852_100000734 | 3300005616 | Bacteria | 21507 |
| 56 | Ga0068852_100076953 | 3300005616 | Bacteria | 2947 |
| 57 | Ga0068852_100227092 | 3300005616 | Bacteria | 1778 |
| 58 | Ga0068852_100322110 | 3300005616 | Bacteria | 1501 |
| 59 | Ga0068859_100766539 | 3300005617 | Bacteria | 1053 |
| 60 | Ga0068864_100007120 | 3300005618 | Bacteria | 9187 |
| 61 | Ga0068863_100042269 | 3300005841 | Unclassified | 4331 |
| 62 | Ga0068863_100176535 | 3300005841 | Bacteria | 2050 |
| 63 | Ga0068863_100375689 | 3300005841 | Bacteria | 1387 |
| 64 | Ga0068858_100001977 | 3300005842 | Bacteria | 20940 |
| 65 | Ga0068858_100002635 | 3300005842 | Bacteria | 18074 |
| 66 | Ga0068858_100089878 | 3300005842 | Bacteria | 2857 |
| 67 | Ga0068858_100628631 | 3300005842 | Unclassified | 1043 |
| 68 | Ga0068858_100752002 | 3300005842 | Unclassified | 950 |
| 69 | Ga0068860_100064996 | 3300005843 | Bacteria | 3465 |
| 70 | Ga0068860_100536302 | 3300005843 | Bacteria | 1171 |
| 71 | Ga0068860_100782282 | 3300005843 | Unclassified | 967 |
| 72 | Ga0097621_100002357 | 3300006237 | Bacteria | 12949 |
| 73 | Ga0097621_100150164 | 3300006237 | Bacteria | 1998 |
| 74 | Ga0097621_100183256 | 3300006237 | Unclassified | 1810 |
| 75 | Ga0097621_100183658 | 3300006237 | Bacteria | 1808 |
| 76 | Ga0097621_100360465 | 3300006237 | Unclassified | 1295 |
| 77 | Ga0097621_100417623 | 3300006237 | Unclassified | 1203 |
| 78 | Ga0068871_100024815 | 3300006358 | Bacteria | 4654 |
| 79 | Ga0068871_100031805 | 3300006358 | Bacteria | 4163 |
| 80 | Ga0068871_100232883 | 3300006358 | Bacteria | 1599 |
| 81 | Ga0068871_101308921 | 3300006358 | Unclassified | 682 |
| 82 | Ga0097620_100147581 | 3300006931 | Bacteria | 2427 |
| 83 | Ga0097620_100766544 | 3300006931 | Bacteria | 1053 |
| 84 | Ga0105240_10001736 | 3300009093 | Bacteria | 36803 |
| 85 | Ga0105240_10030474 | 3300009093 | Bacteria | 7012 |
| 86 | Ga0105240_10102956 | 3300009093 | Bacteria | 3469 |
| 87 | Ga0105240_10425731 | 3300009093 | Bacteria | 1490 |
| 88 | Ga0105245_10008991 | 3300009098 | Bacteria | 8714 |
| 89 | Ga0105245_10029033 | 3300009098 | Bacteria | 4885 |
| 90 | Ga0105245_10118000 | 3300009098 | Bacteria | 2476 |
| 91 | Ga0105245_10469972 | 3300009098 | Unclassified | 1269 |
| 92 | Ga0105245_10951370 | 3300009098 | Bacteria | 902 |
| 93 | Ga0105247_10269414 | 3300009101 | Unclassified | 1171 |
| 94 | Ga0105243_10692246 | 3300009148 | Bacteria | 992 |
| 95 | Ga0105241_10001793 | 3300009174 | Bacteria | 16305 |
| 96 | Ga0105241_10034281 | 3300009174 | Unclassified | 3813 |
| 97 | Ga0105241_10057364 | 3300009174 | Bacteria | 2987 |
| 98 | Ga0105241_10121364 | 3300009174 | Unclassified | 2105 |
| 99 | Ga0105242_10119615 | 3300009176 | Bacteria | 2258 |
| 100 | Ga0105242_10127081 | 3300009176 | Unclassified | 2195 |
| 101 | Ga0105242_10372940 | 3300009176 | Bacteria | 1324 |
| 102 | Ga0105242_10916680 | 3300009176 | Bacteria | 878 |
| 103 | Ga0105242_11110217 | 3300009176 | Bacteria | 805 |
| 104 | Ga0105248_10003545 | 3300009177 | Bacteria | 17298 |
| 105 | Ga0105248_10015043 | 3300009177 | Bacteria | 8519 |
| 106 | Ga0105248_10156610 | 3300009177 | Bacteria | 2571 |
| 107 | Ga0105248_10213283 | 3300009177 | Unclassified | 2175 |
| 108 | Ga0105248_10219222 | 3300009177 | Bacteria | 2142 |
| 109 | Ga0105248_10739969 | 3300009177 | Bacteria | 1109 |
| 110 | Ga0105248_11025827 | 3300009177 | Bacteria | 932 |
| 111 | Ga0105237_10001210 | 3300009545 | Bacteria | 34539 |
| 112 | Ga0105237_10123999 | 3300009545 | Unclassified | 2578 |
| 113 | Ga0105237_10195275 | 3300009545 | Bacteria | 2023 |
| 114 | Ga0105237_10589701 | 3300009545 | Bacteria | 1118 |
| 115 | Ga0105237_11364063 | 3300009545 | Unclassified | 715 |
| 116 | Ga0105238_10000215 | 3300009551 | Bacteria | 64004 |
| 117 | Ga0105238_10026771 | 3300009551 | Bacteria | 5878 |
| 118 | Ga0105238_10088180 | 3300009551 | Bacteria | 3089 |
| 119 | Ga0105238_10123321 | 3300009551 | Bacteria | 2570 |
| 120 | Ga0105238_11234129 | 3300009551 | Unclassified | 772 |
| 121 | Ga0105249_10525861 | 3300009553 | Bacteria | 1231 |
| 122 | Ga0105239_10005525 | 3300010375 | Bacteria | 14805 |
| 123 | Ga0105239_10013336 | 3300010375 | Bacteria | 9132 |
| 124 | Ga0105239_10028283 | 3300010375 | Bacteria | 6167 |
| 125 | Ga0105239_10055261 | 3300010375 | Bacteria | 4354 |
| 126 | Ga0105239_10139643 | 3300010375 | Bacteria | 2699 |
| 127 | Ga0105239_10512705 | 3300010375 | Bacteria | 1364 |
| 128 | Ga0105246_10102074 | 3300011119 | Bacteria | 2091 |
| 129 | Ga0157373_10092725 | 3300013100 | Unclassified | 2127 |
| 130 | Ga0157373_10392407 | 3300013100 | Unclassified | 994 |
| 131 | Ga0157370_10006603 | 3300013104 | Bacteria | 12754 |
| 132 | Ga0157370_10032357 | 3300013104 | Bacteria | 5107 |
| 133 | Ga0157370_10046934 | 3300013104 | Bacteria | 4141 |
| 134 | Ga0157370_10151045 | 3300013104 | Bacteria | 2161 |
| 135 | Ga0157369_10002765 | 3300013105 | Bacteria | 20952 |
| 136 | Ga0157369_10022296 | 3300013105 | Bacteria | 7070 |
| 137 | Ga0157369_10038924 | 3300013105 | Bacteria | 5198 |
| 138 | Ga0157369_10070704 | 3300013105 | Unclassified | 3749 |
| 139 | Ga0157369_10102960 | 3300013105 | Bacteria | 3041 |
| 140 | Ga0157374_10134732 | 3300013296 | Unclassified | 2393 |
| 141 | Ga0157374_10327709 | 3300013296 | Bacteria | 1518 |
| 142 | Ga0157374_10372767 | 3300013296 | Unclassified | 1421 |
| 143 | Ga0157374_10467168 | 3300013296 | Bacteria | 1264 |
| 144 | Ga0157374_10848511 | 3300013296 | Unclassified | 930 |
| 145 | Ga0157378_10002179 | 3300013297 | Bacteria | 17362 |
| 146 | Ga0157378_10190334 | 3300013297 | Bacteria | 1935 |
| 147 | Ga0163162_10008251 | 3300013306 | Bacteria | 10167 |
| 148 | Ga0163162_10016432 | 3300013306 | Bacteria | 7231 |
| 149 | Ga0163162_10539924 | 3300013306 | Unclassified | 1295 |
| 150 | Ga0157372_10002416 | 3300013307 | Bacteria | 20223 |
| 151 | Ga0157372_10004717 | 3300013307 | Bacteria | 14483 |
| 152 | Ga0157372_10033685 | 3300013307 | Bacteria | 5628 |
| 153 | Ga0157372_10097683 | 3300013307 | Bacteria | 3350 |
| 154 | Ga0157372_10098432 | 3300013307 | Unclassified | 3337 |
| 155 | Ga0157375_10033573 | 3300013308 | Bacteria | 4877 |
| 156 | Ga0157375_10105878 | 3300013308 | Bacteria | 2904 |
| 157 | Ga0157375_10588668 | 3300013308 | Bacteria | 1272 |
| 158 | Ga0163163_10000013 | 3300014325 | Bacteria | 242522 |
| 159 | Ga0163163_10003294 | 3300014325 | Bacteria | 13699 |
| 160 | Ga0163163_10390206 | 3300014325 | Unclassified | 1450 |
| 161 | Ga0157377_10615792 | 3300014745 | Unclassified | 777 |
| 162 | Ga0157379_10133370 | 3300014968 | Bacteria | 2237 |
| 163 | Ga0157379_10240432 | 3300014968 | Bacteria | 1642 |
| 164 | Ga0157376_10088090 | 3300014969 | Unclassified | 2680 |
| 165 | Ga0157376_10089645 | 3300014969 | Bacteria | 2659 |
| 166 | Ga0157376_10614024 | 3300014969 | Bacteria | 1084 |
| 167 | Ga0182005_1074267 | 3300015265 | Unclassified | 935 |
| 168 | Ga0197907_10278228 | 3300020069 | Bacteria | 1346 |
| 169 | Ga0206356_10618134 | 3300020070 | Bacteria | 5760 |
| 170 | Ga0206355_1149535 | 3300020076 | Unclassified | 1061 |
| 171 | Ga0206355_1272373 | 3300020076 | Bacteria | 853 |
| 172 | Ga0206351_10605603 | 3300020077 | Bacteria | 771 |
| 173 | Ga0206352_10909494 | 3300020078 | Bacteria | 5773 |
| 174 | Ga0206350_11534743 | 3300020080 | Bacteria | 1494 |
| 175 | Ga0206354_10443071 | 3300020081 | Bacteria | 1423 |
| 176 | Ga0206353_11608898 | 3300020082 | Bacteria | 1364 |
| 177 | Ga0224712_10014327 | 3300022467 | Unclassified | 2549 |
| 178 | Ga0207699_10100879 | 3300025906 | Bacteria | 1831 |
| 179 | Ga0207705_10025157 | 3300025909 | Bacteria | 4250 |
| 180 | Ga0207705_10279765 | 3300025909 | Unclassified | 1277 |
| 181 | Ga0207654_10015183 | 3300025911 | Bacteria | 3992 |
| 182 | Ga0207654_10015975 | 3300025911 | Unclassified | 3903 |
| 183 | Ga0207654_10134885 | 3300025911 | Bacteria | 1567 |
| 184 | Ga0207654_10516988 | 3300025911 | Unclassified | 845 |
| 185 | Ga0207707_10000219 | 3300025912 | Bacteria | 61663 |
| 186 | Ga0207707_10024835 | 3300025912 | Bacteria | 5242 |
| 187 | Ga0207707_10091893 | 3300025912 | Bacteria | 2652 |
| 188 | Ga0207707_10225941 | 3300025912 | Bacteria | 1629 |
| 189 | Ga0207707_10291904 | 3300025912 | Bacteria | 1411 |
| 190 | Ga0207695_10000302 | 3300025913 | Bacteria | 121140 |
| 191 | Ga0207695_10014492 | 3300025913 | Bacteria | 9332 |
| 192 | Ga0207695_10031391 | 3300025913 | Bacteria | 5826 |
| 193 | Ga0207695_10080935 | 3300025913 | Unclassified | 3288 |
| 194 | Ga0207695_10168016 | 3300025913 | Bacteria | 2121 |
| 195 | Ga0207671_10022854 | 3300025914 | Unclassified | 4722 |
| 196 | Ga0207671_10146442 | 3300025914 | Unclassified | 1822 |
| 197 | Ga0207671_10578701 | 3300025914 | Bacteria | 895 |
| 198 | Ga0207663_10544386 | 3300025916 | Bacteria | 907 |
| 199 | Ga0207660_10003568 | 3300025917 | Bacteria | 10135 |
| 200 | Ga0207660_10426951 | 3300025917 | Unclassified | 1070 |
| 201 | Ga0207660_10497079 | 3300025917 | Unclassified | 989 |
| 202 | Ga0207657_10002777 | 3300025919 | Bacteria | 18861 |
| 203 | Ga0207657_10036965 | 3300025919 | Bacteria | 4366 |
| 204 | Ga0207649_10213332 | 3300025920 | Unclassified | 1371 |
| 205 | Ga0207652_10004390 | 3300025921 | Bacteria | 11486 |
| 206 | Ga0207652_10018402 | 3300025921 | Bacteria | 5729 |
| 207 | Ga0207652_10060641 | 3300025921 | Bacteria | 3264 |
| 208 | Ga0207652_10664102 | 3300025921 | Bacteria | 932 |
| 209 | Ga0207694_10004081 | 3300025924 | Bacteria | 11480 |
| 210 | Ga0207694_10012732 | 3300025924 | Bacteria | 6336 |
| 211 | Ga0207694_10075864 | 3300025924 | Bacteria | 2632 |
| 212 | Ga0207694_10088901 | 3300025924 | Unclassified | 2435 |
| 213 | Ga0207659_10742207 | 3300025926 | Bacteria | 842 |
| 214 | Ga0207687_10015122 | 3300025927 | Bacteria | 5057 |
| 215 | Ga0207687_10045867 | 3300025927 | Bacteria | 3023 |
| 216 | Ga0207687_10068983 | 3300025927 | Bacteria | 2520 |
| 217 | Ga0207700_10158634 | 3300025928 | Bacteria | 1877 |
| 218 | Ga0207664_10436308 | 3300025929 | Bacteria | 1168 |
| 219 | Ga0207686_10004566 | 3300025934 | Bacteria | 7419 |
| 220 | Ga0207686_10318617 | 3300025934 | Bacteria | 1161 |
| 221 | Ga0207686_10777896 | 3300025934 | Bacteria | 766 |
| 222 | Ga0207709_10059508 | 3300025935 | Bacteria | 2378 |
| 223 | Ga0207670_10076237 | 3300025936 | Bacteria | 2333 |
| 224 | Ga0207691_10088512 | 3300025940 | Bacteria | 2777 |
| 225 | Ga0207711_10000770 | 3300025941 | Bacteria | 31501 |
| 226 | Ga0207711_10005484 | 3300025941 | Bacteria | 10723 |
| 227 | Ga0207711_10011066 | 3300025941 | Bacteria | 7498 |
| 228 | Ga0207711_10132227 | 3300025941 | Bacteria | 2238 |
| 229 | Ga0207711_10848716 | 3300025941 | Unclassified | 850 |
| 230 | Ga0207711_11273830 | 3300025941 | Bacteria | 677 |
| 231 | Ga0207661_10009464 | 3300025944 | Bacteria | 6987 |
| 232 | Ga0207667_10000265 | 3300025949 | Bacteria | 72799 |
| 233 | Ga0207667_10049529 | 3300025949 | Bacteria | 4436 |
| 234 | Ga0207667_10255473 | 3300025949 | Bacteria | 1792 |
| 235 | Ga0207667_10464426 | 3300025949 | Bacteria | 1285 |
| 236 | Ga0207658_10089008 | 3300025986 | Bacteria | 2389 |
| 237 | Ga0207703_10001119 | 3300026035 | Bacteria | 25314 |
| 238 | Ga0207703_10005876 | 3300026035 | Bacteria | 9831 |
| 239 | Ga0207703_10444405 | 3300026035 | Bacteria | 1210 |
| 240 | Ga0207703_10451215 | 3300026035 | Unclassified | 1201 |
| 241 | Ga0207703_10672733 | 3300026035 | Bacteria | 983 |
| 242 | Ga0207639_10456767 | 3300026041 | Unclassified | 1160 |
| 243 | Ga0207702_10005730 | 3300026078 | Bacteria | 10826 |
| 244 | Ga0207702_10101527 | 3300026078 | Bacteria | 2540 |
| 245 | Ga0207641_10100995 | 3300026088 | Unclassified | 2541 |
| 246 | Ga0207641_10298596 | 3300026088 | Bacteria | 1521 |
| 247 | Ga0207648_10016908 | 3300026089 | Bacteria | 6648 |
| 248 | Ga0207676_10012040 | 3300026095 | Bacteria | 6190 |
| 249 | Ga0207674_10000659 | 3300026116 | Bacteria | 44890 |
| 250 | Ga0207674_10577314 | 3300026116 | Unclassified | 1086 |
| 251 | Ga0207683_10375377 | 3300026121 | Unclassified | 1307 |
| 252 | Ga0207698_10038769 | 3300026142 | Bacteria | 3524 |
| 253 | Ga0207698_10109064 | 3300026142 | Bacteria | 2315 |
| 254 | Ga0207698_10185798 | 3300026142 | Bacteria | 1846 |
| 255 | Ga0207698_10524869 | 3300026142 | Unclassified | 1156 |
| 256 | Ga0265354_1002087 | 3300028016 | Bacteria | 2592 |
| 257 | Ga0265357_1000992 | 3300028023 | Bacteria | 1939 |
| 258 | Ga0265357_1018864 | 3300028023 | Bacteria | 746 |
| 259 | Ga0268266_10704585 | 3300028379 | Bacteria | 973 |
| 260 | Ga0268264_10139783 | 3300028381 | Unclassified | 2158 |
| 261 | Ga0268264_10291789 | 3300028381 | Bacteria | 1532 |
| 262 | Ga0265323_10002017 | 3300028653 | Bacteria | 9559 |
| 263 | Ga0265336_10004100 | 3300028666 | Bacteria | 5549 |
| 264 | Ga0265338_10002847 | 3300028800 | Bacteria | 25282 |
| 265 | Ga0265338_10007559 | 3300028800 | Bacteria | 13437 |
| 266 | Ga0265338_10030754 | 3300028800 | Bacteria | 5279 |
| 267 | Ga0265338_10053721 | 3300028800 | Unclassified | 3600 |
| 268 | Ga0265338_10053809 | 3300028800 | Unclassified | 3596 |
| 269 | Ga0265338_10083607 | 3300028800 | Bacteria | 2669 |
| 270 | Ga0265338_10107231 | 3300028800 | Bacteria | 2259 |
| 271 | Ga0265338_10132035 | 3300028800 | Bacteria | 1970 |
| 272 | Ga0265338_10301631 | 3300028800 | Bacteria | 1164 |
| 273 | Ga0265338_10444308 | 3300028800 | Unclassified | 919 |
| 274 | Ga0265338_10518728 | 3300028800 | Unclassified | 837 |
| 275 | Ga0265338_10579021 | 3300028800 | Bacteria | 783 |
| 276 | Ga0265324_10074748 | 3300029957 | Unclassified | 1153 |
| 277 | Ga0265762_1052249 | 3300030760 | Bacteria | 823 |
| 278 | Ga0265762_1056305 | 3300030760 | Unclassified | 799 |
| 279 | Ga0265775_101636 | 3300030762 | Unclassified | 1090 |
| 280 | Ga0265770_1005235 | 3300030878 | Unclassified | 1782 |
| 281 | Ga0265770_1012424 | 3300030878 | Unclassified | 1262 |
| 282 | Ga0265765_1005027 | 3300030879 | Unclassified | 1376 |
| 283 | Ga0265776_100297 | 3300030880 | Unclassified | 1710 |
| 284 | Ga0265779_103664 | 3300031043 | Unclassified | 791 |
| 285 | Ga0265760_10010207 | 3300031090 | Unclassified | 2678 |
| 286 | Ga0265760_10014130 | 3300031090 | Unclassified | 2285 |
| 287 | Ga0265760_10018505 | 3300031090 | Bacteria | 2007 |
| 288 | Ga0265760_10055975 | 3300031090 | Unclassified | 1193 |
| 289 | Ga0265330_10000634 | 3300031235 | Bacteria | 22572 |
| 290 | Ga0265332_10082618 | 3300031238 | Bacteria | 1362 |
| 291 | Ga0265328_10043906 | 3300031239 | Unclassified | 1644 |
| 292 | Ga0265328_10240165 | 3300031239 | Bacteria | 692 |
| 293 | Ga0265320_10240866 | 3300031240 | Unclassified | 803 |
| 294 | Ga0265325_10000405 | 3300031241 | Bacteria | 30621 |
| 295 | Ga0265325_10001212 | 3300031241 | Bacteria | 18356 |
| 296 | Ga0265325_10010463 | 3300031241 | Bacteria | 5371 |
| 297 | Ga0265329_10021039 | 3300031242 | Bacteria | 2195 |
| 298 | Ga0265329_10084684 | 3300031242 | Bacteria | 1004 |
| 299 | Ga0265340_10007309 | 3300031247 | Bacteria | 6002 |
| 300 | Ga0265340_10072683 | 3300031247 | Unclassified | 1628 |
| 301 | Ga0265339_10000722 | 3300031249 | Bacteria | 25649 |
| 302 | Ga0265339_10002496 | 3300031249 | Bacteria | 13140 |
| 303 | Ga0265339_10113032 | 3300031249 | Bacteria | 1403 |
| 304 | Ga0265339_10184915 | 3300031249 | Bacteria | 1036 |
| 305 | Ga0265339_10285000 | 3300031249 | Bacteria | 791 |
| 306 | Ga0265316_10004235 | 3300031344 | Bacteria | 14336 |
| 307 | Ga0265316_10014810 | 3300031344 | Bacteria | 6844 |
| 308 | Ga0265316_10017604 | 3300031344 | Bacteria | 6168 |
| 309 | Ga0265316_10029078 | 3300031344 | Bacteria | 4549 |
| 310 | Ga0265316_10065600 | 3300031344 | Unclassified | 2811 |
| 311 | Ga0265316_10173510 | 3300031344 | Bacteria | 1607 |
| 312 | Ga0265316_10804529 | 3300031344 | Bacteria | 659 |
| 313 | Ga0265313_10000786 | 3300031595 | Bacteria | 32033 |
| 314 | Ga0265313_10007549 | 3300031595 | Bacteria | 7394 |
| 315 | Ga0265314_10007592 | 3300031711 | Bacteria | 9389 |
| 316 | Ga0265314_10031880 | 3300031711 | Bacteria | 3885 |
| 317 | Ga0265314_10091119 | 3300031711 | Unclassified | 1984 |
| 318 | Ga0265314_10104268 | 3300031711 | Bacteria | 1816 |
| 319 | Ga0265342_10000730 | 3300031712 | Bacteria | 33842 |
| 320 | Ga0265342_10001626 | 3300031712 | Bacteria | 20734 |
| 321 | Ga0265342_10027551 | 3300031712 | Bacteria | 3549 |
| 322 | Ga0265342_10365629 | 3300031712 | Unclassified | 749 |
| 323 | Ga0307516_10701841 | 3300031730 | Unclassified | 669 |
| 324 | Ga0316215_1018060 | 3300033544 | Unclassified | 713 |
| 325 | Ga0316212_1005144 | 3300033547 | Unclassified | 1902 |
| 326 | Ga0373953_0062110 | 3300035117 | Bacteria | 1529 |
| 327 | Ga0373954_0159229 | 3300035118 | Bacteria | 1104 |
| 328 | Ga0373935_0193888 | 3300035692 | Bacteria | 1401 |
| 329 | Ga0373935_0546030 | 3300035692 | Unclassified | 844 |
| 330 | Ga0373947_1006663 | 3300035725 | Unclassified | 568 |
| 331 | Ga0373937_0570437 | 3300036401 | Unclassified | 1075 |
| 332 | Ga0265778_007635 | 3300036457 | Unclassified | 1190 |
| 333 | Ga0436364_0691216 | 3300037853 | Unclassified | 2908 |
| 334 | Ga0436364_0697091 | 3300037853 | Bacteria | 5685 |
| 335 | Ga0451577_0476486 | 3300042876 | Bacteria | 1133 |
| 336 | Ga0453684_0455782 | 3300044712 | Bacteria | 1423 |
| 337 | Ga0451576_0019929 | 3300045051 | Bacteria | 7311 |
| 338 | Ga0495592_0012278 | 3300046454 | Bacteria | 6502 |
| 339 | Ga0495592_0210745 | 3300046454 | Bacteria | 1305 |
| 340 | Ga0495629_0361433 | 3300046459 | Bacteria | 989 |
| 341 | Ga0495641_0054021 | 3300046461 | Bacteria | 1826 |
| 342 | Ga0495651_0018393 | 3300046462 | Bacteria | 5412 |
| 343 | Ga0495653_0024189 | 3300046463 | Bacteria | 4898 |
| 344 | Ga0495580_0027969 | 3300046472 | Bacteria | 4101 |
| 345 | Ga0495580_0127656 | 3300046472 | Bacteria | 1765 |
| 346 | Ga0495580_0127817 | 3300046472 | Bacteria | 1764 |
| 347 | Ga0495580_0208397 | 3300046472 | Unclassified | 1345 |
| 348 | Ga0495580_0353773 | 3300046472 | Unclassified | 994 |
| 349 | Ga0495580_0365948 | 3300046472 | Unclassified | 975 |
| 350 | Ga0495580_0944820 | 3300046472 | Unclassified | 552 |
| 351 | Ga0495582_0009725 | 3300046473 | Bacteria | 5297 |
| 352 | Ga0495582_0177717 | 3300046473 | Bacteria | 1212 |
| 353 | Ga0495582_0222552 | 3300046473 | Unclassified | 1080 |
| 354 | Ga0495639_0035791 | 3300046475 | Bacteria | 2222 |
| 355 | Ga0495662_0043352 | 3300046476 | Unclassified | 2172 |
| 356 | Ga0495664_0326432 | 3300046477 | Unclassified | 925 |
| 357 | Ga0495594_0042778 | 3300046499 | Bacteria | 2481 |
| 358 | Ga0495618_0016891 | 3300046514 | Bacteria | 4472 |
| 359 | Ga0495628_0003428 | 3300046516 | Bacteria | 14193 |
| 360 | Ga0495628_0277744 | 3300046516 | Bacteria | 1245 |
| 361 | Ga0495630_0090420 | 3300046517 | Bacteria | 2313 |
| 362 | Ga0495630_0124802 | 3300046517 | Bacteria | 1953 |
| 363 | Ga0495666_0025423 | 3300046526 | Unclassified | 2923 |
| 364 | Ga0495652_0003457 | 3300046529 | Bacteria | 15585 |
| 365 | Ga0495665_0052027 | 3300046531 | Bacteria | 2168 |
| 366 | Ga0495640_0038142 | 3300046533 | Bacteria | 3381 |
| 367 | Ga0495586_0007286 | 3300046535 | Bacteria | 5905 |
| 368 | Ga0495587_0000962 | 3300046536 | Bacteria | 18881 |
| 369 | Ga0495645_0074662 | 3300046543 | Bacteria | 2441 |
| 370 | Ga0495622_0192491 | 3300046557 | Bacteria | 911 |
| 371 | Ga0495667_0008119 | 3300046559 | Bacteria | 7126 |
| 372 | Ga0495634_0102556 | 3300046642 | Unclassified | 1848 |
| 373 | Ga0495634_0198245 | 3300046642 | Bacteria | 1248 |
| 374 | Ga0495634_0318465 | 3300046642 | Unclassified | 937 |
| 375 | Ga0495635_0030611 | 3300046663 | Bacteria | 3739 |
| 376 | Ga0495657_0011844 | 3300046675 | Bacteria | 6501 |
| 377 | Ga0495599_0077064 | 3300046678 | Bacteria | 2082 |
| 378 | Ga0495623_0397408 | 3300046679 | Unclassified | 742 |
| 379 | Ga0495647_0021135 | 3300046681 | Unclassified | 2341 |
| 380 | Ga0495647_0174689 | 3300046681 | Bacteria | 932 |
| 381 | Ga0495658_0179342 | 3300046683 | Unclassified | 1314 |
| 382 | Ga0495613_0005346 | 3300046689 | Bacteria | 9645 |
| 383 | Ga0495624_0073648 | 3300046690 | Bacteria | 2123 |
| 384 | Ga0495581_0091551 | 3300047315 | Unclassified | 1764 |
| 385 | Ga0495604_0000617 | 3300047317 | Bacteria | 30546 |
| 386 | Ga0495674_0005014 | 3300047319 | Bacteria | 12737 |
| 387 | Ga0495674_0107465 | 3300047319 | Unclassified | 2368 |
| 388 | Ga0495676_0215569 | 3300047321 | Bacteria | 1325 |
| 389 | Ga0495680_0011742 | 3300047322 | Bacteria | 7738 |
| 390 | Ga0495680_0039551 | 3300047322 | Bacteria | 3761 |
| 391 | Ga0495680_0093697 | 3300047322 | Bacteria | 2248 |
| 392 | Ga0495675_0000013 | 3300047444 | Bacteria | 139190 |
| 393 | Ga0495684_0002370 | 3300047471 | Bacteria | 15058 |
| 394 | Ga0495684_0024820 | 3300047471 | Bacteria | 4610 |
| 395 | Ga0495602_0730524 | 3300048088 | Unclassified | 670 |
| 396 | Ga0496102_0590121 | 3300048905 | Bacteria | 1034 |
| 397 | Ga0496104_0841624 | 3300048907 | Unclassified | 823 |
| 398 | Ga0496105_0161102 | 3300048908 | Unclassified | 1842 |
| 399 | Ga0496105_0545930 | 3300048908 | Unclassified | 905 |
| 400 | Ga0496114_0430918 | 3300048917 | Bacteria | 1168 |
| 401 | Ga0495601_0479235 | 3300053077 | Unclassified | 804 |
| 402 | Ga0265320_10038755 | |||
| 403 | Ga0058863_11371726 | |||
| 404 | Ga0058861_10952810 | |||
| 405 | Ga0058862_11724197 | |||
| 406 | Ga0070658_10095617 | |||
| 407 | Ga0070683_100002650 | |||
| 408 | Ga0068869_100550003 | |||
| 409 | Ga0070680_100004543 | |||
| 410 | Ga0070680_100615281 | |||
| 411 | Ga0070682_100091273 | |||
| 412 | Ga0070660_100001145 | |||
| 413 | Ga0070660_100613048 | |||
| 414 | Ga0070689_100173270 | |||
| 415 | Ga0070689_100692573 | |||
| 416 | Ga0070661_100072241 | |||
| 417 | Ga0070661_100300289 | |||
| 418 | Ga0070675_100918868 | |||
| 419 | Ga0070674_100522928 | |||
| 420 | Ga0070673_101428663 | |||
| 421 | Ga0070714_100323569 | |||
| 422 | Ga0070713_100299108 | |||
| 423 | Ga0070713_100671904 | |||
| 424 | Ga0070713_101114766 | |||
| 425 | Ga0070710_10527771 | |||
| 426 | Ga0070711_100323078 | |||
| 427 | Ga0070711_100799036 | |||
| 428 | Ga0070708_100008831 | |||
| 429 | Ga0070678_100333111 | |||
| 430 | Ga0070681_10000538 | |||
| 431 | Ga0070681_10014586 | |||
| 432 | Ga0070681_10071729 | |||
| 433 | Ga0070681_10271994 | |||
| 434 | Ga0068867_100196198 | |||
| 435 | Ga0070685_10622320 | |||
| 436 | Ga0070679_100008345 | |||
| 437 | Ga0070679_100565364 | |||
| 438 | Ga0070684_100001024 | |||
| 439 | Ga0070684_100909610 | |||
| 440 | Ga0070672_100066897 | |||
| 441 | Ga0070695_100047492 | |||
| 442 | Ga0070695_100178869 | |||
| 443 | Ga0070665_100079258 | |||
| 444 | Ga0070665_100584048 | |||
| 445 | Ga0068855_100012488 | |||
| 446 | Ga0068855_100081174 | |||
| 447 | Ga0068855_100105949 | |||
| 448 | Ga0068855_100241872 | |||
| 449 | Ga0070664_100215544 | |||
| 450 | Ga0068857_100002376 | |||
| 451 | Ga0068854_100103134 | |||
| 452 | Ga0068856_100001387 | |||
| 453 | Ga0068856_100015428 | |||
| 454 | Ga0068856_100027974 | |||
| 455 | Ga0068856_100164939 | |||
| 456 | Ga0068852_100000734 | |||
| 457 | Ga0068852_100076953 | |||
| 458 | Ga0068852_100227092 | |||
| 459 | Ga0068852_100322110 | |||
| 460 | Ga0068859_100766539 | |||
| 461 | Ga0068864_100007120 | |||
| 462 | Ga0068863_100042269 | |||
| 463 | Ga0068863_100176535 | |||
| 464 | Ga0068863_100375689 | |||
| 465 | Ga0068858_100001977 | |||
| 466 | Ga0068858_100002635 | |||
| 467 | Ga0068858_100089878 | |||
| 468 | Ga0068858_100628631 | |||
| 469 | Ga0068858_100752002 | |||
| 470 | Ga0068860_100064996 | |||
| 471 | Ga0068860_100536302 | |||
| 472 | Ga0068860_100782282 | |||
| 473 | Ga0097621_100002357 | |||
| 474 | Ga0097621_100150164 | |||
| 475 | Ga0097621_100183256 | |||
| 476 | Ga0097621_100183658 | |||
| 477 | Ga0097621_100360465 | |||
| 478 | Ga0097621_100417623 | |||
| 479 | Ga0068871_100024815 | |||
| 480 | Ga0068871_100031805 | |||
| 481 | Ga0068871_100232883 | |||
| 482 | Ga0068871_101308921 | |||
| 483 | Ga0097620_100147581 | |||
| 484 | Ga0097620_100766544 | |||
| 485 | Ga0105240_10001736 | |||
| 486 | Ga0105240_10030474 | |||
| 487 | Ga0105240_10102956 | |||
| 488 | Ga0105240_10425731 | |||
| 489 | Ga0105245_10008991 | |||
| 490 | Ga0105245_10029033 | |||
| 491 | Ga0105245_10118000 | |||
| 492 | Ga0105245_10469972 | |||
| 493 | Ga0105245_10951370 | |||
| 494 | Ga0105247_10269414 | |||
| 495 | Ga0105243_10692246 | |||
| 496 | Ga0105241_10001793 | |||
| 497 | Ga0105241_10034281 | |||
| 498 | Ga0105241_10057364 | |||
| 499 | Ga0105241_10121364 | |||
| 500 | Ga0105242_10119615 | |||
| 501 | Ga0105242_10127081 | |||
| 502 | Ga0105242_10372940 | |||
| 503 | Ga0105242_10916680 | |||
| 504 | Ga0105242_11110217 | |||
| 505 | Ga0105248_10003545 | |||
| 506 | Ga0105248_10015043 | |||
| 507 | Ga0105248_10156610 | |||
| 508 | Ga0105248_10213283 | |||
| 509 | Ga0105248_10219222 | |||
| 510 | Ga0105248_10739969 | |||
| 511 | Ga0105248_11025827 | |||
| 512 | Ga0105237_10001210 | |||
| 513 | Ga0105237_10123999 | |||
| 514 | Ga0105237_10195275 | |||
| 515 | Ga0105237_10589701 | |||
| 516 | Ga0105237_11364063 | |||
| 517 | Ga0105238_10000215 | |||
| 518 | Ga0105238_10026771 | |||
| 519 | Ga0105238_10088180 | |||
| 520 | Ga0105238_10123321 | |||
| 521 | Ga0105238_11234129 | |||
| 522 | Ga0105249_10525861 | |||
| 523 | Ga0105239_10005525 | |||
| 524 | Ga0105239_10013336 | |||
| 525 | Ga0105239_10028283 | |||
| 526 | Ga0105239_10055261 | |||
| 527 | Ga0105239_10139643 | |||
| 528 | Ga0105239_10512705 | |||
| 529 | Ga0105246_10102074 | |||
| 530 | Ga0157373_10092725 | |||
| 531 | Ga0157373_10392407 | |||
| 532 | Ga0157370_10006603 | |||
| 533 | Ga0157370_10032357 | |||
| 534 | Ga0157370_10046934 | |||
| 535 | Ga0157370_10151045 | |||
| 536 | Ga0157369_10002765 | |||
| 537 | Ga0157369_10022296 | |||
| 538 | Ga0157369_10038924 | |||
| 539 | Ga0157369_10070704 | |||
| 540 | Ga0157369_10102960 | |||
| 541 | Ga0157374_10134732 | |||
| 542 | Ga0157374_10327709 | |||
| 543 | Ga0157374_10372767 | |||
| 544 | Ga0157374_10467168 | |||
| 545 | Ga0157374_10848511 | |||
| 546 | Ga0157378_10002179 | |||
| 547 | Ga0157378_10190334 | |||
| 548 | Ga0163162_10008251 | |||
| 549 | Ga0163162_10016432 | |||
| 550 | Ga0163162_10539924 | |||
| 551 | Ga0157372_10002416 | |||
| 552 | Ga0157372_10004717 | |||
| 553 | Ga0157372_10033685 | |||
| 554 | Ga0157372_10097683 | |||
| 555 | Ga0157372_10098432 | |||
| 556 | Ga0157375_10033573 | |||
| 557 | Ga0157375_10105878 | |||
| 558 | Ga0157375_10588668 | |||
| 559 | Ga0163163_10000013 | |||
| 560 | Ga0163163_10003294 | |||
| 561 | Ga0163163_10390206 | |||
| 562 | Ga0157377_10615792 | |||
| 563 | Ga0157379_10133370 | |||
| 564 | Ga0157379_10240432 | |||
| 565 | Ga0157376_10088090 | |||
| 566 | Ga0157376_10089645 | |||
| 567 | Ga0157376_10614024 | |||
| 568 | Ga0182005_1074267 | |||
| 569 | Ga0197907_10278228 | |||
| 570 | Ga0206356_10618134 | |||
| 571 | Ga0206355_1149535 | |||
| 572 | Ga0206355_1272373 | |||
| 573 | Ga0206351_10605603 | |||
| 574 | Ga0206352_10909494 | |||
| 575 | Ga0206350_11534743 | |||
| 576 | Ga0206354_10443071 | |||
| 577 | Ga0206353_11608898 | |||
| 578 | Ga0224712_10014327 | |||
| 579 | Ga0207699_10100879 | |||
| 580 | Ga0207705_10025157 | |||
| 581 | Ga0207705_10279765 | |||
| 582 | Ga0207654_10015183 | |||
| 583 | Ga0207654_10015975 | |||
| 584 | Ga0207654_10134885 | |||
| 585 | Ga0207654_10516988 | |||
| 586 | Ga0207707_10000219 | |||
| 587 | Ga0207707_10024835 | |||
| 588 | Ga0207707_10091893 | |||
| 589 | Ga0207707_10225941 | |||
| 590 | Ga0207707_10291904 | |||
| 591 | Ga0207695_10000302 | |||
| 592 | Ga0207695_10014492 | |||
| 593 | Ga0207695_10031391 | |||
| 594 | Ga0207695_10080935 | |||
| 595 | Ga0207695_10168016 | |||
| 596 | Ga0207671_10022854 | |||
| 597 | Ga0207671_10146442 | |||
| 598 | Ga0207671_10578701 | |||
| 599 | Ga0207663_10544386 | |||
| 600 | Ga0207660_10003568 | |||
| 601 | Ga0207660_10426951 | |||
| 602 | Ga0207660_10497079 | |||
| 603 | Ga0207657_10002777 | |||
| 604 | Ga0207657_10036965 | |||
| 605 | Ga0207649_10213332 | |||
| 606 | Ga0207652_10004390 | |||
| 607 | Ga0207652_10018402 | |||
| 608 | Ga0207652_10060641 | |||
| 609 | Ga0207652_10664102 | |||
| 610 | Ga0207694_10004081 | |||
| 611 | Ga0207694_10012732 | |||
| 612 | Ga0207694_10075864 | |||
| 613 | Ga0207694_10088901 | |||
| 614 | Ga0207659_10742207 | |||
| 615 | Ga0207687_10015122 | |||
| 616 | Ga0207687_10045867 | |||
| 617 | Ga0207687_10068983 | |||
| 618 | Ga0207700_10158634 | |||
| 619 | Ga0207664_10436308 | |||
| 620 | Ga0207686_10004566 | |||
| 621 | Ga0207686_10318617 | |||
| 622 | Ga0207686_10777896 | |||
| 623 | Ga0207709_10059508 | |||
| 624 | Ga0207670_10076237 | |||
| 625 | Ga0207691_10088512 | |||
| 626 | Ga0207711_10000770 | |||
| 627 | Ga0207711_10005484 | |||
| 628 | Ga0207711_10011066 | |||
| 629 | Ga0207711_10132227 | |||
| 630 | Ga0207711_10848716 | |||
| 631 | Ga0207711_11273830 | |||
| 632 | Ga0207661_10009464 | |||
| 633 | Ga0207667_10000265 | |||
| 634 | Ga0207667_10049529 | |||
| 635 | Ga0207667_10255473 | |||
| 636 | Ga0207667_10464426 | |||
| 637 | Ga0207658_10089008 | |||
| 638 | Ga0207703_10001119 | |||
| 639 | Ga0207703_10005876 | |||
| 640 | Ga0207703_10444405 | |||
| 641 | Ga0207703_10451215 | |||
| 642 | Ga0207703_10672733 | |||
| 643 | Ga0207639_10456767 | |||
| 644 | Ga0207702_10005730 | |||
| 645 | Ga0207702_10101527 | |||
| 646 | Ga0207641_10100995 | |||
| 647 | Ga0207641_10298596 | |||
| 648 | Ga0207648_10016908 | |||
| 649 | Ga0207676_10012040 | |||
| 650 | Ga0207674_10000659 | |||
| 651 | Ga0207674_10577314 | |||
| 652 | Ga0207683_10375377 | |||
| 653 | Ga0207698_10038769 | |||
| 654 | Ga0207698_10109064 | |||
| 655 | Ga0207698_10185798 | |||
| 656 | Ga0207698_10524869 | |||
| 657 | Ga0265354_1002087 | |||
| 658 | Ga0265357_1000992 | |||
| 659 | Ga0265357_1018864 | |||
| 660 | Ga0268266_10704585 | |||
| 661 | Ga0268264_10139783 | |||
| 662 | Ga0268264_10291789 | |||
| 663 | Ga0265323_10002017 | |||
| 664 | Ga0265336_10004100 | |||
| 665 | Ga0265338_10002847 | |||
| 666 | Ga0265338_10007559 | |||
| 667 | Ga0265338_10030754 | |||
| 668 | Ga0265338_10053721 | |||
| 669 | Ga0265338_10053809 | |||
| 670 | Ga0265338_10083607 | |||
| 671 | Ga0265338_10107231 | |||
| 672 | Ga0265338_10132035 | |||
| 673 | Ga0265338_10301631 | |||
| 674 | Ga0265338_10444308 | |||
| 675 | Ga0265338_10518728 | |||
| 676 | Ga0265338_10579021 | |||
| 677 | Ga0265324_10074748 | |||
| 678 | Ga0265762_1052249 | |||
| 679 | Ga0265762_1056305 | |||
| 680 | Ga0265775_101636 | |||
| 681 | Ga0265770_1005235 | |||
| 682 | Ga0265770_1012424 | |||
| 683 | Ga0265765_1005027 | |||
| 684 | Ga0265776_100297 | |||
| 685 | Ga0265779_103664 | |||
| 686 | Ga0265760_10010207 | |||
| 687 | Ga0265760_10014130 | |||
| 688 | Ga0265760_10018505 | |||
| 689 | Ga0265760_10055975 | |||
| 690 | Ga0265330_10000634 | |||
| 691 | Ga0265332_10082618 | |||
| 692 | Ga0265328_10043906 | |||
| 693 | Ga0265328_10240165 | |||
| 694 | Ga0265320_10240866 | |||
| 695 | Ga0265325_10000405 | |||
| 696 | Ga0265325_10001212 | |||
| 697 | Ga0265325_10010463 | |||
| 698 | Ga0265329_10021039 | |||
| 699 | Ga0265329_10084684 | |||
| 700 | Ga0265340_10007309 | |||
| 701 | Ga0265340_10072683 | |||
| 702 | Ga0265339_10000722 | |||
| 703 | Ga0265339_10002496 | |||
| 704 | Ga0265339_10113032 | |||
| 705 | Ga0265339_10184915 | |||
| 706 | Ga0265339_10285000 | |||
| 707 | Ga0265316_10004235 | |||
| 708 | Ga0265316_10014810 | |||
| 709 | Ga0265316_10017604 | |||
| 710 | Ga0265316_10029078 | |||
| 711 | Ga0265316_10065600 | |||
| 712 | Ga0265316_10173510 | |||
| 713 | Ga0265316_10804529 | |||
| 714 | Ga0265313_10000786 | |||
| 715 | Ga0265313_10007549 | |||
| 716 | Ga0265314_10007592 | |||
| 717 | Ga0265314_10031880 | |||
| 718 | Ga0265314_10091119 | |||
| 719 | Ga0265314_10104268 | |||
| 720 | Ga0265342_10000730 | |||
| 721 | Ga0265342_10001626 | |||
| 722 | Ga0265342_10027551 | |||
| 723 | Ga0265342_10365629 | |||
| 724 | Ga0307516_10701841 | |||
| 725 | Ga0316215_1018060 | |||
| 726 | Ga0316212_1005144 | |||
| 727 | Ga0373953_0062110 | |||
| 728 | Ga0373954_0159229 | |||
| 729 | Ga0373935_0193888 | |||
| 730 | Ga0373935_0546030 | |||
| 731 | Ga0373947_1006663 | |||
| 732 | Ga0373937_0570437 | |||
| 733 | Ga0265778_007635 | |||
| 734 | Ga0436364_0691216 | |||
| 735 | Ga0436364_0697091 | |||
| 736 | Ga0451577_0476486 | |||
| 737 | Ga0453684_0455782 | |||
| 738 | Ga0451576_0019929 | |||
| 739 | Ga0495592_0012278 | |||
| 740 | Ga0495592_0210745 | |||
| 741 | Ga0495629_0361433 | |||
| 742 | Ga0495641_0054021 | |||
| 743 | Ga0495651_0018393 | |||
| 744 | Ga0495653_0024189 | |||
| 745 | Ga0495580_0027969 | |||
| 746 | Ga0495580_0127656 | |||
| 747 | Ga0495580_0127817 | |||
| 748 | Ga0495580_0208397 | |||
| 749 | Ga0495580_0353773 | |||
| 750 | Ga0495580_0365948 | |||
| 751 | Ga0495580_0944820 | |||
| 752 | Ga0495582_0009725 | |||
| 753 | Ga0495582_0177717 | |||
| 754 | Ga0495582_0222552 | |||
| 755 | Ga0495639_0035791 | |||
| 756 | Ga0495662_0043352 | |||
| 757 | Ga0495664_0326432 | |||
| 758 | Ga0495594_0042778 | |||
| 759 | Ga0495618_0016891 | |||
| 760 | Ga0495628_0003428 | |||
| 761 | Ga0495628_0277744 | |||
| 762 | Ga0495630_0090420 | |||
| 763 | Ga0495630_0124802 | |||
| 764 | Ga0495666_0025423 | |||
| 765 | Ga0495652_0003457 | |||
| 766 | Ga0495665_0052027 | |||
| 767 | Ga0495640_0038142 | |||
| 768 | Ga0495586_0007286 | |||
| 769 | Ga0495587_0000962 | |||
| 770 | Ga0495645_0074662 | |||
| 771 | Ga0495622_0192491 | |||
| 772 | Ga0495667_0008119 | |||
| 773 | Ga0495634_0102556 | |||
| 774 | Ga0495634_0198245 | |||
| 775 | Ga0495634_0318465 | |||
| 776 | Ga0495635_0030611 | |||
| 777 | Ga0495657_0011844 | |||
| 778 | Ga0495599_0077064 | |||
| 779 | Ga0495623_0397408 | |||
| 780 | Ga0495647_0021135 | |||
| 781 | Ga0495647_0174689 | |||
| 782 | Ga0495658_0179342 | |||
| 783 | Ga0495613_0005346 | |||
| 784 | Ga0495624_0073648 | |||
| 785 | Ga0495581_0091551 | |||
| 786 | Ga0495604_0000617 | |||
| 787 | Ga0495674_0005014 | |||
| 788 | Ga0495674_0107465 | |||
| 789 | Ga0495676_0215569 | |||
| 790 | Ga0495680_0011742 | |||
| 791 | Ga0495680_0039551 | |||
| 792 | Ga0495680_0093697 | |||
| 793 | Ga0495675_0000013 | |||
| 794 | Ga0495684_0002370 | |||
| 795 | Ga0495684_0024820 | |||
| 796 | Ga0495602_0730524 | |||
| 797 | Ga0496102_0590121 | |||
| 798 | Ga0496104_0841624 | |||
| 799 | Ga0496105_0161102 | |||
| 800 | Ga0496105_0545930 | |||
| 801 | Ga0496114_0430918 | |||
| 802 | Ga0495601_0479235 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vcm-assembly1.cif.gz_A | crystal structure of ginko1 | 0.814 | 26 | 86 |
| 7vcm-assembly2.cif.gz_B | crystal structure of ginko1 | 0.8133 | 26 | 86 |
| 7pvc-assembly1.cif.gz_A | the structure of kbp.k from e. coli with potassium bound. | 0.7687 | 26 | 89 |
| 3cq2-assembly1.cif.gz_B | structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 | 0.7535 | 106 | 168 |
| 7pda-assembly1.cif.gz_A | crystal structure of phenazine 1-carboxylic acid decarboxylase from mycobacterium fortuitum | 0.7321 | 26 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFH8_57_122_3.30.1340.30 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; | 0.9623 | 105 | 165 | 3.30.1340.30 |
| af_P0AFH8_137_201_3.30.1340.30 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; | 0.9579 | 106 | 165 | 3.30.1340.30 |
| af_P64596_124_191_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9478 | 103 | 165 | 3.30.70.330 |
| af_P64596_46_115_3.30.1340.30 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; | 0.9437 | 103 | 165 | 3.30.1340.30 |
| af_P0AFH8_57_122_3.30.1340.30 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;; | 0.8784 | 105 | 165 | 3.30.1340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K1QGQ6-F1-model_v4 | deleted | 0.9764 | 103 | 165 |
|
| AF-A0A6I1QRK5-F1-model_v4 | AAA family ATPase | 0.9762 | 103 | 165 |
GO:0016020
GO:0016887 |
| AF-A0A3N5HQZ4-F1-model_v4 | BON domain-containing protein | 0.9619 | 103 | 165 |
GO:0016887
|
| AF-A0A7C5VBW6-F1-model_v4 | OmpA-like domain-containing protein | 0.9589 | 93 | 165 |
GO:0009279
|
| AF-A0A7C7Y1U3-F1-model_v4 | BON domain-containing protein | 0.9582 | 99 | 165 |
|