F434857

General Info

Members Datasets Scaffolds Average Seq Length
401 181 800 314

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10194412|Ga0157380_101944121
Length 372
Sequence MSRLKCSFQYEDQTLESMPTHSSHVYLTTKILKGIVVSPTTTSSKYTEESDVRTITSFIALIAIASVFVRGGDTPHAQSWQPPTDSQRCPSKWGADDQRGSGNHMKPETVLRAVRLIKSGEVIELGHVLNSSMPFFGTRRFDVHTKRTFMNPESNRRGSNEELVVGEIGQVGTQFDGFAHQTIGDSMYNCFKVGDVSTRNGFEKLGIENVGALITRGVLIDIAGLKGVEILPDTYEITVKDIEQALARQNLKLQSGDAIILHTGWGKLWGKDNARYAKNCPGIGLAAAEWLARQDPMLVGADNVGVEVSPNPDLKLSLPIHQVMLVVNGIHLLENMKLDQLVAKRVQEFALIVQPLKIQGGTGSTVAPVAVH

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
153 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
173 2791355199
174 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
175 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
176 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
177 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
178 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
179 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
180 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
181 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 1.5
Rhizoplane 1
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 16.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10194412 3300014326 Unclassified 1794
2 Ga0065712_10001698 3300005290 Bacteria 6374
3 Ga0065707_10088284 3300005295 Bacteria 4707
4 Ga0070676_10056067 3300005328 Bacteria 2327
5 Ga0070690_100028794 3300005330 Bacteria 3442
6 Ga0070677_10018160 3300005333 Bacteria 2530
7 Ga0070677_10027116 3300005333 Bacteria 2154
8 Ga0070677_10144226 3300005333 Bacteria 1102
9 Ga0068869_100078654 3300005334 Bacteria 2456
10 Ga0070666_10006686 3300005335 Bacteria 7095
11 Ga0068868_100030049 3300005338 Bacteria 4165
12 Ga0070687_100062494 3300005343 Bacteria 1972
13 Ga0070661_100174431 3300005344 Unclassified 1634
14 Ga0070669_100058758 3300005353 Bacteria 2822
15 Ga0070669_100059141 3300005353 Unclassified 2814
16 Ga0070669_100081197 3300005353 Bacteria 2415
17 Ga0070669_100419858 3300005353 Unclassified 1098
18 Ga0070675_100019282 3300005354 Bacteria 5434
19 Ga0070675_100035140 3300005354 Bacteria 4071
20 Ga0070675_100039002 3300005354 Bacteria 3874
21 Ga0070675_100080910 3300005354 Unclassified 2708
22 Ga0070675_100148866 3300005354 Bacteria 2006
23 Ga0070675_100164171 3300005354 Unclassified 1912
24 Ga0070671_100011808 3300005355 Bacteria 7026
25 Ga0070671_100182098 3300005355 Unclassified 1779
26 Ga0070674_100004995 3300005356 Bacteria 7607
27 Ga0070674_100102999 3300005356 Bacteria 2083
28 Ga0070673_100024094 3300005364 Bacteria 4456
29 Ga0070673_100028564 3300005364 Bacteria 4149
30 Ga0070673_100062297 3300005364 Bacteria 2963
31 Ga0070673_100124722 3300005364 Bacteria 2153
32 Ga0070688_100006467 3300005365 Bacteria 6268
33 Ga0070667_100012378 3300005367 Bacteria 7058
34 Ga0070667_100085404 3300005367 Bacteria 2707
35 Ga0070703_10030423 3300005406 Unclassified 1626
36 Ga0070701_10072306 3300005438 Unclassified 1847
37 Ga0070701_10139015 3300005438 Unclassified 1387
38 Ga0070700_100070629 3300005441 Bacteria 2227
39 Ga0070700_100264026 3300005441 Unclassified 1241
40 Ga0070694_100011456 3300005444 Bacteria 5492
41 Ga0070694_100077287 3300005444 Bacteria 2306
42 Ga0070708_100190469 3300005445 Bacteria 1918
43 Ga0070663_100163408 3300005455 Unclassified 1715
44 Ga0070678_100005056 3300005456 Bacteria 7563
45 Ga0070678_100105975 3300005456 Unclassified 2189
46 Ga0070678_100169315 3300005456 Bacteria 1777
47 Ga0070662_100021186 3300005457 Unclassified 4436
48 Ga0070662_100297814 3300005457 Bacteria 1309
49 Ga0068867_100009348 3300005459 Bacteria 6919
50 Ga0068867_100173143 3300005459 Bacteria 1711
51 Ga0070685_10006112 3300005466 Bacteria 6133
52 Ga0070706_100026020 3300005467 Bacteria 5384
53 Ga0070706_100050443 3300005467 Bacteria 3841
54 Ga0070707_100011132 3300005468 Bacteria 8382
55 Ga0070707_100113910 3300005468 Bacteria 2624
56 Ga0070679_100323470 3300005530 Unclassified 1491
57 Ga0070672_100011810 3300005543 Bacteria 6102
58 Ga0070672_100026095 3300005543 Bacteria 4342
59 Ga0070672_100067417 3300005543 Bacteria 2836
60 Ga0070672_100075057 3300005543 Bacteria 2698
61 Ga0070672_100077482 3300005543 Bacteria 2659
62 Ga0070672_100095406 3300005543 Bacteria 2405
63 Ga0070672_100127717 3300005543 Bacteria 2087
64 Ga0070686_100006985 3300005544 Bacteria 6293
65 Ga0070695_100004017 3300005545 Bacteria 8604
66 Ga0070696_100032928 3300005546 Bacteria 3558
67 Ga0070696_100286200 3300005546 Unclassified 1258
68 Ga0070665_100010796 3300005548 Bacteria 9237
69 Ga0070704_100061282 3300005549 Bacteria 2692
70 Ga0070704_100510027 3300005549 Bacteria 1045
71 Ga0070664_100227917 3300005564 Unclassified 1669
72 Ga0068859_100049784 3300005617 Bacteria 4209
73 Ga0068859_100145806 3300005617 Bacteria 2442
74 Ga0068859_100225269 3300005617 Bacteria 1963
75 Ga0068859_100313730 3300005617 Unclassified 1662
76 Ga0068864_100213984 3300005618 Bacteria 1776
77 Ga0068864_100242108 3300005618 Unclassified 1672
78 Ga0068864_100248132 3300005618 Unclassified 1652
79 Ga0068864_100523036 3300005618 Unclassified 1144
80 Ga0068861_100009277 3300005719 Bacteria 6788
81 Ga0068861_100009390 3300005719 Bacteria 6752
82 Ga0068861_100141064 3300005719 Bacteria 1967
83 Ga0068870_10089524 3300005840 Bacteria 1718
84 Ga0068870_10228104 3300005840 Bacteria 1144
85 Ga0068863_100031129 3300005841 Bacteria 5094
86 Ga0068858_100084333 3300005842 Bacteria 2956
87 Ga0068858_100188381 3300005842 Bacteria 1949
88 Ga0068860_100018794 3300005843 Bacteria 6713
89 Ga0068860_100028799 3300005843 Bacteria 5345
90 Ga0068860_100361360 3300005843 Bacteria 1430
91 Ga0068862_100073006 3300005844 Unclassified 2965
92 Ga0081455_10004424 3300005937 Bacteria 15772
93 Ga0081455_10006850 3300005937 Bacteria 12142
94 Ga0081455_10009107 3300005937 Bacteria 10243
95 Ga0081455_10021309 3300005937 Bacteria 6082
96 Ga0081455_10070911 3300005937 Plasmid 2891
97 Ga0081455_10268725 3300005937 Bacteria 1238
98 Ga0081538_10014501 3300005981 Bacteria 6167
99 Ga0081540_1002637 3300005983 Bacteria 14577
100 Ga0081540_1010611 3300005983 Bacteria 6220
101 Ga0081539_10002522 3300005985 Bacteria 25579
102 Ga0081539_10044206 3300005985 Bacteria 2573
103 Ga0075368_10048835 3300006042 Bacteria 1678
104 Ga0070715_10010215 3300006163 Plasmid 3339
105 Ga0075367_10046532 3300006178 Bacteria 2549
106 Ga0075367_10068010 3300006178 Bacteria 2136
107 Ga0075366_10005565 3300006195 Bacteria 6828
108 Ga0075366_10041946 3300006195 Bacteria 2709
109 Ga0097621_100008461 3300006237 Bacteria 7414
110 Ga0097621_100204411 3300006237 Bacteria 1716
111 Ga0097621_100320356 3300006237 Unclassified 1373
112 Ga0068871_100006622 3300006358 Bacteria 8216
113 Ga0068871_100007857 3300006358 Bacteria 7642
114 Ga0075428_100067169 3300006844 Bacteria 3926
115 Ga0075428_100302216 3300006844 Bacteria 1720
116 Ga0075428_100472842 3300006844 Unclassified 1342
117 Ga0075430_100077810 3300006846 Bacteria 2780
118 Ga0075430_100204181 3300006846 Bacteria 1640
119 Ga0075431_100004922 3300006847 Bacteria 13157
120 Ga0075431_100010605 3300006847 Bacteria 9268
121 Ga0075431_100170764 3300006847 Bacteria 2234
122 Ga0075431_100206397 3300006847 Bacteria 2009
123 Ga0075431_100277749 3300006847 Unclassified 1696
124 Ga0075431_100372418 3300006847 Unclassified 1433
125 Ga0075431_100423084 3300006847 Unclassified 1331
126 Ga0075433_10004705 3300006852 Bacteria 10635
127 Ga0075433_10015200 3300006852 Bacteria 6308
128 Ga0075433_10021511 3300006852 Bacteria 5409
129 Ga0075433_10208595 3300006852 Bacteria 1736
130 Ga0075433_10441119 3300006852 Unclassified 1148
131 Ga0075433_10491637 3300006852 Bacteria 1080
132 Ga0075434_100008263 3300006871 Bacteria 9667
133 Ga0075434_100026518 3300006871 Bacteria 5678
134 Ga0075434_100075075 3300006871 Unclassified 3374
135 Ga0075434_100128422 3300006871 Bacteria 2552
136 Ga0075434_100154030 3300006871 Bacteria 2318
137 Ga0075434_100358429 3300006871 Bacteria 1479
138 Ga0075429_100005496 3300006880 Bacteria 10910
139 Ga0075429_100007105 3300006880 Bacteria 9722
140 Ga0075429_100015469 3300006880 Bacteria 6610
141 Ga0075429_100046264 3300006880 Bacteria 3786
142 Ga0075429_100061622 3300006880 Bacteria 3268
143 Ga0075429_100309512 3300006880 Unclassified 1383
144 Ga0075436_100117491 3300006914 Bacteria 1859
145 Ga0097620_100049783 3300006931 Bacteria 4209
146 Ga0097620_100145804 3300006931 Bacteria 2442
147 Ga0097620_100225268 3300006931 Bacteria 1963
148 Ga0097620_100313699 3300006931 Unclassified 1662
149 Ga0075435_100049531 3300007076 Bacteria 3379
150 Ga0075435_100077337 3300007076 Bacteria 2728
151 Ga0111539_10001818 3300009094 Bacteria 28402
152 Ga0111539_10025082 3300009094 Bacteria 7308
153 Ga0111539_10111252 3300009094 Unclassified 3214
154 Ga0111539_10306586 3300009094 Bacteria 1848
155 Ga0111539_10619588 3300009094 Bacteria 1260
156 Ga0114129_10000839 3300009147 Bacteria 39797
157 Ga0114129_10005328 3300009147 Bacteria 18157
158 Ga0114129_10014091 3300009147 Bacteria 11389
159 Ga0114129_10021903 3300009147 Bacteria 9071
160 Ga0114129_10030816 3300009147 Bacteria 7585
161 Ga0114129_10038630 3300009147 Bacteria 6731
162 Ga0114129_10042155 3300009147 Bacteria 6427
163 Ga0114129_10055143 3300009147 Bacteria 5571
164 Ga0114129_10058489 3300009147 Bacteria 5392
165 Ga0114129_10061974 3300009147 Bacteria 5226
166 Ga0114129_10141086 3300009147 Bacteria 3303
167 Ga0114129_10257605 3300009147 Bacteria 2340
168 Ga0114129_10362680 3300009147 Unclassified 1917
169 Ga0114129_10452673 3300009147 Bacteria 1683
170 Ga0114129_10568523 3300009147 Unclassified 1472
171 Ga0105243_10007315 3300009148 Bacteria 8491
172 Ga0105242_10018182 3300009176 Bacteria 5492
173 Ga0105248_10300398 3300009177 Unclassified 1808
174 Ga0105249_10013887 3300009553 Bacteria 7119
175 Ga0105246_10187690 3300011119 Unclassified 1597
176 Ga0163162_10006792 3300013306 Bacteria 11100
177 Ga0163162_10812577 3300013306 Bacteria 1052
178 Ga0157375_10046749 3300013308 Bacteria 4223
179 Ga0157375_10199628 3300013308 Bacteria 2156
180 Ga0163163_10041102 3300014325 Bacteria 4520
181 Ga0157380_10040390 3300014326 Bacteria 3633
182 Ga0157380_10158172 3300014326 Unclassified 1966
183 Ga0157380_10316935 3300014326 Unclassified 1444
184 Ga0157377_10014855 3300014745 Unclassified 3972
185 Ga0157377_10098166 3300014745 Bacteria 1741
186 Ga0157377_10237367 3300014745 Bacteria 1175
187 Ga0157379_10007641 3300014968 Bacteria 9355
188 Ga0157379_10316612 3300014968 Bacteria 1424
189 Ga0163161_10005795 3300017792 Bacteria 8567
190 Ga0207697_10003037 3300025315 Bacteria 8426
191 Ga0207682_10000612 3300025893 Bacteria 16611
192 Ga0207682_10006330 3300025893 Bacteria 4777
193 Ga0207682_10016048 3300025893 Bacteria 2919
194 Ga0207688_10000544 3300025901 Bacteria 18348
195 Ga0207688_10195928 3300025901 Bacteria 1210
196 Ga0207680_10013087 3300025903 Bacteria 4249
197 Ga0207680_10206142 3300025903 Bacteria 1342
198 Ga0207685_10026313 3300025905 Unclassified 2021
199 Ga0207645_10002837 3300025907 Bacteria 13445
200 Ga0207645_10003997 3300025907 Bacteria 10995
201 Ga0207645_10062312 3300025907 Bacteria 2382
202 Ga0207645_10249962 3300025907 Bacteria 1173
203 Ga0207643_10000450 3300025908 Bacteria 26721
204 Ga0207643_10247167 3300025908 Bacteria 1098
205 Ga0207684_10036843 3300025910 Bacteria 4151
206 Ga0207684_10037393 3300025910 Unclassified 4119
207 Ga0207684_10183584 3300025910 Bacteria 1804
208 Ga0207660_10155557 3300025917 Bacteria 1760
209 Ga0207662_10035680 3300025918 Bacteria 2905
210 Ga0207646_10106337 3300025922 Bacteria 2517
211 Ga0207681_10099314 3300025923 Bacteria 2096
212 Ga0207681_10209372 3300025923 Bacteria 1502
213 Ga0207681_10280197 3300025923 Bacteria 1312
214 Ga0207650_10009997 3300025925 Bacteria 6495
215 Ga0207650_10023376 3300025925 Bacteria 4382
216 Ga0207659_10023166 3300025926 Bacteria 4141
217 Ga0207659_10035803 3300025926 Bacteria 3434
218 Ga0207659_10052796 3300025926 Unclassified 2897
219 Ga0207644_10012060 3300025931 Bacteria 5732
220 Ga0207644_10015612 3300025931 Bacteria 5101
221 Ga0207706_10071116 3300025933 Unclassified 3060
222 Ga0207706_10202312 3300025933 Bacteria 1742
223 Ga0207706_10502204 3300025933 Bacteria 1047
224 Ga0207686_10002750 3300025934 Bacteria 9533
225 Ga0207709_10027700 3300025935 Bacteria 3268
226 Ga0207704_10082604 3300025938 Bacteria 2082
227 Ga0207704_10188632 3300025938 Bacteria 1497
228 Ga0207704_10245259 3300025938 Bacteria 1341
229 Ga0207691_10004632 3300025940 Bacteria 13310
230 Ga0207691_10032203 3300025940 Bacteria 4889
231 Ga0207691_10056898 3300025940 Bacteria 3561
232 Ga0207711_10209103 3300025941 Unclassified 1782
233 Ga0207711_10299579 3300025941 Bacteria 1483
234 Ga0207689_10001850 3300025942 Bacteria 20023
235 Ga0207651_10030860 3300025960 Bacteria 3418
236 Ga0207651_10033173 3300025960 Bacteria 3327
237 Ga0207651_10058129 3300025960 Bacteria 2671
238 Ga0207651_10285493 3300025960 Bacteria 1366
239 Ga0207712_10080250 3300025961 Bacteria 2373
240 Ga0207677_10163206 3300026023 Bacteria 1733
241 Ga0207703_10074102 3300026035 Bacteria 2818
242 Ga0207708_10283760 3300026075 Unclassified 1342
243 Ga0207641_10017522 3300026088 Bacteria 5864
244 Ga0207648_10005451 3300026089 Bacteria 12816
245 Ga0207648_10079666 3300026089 Bacteria 2858
246 Ga0207648_10233897 3300026089 Bacteria 1635
247 Ga0207648_10268555 3300026089 Bacteria 1523
248 Ga0207676_10439310 3300026095 Bacteria 1228
249 Ga0207674_10412220 3300026116 Bacteria 1306
250 Ga0207674_10422193 3300026116 Unclassified 1289
251 Ga0207675_100005152 3300026118 Bacteria 12589
252 Ga0207675_100154379 3300026118 Bacteria 2187
253 Ga0207675_100227048 3300026118 Bacteria 1800
254 Ga0207683_10012404 3300026121 Bacteria 7272
255 Ga0207683_10014951 3300026121 Bacteria 6607
256 Ga0207683_10042719 3300026121 Bacteria 3960
257 Ga0207683_10093875 3300026121 Bacteria 2674
258 Ga0209982_1016577 3300027552 Bacteria 1120
259 Ga0209971_1024768 3300027682 Bacteria 1433
260 Ga0209813_10001308 3300027866 Bacteria 5563
261 Ga0207428_10000013 3300027907 Bacteria 346742
262 Ga0207428_10000145 3300027907 Bacteria 96603
263 Ga0207428_10005192 3300027907 Bacteria 12179
264 Ga0207428_10020970 3300027907 Bacteria 5539
265 Ga0207428_10028285 3300027907 Bacteria 4658
266 Ga0207428_10082617 3300027907 Unclassified 2507
267 Ga0268265_10057641 3300028380 Bacteria 2962
268 Ga0268265_10106849 3300028380 Bacteria 2274
269 Ga0268264_10076231 3300028381 Bacteria 2852
270 Ga0307509_10166244 3300031507 Bacteria 2094
271 Ga0307405_10255270 3300031731 Bacteria 1307
272 Ga0373940_0039343 3300035088 Bacteria 1294
273 Ga0373949_0029585 3300035090 Bacteria 1299
274 Ga0373932_0008426 3300035112 Bacteria 2465
275 Ga0373942_0019034 3300035207 Bacteria 1710
276 Ga0373962_0033819 3300035242 Bacteria 1413
277 Ga0373931_0015772 3300035691 Bacteria 3708
278 Ga0439462_0017235 3300042015 Unclassified 1871
279 Ga0439444_0030455 3300042437 Bacteria 1011
280 Ga0495617_003956 3300046452 Bacteria 5457
281 Ga0495638_0006587 3300046460 Bacteria 8442
282 Ga0495580_0006259 3300046472 Bacteria 9733
283 Ga0495584_0021350 3300046491 Bacteria 3290
284 Ga0495584_0184593 3300046491 Unclassified 1060
285 Ga0495585_0025581 3300046492 Bacteria 3379
286 Ga0495610_0083202 3300046512 Bacteria 1465
287 Ga0495631_0026733 3300046518 Bacteria 2646
288 Ga0495632_0067019 3300046519 Bacteria 1731
289 Ga0495644_0070729 3300046523 Bacteria 1311
290 Ga0495598_0015388 3300046537 Bacteria 1931
291 Ga0495598_0063823 3300046537 Bacteria 1143
292 Ga0495656_0026369 3300046615 Bacteria 2313
293 Ga0495656_0093281 3300046615 Bacteria 1380
294 Ga0495668_0013031 3300046616 Bacteria 4920
295 Ga0495625_0105249 3300046660 Bacteria 1933
296 Ga0496102_0077014 3300048905 Bacteria 3069
297 Ga0496109_0491583 3300048912 Unclassified 1158
298 Ga0496112_0000051 3300048915 Bacteria 82351
299 Ga0496112_0086479 3300048915 Bacteria 3102
300 Ga0501299_009368 3300049522 Unclassified 1613
301 Ga0501040_0072059 3300049576 Bacteria 2386
302 Ga0501040_0102483 3300049576 Bacteria 1997
303 Ga0501040_0264297 3300049576 Unclassified 1228
304 Ga0501046_0093154 3300049580 Bacteria 2316
305 Ga0501048_0028089 3300049582 Bacteria 4085
306 Ga0501048_0182549 3300049582 Unclassified 1487
307 Ga0501048_0292765 3300049582 Unclassified 1158
308 Ga0501071_0016614 3300049587 Bacteria 5063
309 Ga0501071_0075744 3300049587 Unclassified 2457
310 Ga0501072_0073364 3300049588 Bacteria 2706
311 Ga0501072_0078940 3300049588 Bacteria 2606
312 Ga0501075_0029113 3300049591 Bacteria 4083
313 Ga0501075_0054032 3300049591 Bacteria 3021
314 Ga0501075_0075116 3300049591 Bacteria 2556
315 Ga0501076_0069998 3300049592 Bacteria 2804
316 Ga0501076_0125135 3300049592 Bacteria 2083
317 Ga0501236_009889 3300049670 Unclassified 1238
318 Ga0501249_007241 3300049679 Unclassified 2291
319 Ga0501079_0041842 3300049741 Bacteria 3538
320 Ga0501080_0107580 3300049742 Bacteria 2585
321 Ga0501081_0010292 3300049743 Bacteria 6106
322 Ga0501081_0028954 3300049743 Bacteria 3740
323 Ga0501081_0265912 3300049743 Bacteria 1254
324 Ga0501045_0190104 3300049824 Unclassified 1530
325 Ga0501045_0195529 3300049824 Bacteria 1507
326 nmdc:mga06z11_16506_c1 3300050494 Bacteria 3328
327 nmdc:mga06z11_43719_c1 3300050494 Bacteria 2256
328 nmdc:mga06z11_9025_c1 3300050494 Unclassified 4188
329 nmdc:mga04h51_5050_c1 3300050495 Bacteria 3337
330 nmdc:mga05p37_164641_c1 3300050507 Bacteria 2707
331 nmdc:mga05p37_17372_c1 3300050507 Bacteria 8680
332 nmdc:mga05p37_19401_c1 3300050507 Bacteria 8227
333 nmdc:mga05p37_200377_c1 3300050507 Bacteria 2418
334 nmdc:mga05p37_20197_c1 3300050507 Bacteria 8062
335 nmdc:mga05p37_21004_c1 3300050507 Bacteria 7903
336 nmdc:mga05p37_214052_c1 3300050507 Unclassified 2328
337 nmdc:mga05p37_217525_c1 3300050507 Bacteria 2307
338 nmdc:mga05p37_279646_c1 3300050507 Bacteria 1991
339 nmdc:mga05p37_380518_c1 3300050507 Bacteria 1654
340 nmdc:mga05p37_381536_c1 3300050507 Bacteria 1651
341 nmdc:mga05p37_416398_c1 3300050507 Bacteria 1565
342 nmdc:mga05p37_417049_c1 3300050507 Bacteria 1563
343 nmdc:mga05p37_683_c1 3300050507 Bacteria 37611
344 nmdc:mga05p37_6995_c1 3300050507 Bacteria 13296
345 nmdc:mga05p37_98945_c1 3300050507 Bacteria 3593
346 nmdc:mga09592_16704_c1 3300050508 Bacteria 6007
347 nmdc:mga09592_34047_c1 3300050508 Bacteria 4258
348 nmdc:mga09592_34279_c1 3300050508 Bacteria 4244
349 nmdc:mga09592_35704_c1 3300050508 Bacteria 4162
350 nmdc:mga09592_3995_c1 3300050508 Bacteria 11889
351 nmdc:mga09592_4618_c1 3300050508 Bacteria 11154
352 nmdc:mga0qj67_105367_c1 3300050509 Bacteria 2275
353 nmdc:mga0qj67_201139_c1 3300050509 Bacteria 1619
354 nmdc:mga0qj67_43338_c1 3300050509 Bacteria 3544
355 nmdc:mga0qj67_68166_c1 3300050509 Bacteria 2835
356 nmdc:mga06r32_151254_c1 3300050510 Unclassified 2300
357 nmdc:mga06r32_25014_c1 3300050510 Bacteria 5548
358 nmdc:mga06r32_252887_c1 3300050510 Bacteria 1750
359 nmdc:mga06r32_283300_c1 3300050510 Bacteria 1644
360 nmdc:mga06r32_32526_c1 3300050510 Bacteria 4908
361 nmdc:mga06r32_328438_c1 3300050510 Bacteria 1515
362 nmdc:mga06r32_489796_c1 3300050510 Unclassified 1207
363 nmdc:mga06r32_502418_c1 3300050510 Unclassified 1189
364 nmdc:mga06r32_7855_c1 3300050510 Bacteria 9585
365 nmdc:mga06r32_8446_c1 3300050510 Bacteria 9280
366 nmdc:mga06r32_90343_c1 3300050510 Bacteria 2992
367 nmdc:mga08y16_14552_c1 3300050511 Bacteria 8274
368 nmdc:mga08y16_17348_c1 3300050511 Bacteria 7580
369 nmdc:mga08y16_44258_c1 3300050511 Bacteria 4664
370 nmdc:mga08y16_47403_c1 3300050511 Unclassified 4498
371 nmdc:mga08y16_606333_c1 3300050511 Bacteria 1103
372 nmdc:mga08y16_80301_c1 3300050511 Bacteria 3400
373 nmdc:mga08y16_8724_c1 3300050511 Bacteria 10633
374 nmdc:mga0n895_117040_c1 3300050512 Unclassified 2684
375 nmdc:mga0n895_24473_c1 3300050512 Bacteria 5690
376 nmdc:mga0n895_34507_c1 3300050512 Bacteria 4871
377 nmdc:mga0n895_34815_c1 3300050512 Bacteria 4851
378 nmdc:mga0n895_7309_c1 3300050512 Bacteria 9468
379 nmdc:mga0rr50_25262_c1 3300050513 Bacteria 4128
380 nmdc:mga08x19_4556_c1 3300050514 Bacteria 8224
381 nmdc:mga0a205_14685_c1 3300050515 Bacteria 7307
382 nmdc:mga0a205_308997_c1 3300050515 Unclassified 1453
383 nmdc:mga0a205_459_c1 3300050515 Bacteria 31641
384 nmdc:mga0a205_49013_c1 3300050515 Bacteria 4077
385 nmdc:mga0a205_627_c1 3300050515 Bacteria 28069
386 nmdc:mga0a205_90042_c1 3300050515 Bacteria 2965
387 Ga0501084_0089075 3300054114 Bacteria 2590
388 Ga0501084_0302448 3300054114 Bacteria 1351
389 Ga0590077_001063 3300059426 Bacteria 6817
390 Ga0530510_0079320 3300061734 Unclassified 2388
391 2723846373 2721755755 Bacteria 8322773
392 2793081142
393 2874610663 2874604998 Bacteria 7834745
394 2876811865 2876808645 Bacteria 8824342
395 2879118731 2879110137 Bacteria 8907982
396 2889039126 2889033259 Bacteria 9099371
397 2922362188 2922361189 Bacteria 7436256
398 2922388065 2922386360 Bacteria 7017218
399 8006991854 8006984368 Bacteria 9651211
400 8006995488 8006994254 Bacteria 8309700
401 Ga0157380_10194412
402 Ga0065712_10001698
403 Ga0065707_10088284
404 Ga0070676_10056067
405 Ga0070690_100028794
406 Ga0070677_10018160
407 Ga0070677_10027116
408 Ga0070677_10144226
409 Ga0068869_100078654
410 Ga0070666_10006686
411 Ga0068868_100030049
412 Ga0070687_100062494
413 Ga0070661_100174431
414 Ga0070669_100058758
415 Ga0070669_100059141
416 Ga0070669_100081197
417 Ga0070669_100419858
418 Ga0070675_100019282
419 Ga0070675_100035140
420 Ga0070675_100039002
421 Ga0070675_100080910
422 Ga0070675_100148866
423 Ga0070675_100164171
424 Ga0070671_100011808
425 Ga0070671_100182098
426 Ga0070674_100004995
427 Ga0070674_100102999
428 Ga0070673_100024094
429 Ga0070673_100028564
430 Ga0070673_100062297
431 Ga0070673_100124722
432 Ga0070688_100006467
433 Ga0070667_100012378
434 Ga0070667_100085404
435 Ga0070703_10030423
436 Ga0070701_10072306
437 Ga0070701_10139015
438 Ga0070700_100070629
439 Ga0070700_100264026
440 Ga0070694_100011456
441 Ga0070694_100077287
442 Ga0070708_100190469
443 Ga0070663_100163408
444 Ga0070678_100005056
445 Ga0070678_100105975
446 Ga0070678_100169315
447 Ga0070662_100021186
448 Ga0070662_100297814
449 Ga0068867_100009348
450 Ga0068867_100173143
451 Ga0070685_10006112
452 Ga0070706_100026020
453 Ga0070706_100050443
454 Ga0070707_100011132
455 Ga0070707_100113910
456 Ga0070679_100323470
457 Ga0070672_100011810
458 Ga0070672_100026095
459 Ga0070672_100067417
460 Ga0070672_100075057
461 Ga0070672_100077482
462 Ga0070672_100095406
463 Ga0070672_100127717
464 Ga0070686_100006985
465 Ga0070695_100004017
466 Ga0070696_100032928
467 Ga0070696_100286200
468 Ga0070665_100010796
469 Ga0070704_100061282
470 Ga0070704_100510027
471 Ga0070664_100227917
472 Ga0068859_100049784
473 Ga0068859_100145806
474 Ga0068859_100225269
475 Ga0068859_100313730
476 Ga0068864_100213984
477 Ga0068864_100242108
478 Ga0068864_100248132
479 Ga0068864_100523036
480 Ga0068861_100009277
481 Ga0068861_100009390
482 Ga0068861_100141064
483 Ga0068870_10089524
484 Ga0068870_10228104
485 Ga0068863_100031129
486 Ga0068858_100084333
487 Ga0068858_100188381
488 Ga0068860_100018794
489 Ga0068860_100028799
490 Ga0068860_100361360
491 Ga0068862_100073006
492 Ga0081455_10004424
493 Ga0081455_10006850
494 Ga0081455_10009107
495 Ga0081455_10021309
496 Ga0081455_10070911
497 Ga0081455_10268725
498 Ga0081538_10014501
499 Ga0081540_1002637
500 Ga0081540_1010611
501 Ga0081539_10002522
502 Ga0081539_10044206
503 Ga0075368_10048835
504 Ga0070715_10010215
505 Ga0075367_10046532
506 Ga0075367_10068010
507 Ga0075366_10005565
508 Ga0075366_10041946
509 Ga0097621_100008461
510 Ga0097621_100204411
511 Ga0097621_100320356
512 Ga0068871_100006622
513 Ga0068871_100007857
514 Ga0075428_100067169
515 Ga0075428_100302216
516 Ga0075428_100472842
517 Ga0075430_100077810
518 Ga0075430_100204181
519 Ga0075431_100004922
520 Ga0075431_100010605
521 Ga0075431_100170764
522 Ga0075431_100206397
523 Ga0075431_100277749
524 Ga0075431_100372418
525 Ga0075431_100423084
526 Ga0075433_10004705
527 Ga0075433_10015200
528 Ga0075433_10021511
529 Ga0075433_10208595
530 Ga0075433_10441119
531 Ga0075433_10491637
532 Ga0075434_100008263
533 Ga0075434_100026518
534 Ga0075434_100075075
535 Ga0075434_100128422
536 Ga0075434_100154030
537 Ga0075434_100358429
538 Ga0075429_100005496
539 Ga0075429_100007105
540 Ga0075429_100015469
541 Ga0075429_100046264
542 Ga0075429_100061622
543 Ga0075429_100309512
544 Ga0075436_100117491
545 Ga0097620_100049783
546 Ga0097620_100145804
547 Ga0097620_100225268
548 Ga0097620_100313699
549 Ga0075435_100049531
550 Ga0075435_100077337
551 Ga0111539_10001818
552 Ga0111539_10025082
553 Ga0111539_10111252
554 Ga0111539_10306586
555 Ga0111539_10619588
556 Ga0114129_10000839
557 Ga0114129_10005328
558 Ga0114129_10014091
559 Ga0114129_10021903
560 Ga0114129_10030816
561 Ga0114129_10038630
562 Ga0114129_10042155
563 Ga0114129_10055143
564 Ga0114129_10058489
565 Ga0114129_10061974
566 Ga0114129_10141086
567 Ga0114129_10257605
568 Ga0114129_10362680
569 Ga0114129_10452673
570 Ga0114129_10568523
571 Ga0105243_10007315
572 Ga0105242_10018182
573 Ga0105248_10300398
574 Ga0105249_10013887
575 Ga0105246_10187690
576 Ga0163162_10006792
577 Ga0163162_10812577
578 Ga0157375_10046749
579 Ga0157375_10199628
580 Ga0163163_10041102
581 Ga0157380_10040390
582 Ga0157380_10158172
583 Ga0157380_10316935
584 Ga0157377_10014855
585 Ga0157377_10098166
586 Ga0157377_10237367
587 Ga0157379_10007641
588 Ga0157379_10316612
589 Ga0163161_10005795
590 Ga0207697_10003037
591 Ga0207682_10000612
592 Ga0207682_10006330
593 Ga0207682_10016048
594 Ga0207688_10000544
595 Ga0207688_10195928
596 Ga0207680_10013087
597 Ga0207680_10206142
598 Ga0207685_10026313
599 Ga0207645_10002837
600 Ga0207645_10003997
601 Ga0207645_10062312
602 Ga0207645_10249962
603 Ga0207643_10000450
604 Ga0207643_10247167
605 Ga0207684_10036843
606 Ga0207684_10037393
607 Ga0207684_10183584
608 Ga0207660_10155557
609 Ga0207662_10035680
610 Ga0207646_10106337
611 Ga0207681_10099314
612 Ga0207681_10209372
613 Ga0207681_10280197
614 Ga0207650_10009997
615 Ga0207650_10023376
616 Ga0207659_10023166
617 Ga0207659_10035803
618 Ga0207659_10052796
619 Ga0207644_10012060
620 Ga0207644_10015612
621 Ga0207706_10071116
622 Ga0207706_10202312
623 Ga0207706_10502204
624 Ga0207686_10002750
625 Ga0207709_10027700
626 Ga0207704_10082604
627 Ga0207704_10188632
628 Ga0207704_10245259
629 Ga0207691_10004632
630 Ga0207691_10032203
631 Ga0207691_10056898
632 Ga0207711_10209103
633 Ga0207711_10299579
634 Ga0207689_10001850
635 Ga0207651_10030860
636 Ga0207651_10033173
637 Ga0207651_10058129
638 Ga0207651_10285493
639 Ga0207712_10080250
640 Ga0207677_10163206
641 Ga0207703_10074102
642 Ga0207708_10283760
643 Ga0207641_10017522
644 Ga0207648_10005451
645 Ga0207648_10079666
646 Ga0207648_10233897
647 Ga0207648_10268555
648 Ga0207676_10439310
649 Ga0207674_10412220
650 Ga0207674_10422193
651 Ga0207675_100005152
652 Ga0207675_100154379
653 Ga0207675_100227048
654 Ga0207683_10012404
655 Ga0207683_10014951
656 Ga0207683_10042719
657 Ga0207683_10093875
658 Ga0209982_1016577
659 Ga0209971_1024768
660 Ga0209813_10001308
661 Ga0207428_10000013
662 Ga0207428_10000145
663 Ga0207428_10005192
664 Ga0207428_10020970
665 Ga0207428_10028285
666 Ga0207428_10082617
667 Ga0268265_10057641
668 Ga0268265_10106849
669 Ga0268264_10076231
670 Ga0307509_10166244
671 Ga0307405_10255270
672 Ga0373940_0039343
673 Ga0373949_0029585
674 Ga0373932_0008426
675 Ga0373942_0019034
676 Ga0373962_0033819
677 Ga0373931_0015772
678 Ga0439462_0017235
679 Ga0439444_0030455
680 Ga0495617_003956
681 Ga0495638_0006587
682 Ga0495580_0006259
683 Ga0495584_0021350
684 Ga0495584_0184593
685 Ga0495585_0025581
686 Ga0495610_0083202
687 Ga0495631_0026733
688 Ga0495632_0067019
689 Ga0495644_0070729
690 Ga0495598_0015388
691 Ga0495598_0063823
692 Ga0495656_0026369
693 Ga0495656_0093281
694 Ga0495668_0013031
695 Ga0495625_0105249
696 Ga0496102_0077014
697 Ga0496109_0491583
698 Ga0496112_0000051
699 Ga0496112_0086479
700 Ga0501299_009368
701 Ga0501040_0072059
702 Ga0501040_0102483
703 Ga0501040_0264297
704 Ga0501046_0093154
705 Ga0501048_0028089
706 Ga0501048_0182549
707 Ga0501048_0292765
708 Ga0501071_0016614
709 Ga0501071_0075744
710 Ga0501072_0073364
711 Ga0501072_0078940
712 Ga0501075_0029113
713 Ga0501075_0054032
714 Ga0501075_0075116
715 Ga0501076_0069998
716 Ga0501076_0125135
717 Ga0501236_009889
718 Ga0501249_007241
719 Ga0501079_0041842
720 Ga0501080_0107580
721 Ga0501081_0010292
722 Ga0501081_0028954
723 Ga0501081_0265912
724 Ga0501045_0190104
725 Ga0501045_0195529
726 nmdc:mga06z11_16506_c1
727 nmdc:mga06z11_43719_c1
728 nmdc:mga06z11_9025_c1
729 nmdc:mga04h51_5050_c1
730 nmdc:mga05p37_164641_c1
731 nmdc:mga05p37_17372_c1
732 nmdc:mga05p37_19401_c1
733 nmdc:mga05p37_200377_c1
734 nmdc:mga05p37_20197_c1
735 nmdc:mga05p37_21004_c1
736 nmdc:mga05p37_214052_c1
737 nmdc:mga05p37_217525_c1
738 nmdc:mga05p37_279646_c1
739 nmdc:mga05p37_380518_c1
740 nmdc:mga05p37_381536_c1
741 nmdc:mga05p37_416398_c1
742 nmdc:mga05p37_417049_c1
743 nmdc:mga05p37_683_c1
744 nmdc:mga05p37_6995_c1
745 nmdc:mga05p37_98945_c1
746 nmdc:mga09592_16704_c1
747 nmdc:mga09592_34047_c1
748 nmdc:mga09592_34279_c1
749 nmdc:mga09592_35704_c1
750 nmdc:mga09592_3995_c1
751 nmdc:mga09592_4618_c1
752 nmdc:mga0qj67_105367_c1
753 nmdc:mga0qj67_201139_c1
754 nmdc:mga0qj67_43338_c1
755 nmdc:mga0qj67_68166_c1
756 nmdc:mga06r32_151254_c1
757 nmdc:mga06r32_25014_c1
758 nmdc:mga06r32_252887_c1
759 nmdc:mga06r32_283300_c1
760 nmdc:mga06r32_32526_c1
761 nmdc:mga06r32_328438_c1
762 nmdc:mga06r32_489796_c1
763 nmdc:mga06r32_502418_c1
764 nmdc:mga06r32_7855_c1
765 nmdc:mga06r32_8446_c1
766 nmdc:mga06r32_90343_c1
767 nmdc:mga08y16_14552_c1
768 nmdc:mga08y16_17348_c1
769 nmdc:mga08y16_44258_c1
770 nmdc:mga08y16_47403_c1
771 nmdc:mga08y16_606333_c1
772 nmdc:mga08y16_80301_c1
773 nmdc:mga08y16_8724_c1
774 nmdc:mga0n895_117040_c1
775 nmdc:mga0n895_24473_c1
776 nmdc:mga0n895_34507_c1
777 nmdc:mga0n895_34815_c1
778 nmdc:mga0n895_7309_c1
779 nmdc:mga0rr50_25262_c1
780 nmdc:mga08x19_4556_c1
781 nmdc:mga0a205_14685_c1
782 nmdc:mga0a205_308997_c1
783 nmdc:mga0a205_459_c1
784 nmdc:mga0a205_49013_c1
785 nmdc:mga0a205_627_c1
786 nmdc:mga0a205_90042_c1
787 Ga0501084_0089075
788 Ga0501084_0302448
789 Ga0590077_001063
790 Ga0530510_0079320
791 2723846373
792 2793081142
793 2874610663
794 2876811865
795 2879118731
796 2889039126
797 2922362188
798 2922388065
799 8006991854
800 8006995488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

123

308

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.8295 34 316
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.8255 24 316
5ibz-assembly1.cif.gz_C crystal structure of a novel cyclase (pfam04199). 0.8198 36 316
5ibz-assembly1.cif.gz_B crystal structure of a novel cyclase (pfam04199). 0.8151 24 316
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.7899 24 316
ID Description Score Start End Superfamily
af_Q58193_2_186_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7567 65 316 3.50.30.50
af_Q58193_2_186_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.753 65 316 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7184 65 314 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.717 54 315 3.50.30.50
4ehiB02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain 0.7163 229 279 3.40.140.20
ID Description Score Start End GO Terms
AF-A0A536Z1A2-F1-model_v4 Cyclase family protein 0.9884 170 316 GO:0004061
GO:0019441
AF-A0A537C2F8-F1-model_v4 Cyclase family protein 0.9874 176 316 GO:0004061
GO:0019441
AF-A0A1Q8B2X3-F1-model_v4 Cyclase 0.9872 159 215 GO:0004061
GO:0019441
AF-A0A537ACP5-F1-model_v4 Cyclase family protein 0.9812 201 316 GO:0004061
GO:0019441
AF-A0A1Q7MRX9-F1-model_v4 Cyclase 0.9812 159 215 GO:0004061
GO:0019441

Map