F434839

General Info

Members Datasets Scaffolds Average Seq Length
401 215 802 584

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10003913|Ga0105238_100039132
Length 657
Sequence VYLNLIPRLSLRSNPGLKLANAFGVVVANLPLTDYRIPMKVANKVNAKTFAILLWRLAIPFSSLGFIVYQDAPVPPNATPPEIYQLRCAACHDKPTARIPPRAQIAKRSTEDVVQAMTTGTMKQWAEALTPTQINGVALYLTGKPAAAPSPTTNDNLCKEPAPPLMLDELQWNGWGRDLDNSRYQPKPGISAADVPRLKVKWAWRHPGAMATGQPTIIGQRLFVTTEAGQLFSLNAQRGCTYWSIKAGAGLRSAITVAPLPEGGKVKFALYFGDLRANMHSVDADTGEVIWTTKVEDHALSRITGSPVLYRNRLYVPVSSIEEVAGREAKYECCKFRGSLIALDAHTGKILWKSFTVQEEPKPFKKNSAGTQMYGPAGGAIWSAPTIDPKRKVIYVATGNSYTDVPTGHSDAIMAFDLETGSLKWVNQVTPTDNFLVGCRQPGVGNCPEDAGPDHDFGSSPILRTAPNGKQILLAGQKSAVLYALDPDKSGKILWQVRLGGGGALGGIEWGFAADERNVYVPVADTTGPQRKPGITALQISNGKQLWHVPAPAANCSWGQARCNNSQSAAATLIPGVIFSGTVDGHLRAYATKDGTIIWDVDTALPIPTVNGGLTSGGALXXXGPTIANGVLYTNSGYGRIVGQPGNLLLSYTVDGK

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 1.75
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 13.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10003913 3300009551 Bacteria 14791
2 Ga0065712_10001403 3300005290 Bacteria 8135
3 Ga0065712_10077537 3300005290 Bacteria 3481
4 Ga0070658_10015924 3300005327 Bacteria 6013
5 Ga0070676_10010074 3300005328 Bacteria 5120
6 Ga0070683_100001153 3300005329 Bacteria 20002
7 Ga0070683_100009403 3300005329 Bacteria 8359
8 Ga0070683_100028577 3300005329 Bacteria 5041
9 Ga0070683_100043531 3300005329 Unclassified 4138
10 Ga0070690_100004751 3300005330 Bacteria 7581
11 Ga0070690_100014548 3300005330 Bacteria 4671
12 Ga0070677_10003501 3300005333 Bacteria 5066
13 Ga0068869_100048966 3300005334 Bacteria 3058
14 Ga0070666_10005143 3300005335 Bacteria 8009
15 Ga0070666_10006097 3300005335 Bacteria 7409
16 Ga0070680_100019880 3300005336 Bacteria 5325
17 Ga0068868_100013968 3300005338 Bacteria 5907
18 Ga0068868_100074245 3300005338 Unclassified 2716
19 Ga0070689_100012668 3300005340 Bacteria 6083
20 Ga0070691_10000325 3300005341 Bacteria 16873
21 Ga0070691_10005457 3300005341 Bacteria 5786
22 Ga0070687_100009917 3300005343 Bacteria 4096
23 Ga0070669_100006268 3300005353 Bacteria 8583
24 Ga0070669_100021597 3300005353 Bacteria 4600
25 Ga0070669_100022481 3300005353 Bacteria 4508
26 Ga0070669_100082302 3300005353 Unclassified 2399
27 Ga0070671_100030991 3300005355 Bacteria 4415
28 Ga0070674_100003018 3300005356 Bacteria 9364
29 Ga0070709_10003546 3300005434 Bacteria 8386
30 Ga0070714_100058082 3300005435 Unclassified 3313
31 Ga0070711_100054105 3300005439 Bacteria 2769
32 Ga0070705_100003584 3300005440 Bacteria 7604
33 Ga0070700_100008763 3300005441 Bacteria 5522
34 Ga0070700_100072024 3300005441 Bacteria 2208
35 Ga0070694_100001409 3300005444 Bacteria 14070
36 Ga0070694_100001660 3300005444 Bacteria 13091
37 Ga0070694_100002088 3300005444 Bacteria 11842
38 Ga0070694_100045211 3300005444 Bacteria 2950
39 Ga0070694_100090529 3300005444 Bacteria 2146
40 Ga0070681_10036305 3300005458 Bacteria 4948
41 Ga0068867_100019180 3300005459 Bacteria 4872
42 Ga0068867_100036569 3300005459 Bacteria 3565
43 Ga0070707_100024745 3300005468 Bacteria 5691
44 Ga0070707_100109056 3300005468 Unclassified 2685
45 Ga0070699_100052135 3300005518 Unclassified 3542
46 Ga0070699_100076136 3300005518 Bacteria 2921
47 Ga0070699_100117775 3300005518 Unclassified 2335
48 Ga0070699_100118120 3300005518 Bacteria 2331
49 Ga0070679_100056971 3300005530 Unclassified 3894
50 Ga0070679_100149916 3300005530 Bacteria 2309
51 Ga0070684_100000512 3300005535 Bacteria 26647
52 Ga0070684_100014536 3300005535 Bacteria 6381
53 Ga0070684_100104287 3300005535 Bacteria 2536
54 Ga0070697_100000949 3300005536 Bacteria 21843
55 Ga0070697_100012102 3300005536 Bacteria 6755
56 Ga0068853_100010637 3300005539 Bacteria 7444
57 Ga0070672_100051092 3300005543 Bacteria 3222
58 Ga0070672_100083249 3300005543 Bacteria 2567
59 Ga0070686_100002146 3300005544 Bacteria 10872
60 Ga0070686_100032352 3300005544 Bacteria 3206
61 Ga0070695_100004461 3300005545 Bacteria 8223
62 Ga0070696_100002743 3300005546 Bacteria 11685
63 Ga0070665_100001616 3300005548 Bacteria 25948
64 Ga0070665_100037823 3300005548 Bacteria 4851
65 Ga0070665_100058129 3300005548 Bacteria 3877
66 Ga0070665_100073407 3300005548 Bacteria 3427
67 Ga0070704_100019721 3300005549 Bacteria 4338
68 Ga0070704_100026521 3300005549 Bacteria 3829
69 Ga0068855_100003854 3300005563 Bacteria 18334
70 Ga0068855_100018046 3300005563 Bacteria 8479
71 Ga0068855_100032116 3300005563 Bacteria 6268
72 Ga0070664_100041344 3300005564 Bacteria 3890
73 Ga0070664_100108144 3300005564 Unclassified 2424
74 Ga0068857_100002676 3300005577 Bacteria 14628
75 Ga0068854_100007771 3300005578 Bacteria 6858
76 Ga0068856_100009340 3300005614 Bacteria 9525
77 Ga0068856_100032267 3300005614 Bacteria 5126
78 Ga0068856_100084199 3300005614 Bacteria 3159
79 Ga0070702_100011652 3300005615 Bacteria 4379
80 Ga0070702_100021170 3300005615 Bacteria 3417
81 Ga0068852_100050711 3300005616 Bacteria 3558
82 Ga0068859_100003168 3300005617 Bacteria 16736
83 Ga0068859_100028393 3300005617 Bacteria 5608
84 Ga0068859_100059627 3300005617 Bacteria 3845
85 Ga0068859_100147770 3300005617 Unclassified 2425
86 Ga0068864_100002112 3300005618 Bacteria 16425
87 Ga0068866_10004267 3300005718 Bacteria 5870
88 Ga0068870_10025908 3300005840 Bacteria 2917
89 Ga0068863_100138949 3300005841 Bacteria 2322
90 Ga0068858_100001895 3300005842 Bacteria 21356
91 Ga0068858_100002759 3300005842 Bacteria 17653
92 Ga0068858_100005285 3300005842 Bacteria 12657
93 Ga0068858_100047376 3300005842 Bacteria 3985
94 Ga0068858_100129895 3300005842 Bacteria 2361
95 Ga0068860_100003818 3300005843 Bacteria 15496
96 Ga0068860_100097774 3300005843 Bacteria 2799
97 Ga0068860_100150339 3300005843 Unclassified 2242
98 Ga0068860_100159530 3300005843 Unclassified 2174
99 Ga0081539_10000047 3300005985 Bacteria 275235
100 Ga0097621_100000879 3300006237 Bacteria 21139
101 Ga0097621_100002908 3300006237 Bacteria 11760
102 Ga0097621_100020648 3300006237 Bacteria 5079
103 Ga0097621_100043281 3300006237 Bacteria 3630
104 Ga0097621_100088641 3300006237 Unclassified 2586
105 Ga0068871_100001795 3300006358 Bacteria 14473
106 Ga0068871_100032293 3300006358 Bacteria 4134
107 Ga0075428_100004528 3300006844 Bacteria 15359
108 Ga0075431_100013432 3300006847 Bacteria 8273
109 Ga0075433_10076494 3300006852 Unclassified 2948
110 Ga0075434_100003264 3300006871 Bacteria 14498
111 Ga0075434_100003612 3300006871 Bacteria 13803
112 Ga0075434_100024569 3300006871 Bacteria 5892
113 Ga0075434_100027563 3300006871 Bacteria 5579
114 Ga0075434_100051853 3300006871 Unclassified 4076
115 Ga0068865_100025877 3300006881 Bacteria 3864
116 Ga0075436_100017140 3300006914 Bacteria 4957
117 Ga0075436_100101357 3300006914 Bacteria 2005
118 Ga0097620_100003168 3300006931 Bacteria 16736
119 Ga0097620_100028394 3300006931 Bacteria 5608
120 Ga0097620_100059623 3300006931 Bacteria 3845
121 Ga0097620_100147761 3300006931 Unclassified 2425
122 Ga0075435_100000051 3300007076 Bacteria 59038
123 Ga0075435_100000891 3300007076 Bacteria 18771
124 Ga0075435_100002569 3300007076 Bacteria 12104
125 Ga0075435_100046219 3300007076 Unclassified 3491
126 Ga0075435_100073301 3300007076 Unclassified 2799
127 Ga0105240_10001705 3300009093 Bacteria 37134
128 Ga0105240_10002620 3300009093 Bacteria 28692
129 Ga0105240_10111830 3300009093 Bacteria 3303
130 Ga0105240_10126328 3300009093 Archaea 3073
131 Ga0111539_10002255 3300009094 Bacteria 25699
132 Ga0111539_10005752 3300009094 Bacteria 16034
133 Ga0111539_10030272 3300009094 Bacteria 6582
134 Ga0111539_10129199 3300009094 Bacteria 2959
135 Ga0105245_10002686 3300009098 Bacteria 16007
136 Ga0105245_10004750 3300009098 Bacteria 11996
137 Ga0105245_10197754 3300009098 Unclassified 1929
138 Ga0105247_10032236 3300009101 Bacteria 3183
139 Ga0114129_10002095 3300009147 Bacteria 27439
140 Ga0114129_10012483 3300009147 Bacteria 12096
141 Ga0114129_10030933 3300009147 Bacteria 7570
142 Ga0114129_10038458 3300009147 Bacteria 6749
143 Ga0114129_10040486 3300009147 Bacteria 6569
144 Ga0114129_10132215 3300009147 Unclassified 3426
145 Ga0114129_10143289 3300009147 Unclassified 3274
146 Ga0114129_10154041 3300009147 Bacteria 3144
147 Ga0114129_10247215 3300009147 Bacteria 2396
148 Ga0105243_10001313 3300009148 Bacteria 22196
149 Ga0105243_10003063 3300009148 Bacteria 13772
150 Ga0105243_10016139 3300009148 Bacteria 5649
151 Ga0105243_10155418 3300009148 Bacteria 1966
152 Ga0105241_10002691 3300009174 Bacteria 13318
153 Ga0105242_10000997 3300009176 Bacteria 22197
154 Ga0105242_10018059 3300009176 Bacteria 5508
155 Ga0105242_10021497 3300009176 Bacteria 5068
156 Ga0105242_10071895 3300009176 Unclassified 2872
157 Ga0105248_10005764 3300009177 Bacteria 13607
158 Ga0105248_10005975 3300009177 Bacteria 13368
159 Ga0105248_10009023 3300009177 Bacteria 10967
160 Ga0105248_10039664 3300009177 Bacteria 5277
161 Ga0105237_10020501 3300009545 Bacteria 6812
162 Ga0105238_10005907 3300009551 Bacteria 12126
163 Ga0105238_10023366 3300009551 Bacteria 6301
164 Ga0105238_10033378 3300009551 Bacteria 5239
165 Ga0105239_10001560 3300010375 Bacteria 30320
166 Ga0105239_10006411 3300010375 Bacteria 13658
167 Ga0105239_10117420 3300010375 Bacteria 2952
168 Ga0105246_10082564 3300011119 Unclassified 2294
169 Ga0157370_10016761 3300013104 Bacteria 7411
170 Ga0157370_10026109 3300013104 Bacteria 5771
171 Ga0157369_10003094 3300013105 Bacteria 19881
172 Ga0157369_10007863 3300013105 Bacteria 12261
173 Ga0157374_10008917 3300013296 Bacteria 8593
174 Ga0157374_10079161 3300013296 Bacteria 3114
175 Ga0157372_10022795 3300013307 Bacteria 6779
176 Ga0157372_10039142 3300013307 Bacteria 5234
177 Ga0157372_10110869 3300013307 Bacteria 3143
178 Ga0157375_10009837 3300013308 Bacteria 8410
179 Ga0157375_10027642 3300013308 Bacteria 5306
180 Ga0163163_10022620 3300014325 Bacteria 5958
181 Ga0163163_10027149 3300014325 Bacteria 5481
182 Ga0163163_10040328 3300014325 Bacteria 4559
183 Ga0163163_10068754 3300014325 Bacteria 3525
184 Ga0157380_10026407 3300014326 Bacteria 4409
185 Ga0157380_10045420 3300014326 Bacteria 3447
186 Ga0157377_10011997 3300014745 Unclassified 4345
187 Ga0157377_10029093 3300014745 Unclassified 2979
188 Ga0157379_10010434 3300014968 Bacteria 8096
189 Ga0157379_10014200 3300014968 Bacteria 6985
190 Ga0157379_10020785 3300014968 Bacteria 5809
191 Ga0157376_10015925 3300014969 Bacteria 5695
192 Ga0157376_10040530 3300014969 Bacteria 3807
193 Ga0157376_10128459 3300014969 Unclassified 2258
194 Ga0163161_10054542 3300017792 Unclassified 2901
195 Ga0207682_10001038 3300025893 Bacteria 12802
196 Ga0207642_10012849 3300025899 Bacteria 3036
197 Ga0207680_10023678 3300025903 Bacteria 3358
198 Ga0207680_10050427 3300025903 Unclassified 2483
199 Ga0207699_10085343 3300025906 Bacteria 1969
200 Ga0207645_10006944 3300025907 Bacteria 8063
201 Ga0207643_10007517 3300025908 Bacteria 5850
202 Ga0207643_10044855 3300025908 Unclassified 2496
203 Ga0207643_10051767 3300025908 Bacteria 2331
204 Ga0207707_10001082 3300025912 Bacteria 26051
205 Ga0207695_10001264 3300025913 Bacteria 43057
206 Ga0207695_10038175 3300025913 Bacteria 5174
207 Ga0207671_10077328 3300025914 Bacteria 2491
208 Ga0207663_10046272 3300025916 Bacteria 2680
209 Ga0207660_10088967 3300025917 Bacteria 2285
210 Ga0207662_10008177 3300025918 Bacteria 5720
211 Ga0207662_10016612 3300025918 Bacteria 4156
212 Ga0207652_10023445 3300025921 Bacteria 5113
213 Ga0207681_10014361 3300025923 Bacteria 4920
214 Ga0207681_10048648 3300025923 Bacteria 2863
215 Ga0207694_10000985 3300025924 Bacteria 24968
216 Ga0207694_10006061 3300025924 Bacteria 9249
217 Ga0207694_10059147 3300025924 Bacteria 2981
218 Ga0207650_10007265 3300025925 Bacteria 7544
219 Ga0207650_10062796 3300025925 Unclassified 2776
220 Ga0207659_10001310 3300025926 Bacteria 14865
221 Ga0207659_10117988 3300025926 Bacteria 2029
222 Ga0207687_10001962 3300025927 Bacteria 14159
223 Ga0207687_10052757 3300025927 Bacteria 2839
224 Ga0207700_10029511 3300025928 Bacteria 3871
225 Ga0207644_10003483 3300025931 Bacteria 10180
226 Ga0207644_10113380 3300025931 Bacteria 2053
227 Ga0207706_10078009 3300025933 Unclassified 2913
228 Ga0207706_10190115 3300025933 Unclassified 1802
229 Ga0207686_10000208 3300025934 Bacteria 44632
230 Ga0207686_10012328 3300025934 Bacteria 4699
231 Ga0207686_10028531 3300025934 Bacteria 3282
232 Ga0207686_10042135 3300025934 Unclassified 2788
233 Ga0207709_10000029 3300025935 Bacteria 333327
234 Ga0207709_10058479 3300025935 Bacteria 2396
235 Ga0207669_10037956 3300025937 Bacteria 2769
236 Ga0207704_10015954 3300025938 Bacteria 3845
237 Ga0207704_10091823 3300025938 Unclassified 1996
238 Ga0207691_10018083 3300025940 Bacteria 6676
239 Ga0207691_10018098 3300025940 Bacteria 6672
240 Ga0207691_10045225 3300025940 Bacteria 4048
241 Ga0207711_10013429 3300025941 Bacteria 6804
242 Ga0207711_10013819 3300025941 Bacteria 6703
243 Ga0207711_10061094 3300025941 Unclassified 3249
244 Ga0207689_10057948 3300025942 Bacteria 3186
245 Ga0207661_10113829 3300025944 Bacteria 2293
246 Ga0207679_10016395 3300025945 Bacteria 4921
247 Ga0207679_10054478 3300025945 Bacteria 2945
248 Ga0207667_10002201 3300025949 Bacteria 24454
249 Ga0207667_10004907 3300025949 Bacteria 16338
250 Ga0207651_10102241 3300025960 Bacteria 2130
251 Ga0207712_10109741 3300025961 Unclassified 2067
252 Ga0207640_10028390 3300025981 Unclassified 3421
253 Ga0207677_10048755 3300026023 Bacteria 2853
254 Ga0207703_10088466 3300026035 Bacteria 2599
255 Ga0207639_10008587 3300026041 Bacteria 7009
256 Ga0207708_10006412 3300026075 Bacteria 8717
257 Ga0207708_10015877 3300026075 Bacteria 5654
258 Ga0207702_10044406 3300026078 Unclassified 3735
259 Ga0207702_10075450 3300026078 Bacteria 2913
260 Ga0207641_10052546 3300026088 Bacteria 3451
261 Ga0207648_10013095 3300026089 Bacteria 7733
262 Ga0207648_10024402 3300026089 Bacteria 5398
263 Ga0207648_10039074 3300026089 Bacteria 4173
264 Ga0207674_10000042 3300026116 Bacteria 126790
265 Ga0207675_100003240 3300026118 Bacteria 15957
266 Ga0207675_100020707 3300026118 Bacteria 6132
267 Ga0207675_100091534 3300026118 Unclassified 2860
268 Ga0207683_10024531 3300026121 Bacteria 5195
269 Ga0207683_10033870 3300026121 Bacteria 4438
270 Ga0207428_10004863 3300027907 Bacteria 12663
271 Ga0207428_10005688 3300027907 Bacteria 11585
272 Ga0268266_10025685 3300028379 Bacteria 5011
273 Ga0268266_10026809 3300028379 Bacteria 4903
274 Ga0268265_10012153 3300028380 Bacteria 5831
275 Ga0268264_10078163 3300028381 Bacteria 2820
276 Ga0265314_10000503 3300031711 Bacteria 50401
277 Ga0265314_10042309 3300031711 Bacteria 3252
278 Ga0265314_10062172 3300031711 Bacteria 2539
279 Ga0265342_10039747 3300031712 Bacteria 2856
280 Ga0307405_10025277 3300031731 Bacteria 3406
281 Ga0307412_10038465 3300031911 Bacteria 3081
282 Ga0307414_10105495 3300032004 Bacteria 2131
283 Ga0373959_0000310 3300034820 Bacteria 10147
284 Ga0373928_0009425 3300035084 Bacteria 1906
285 Ga0373929_0000254 3300035085 Bacteria 9893
286 Ga0373929_0001011 3300035085 Bacteria 5454
287 Ga0373940_0002303 3300035088 Unclassified 3686
288 Ga0373952_0000110 3300035092 Bacteria 11114
289 Ga0373952_0009755 3300035092 Bacteria 1846
290 Ga0373923_0009039 3300035111 Unclassified 3580
291 Ga0373932_0000628 3300035112 Bacteria 10707
292 Ga0373932_0005199 3300035112 Unclassified 3059
293 Ga0373939_0000627 3300035114 Bacteria 8795
294 Ga0373941_0000188 3300035115 Bacteria 11707
295 Ga0373941_0002930 3300035115 Bacteria 3809
296 Ga0373954_0001256 3300035118 Bacteria 10197
297 Ga0373954_0010403 3300035118 Bacteria 4105
298 Ga0373960_0002114 3300035121 Unclassified 4474
299 Ga0373960_0007795 3300035121 Bacteria 2546
300 Ga0373942_0001025 3300035207 Bacteria 7605
301 Ga0373942_0001175 3300035207 Bacteria 6920
302 Ga0373961_0001297 3300035241 Bacteria 7593
303 Ga0373931_0015244 3300035691 Unclassified 3768
304 Ga0373933_0004203 3300035724 Bacteria 7938
305 Ga0373947_0006085 3300035725 Bacteria 7030
306 Ga0373937_0004570 3300036401 Bacteria 11742
307 Ga0373937_0013882 3300036401 Bacteria 7102
308 Ga0373937_0019501 3300036401 Bacteria 6068
309 Ga0373925_0004404 3300037068 Bacteria 10639
310 Ga0373925_0098811 3300037068 Bacteria 2241
311 Ga0436361_1146333 3300039447 Bacteria 3826
312 Ga0451853_3154446 3300041512 Unclassified 2265
313 Ga0451576_0005900 3300045051 Bacteria 15198
314 Ga0495592_0026231 3300046454 Unclassified 4419
315 Ga0495580_0019401 3300046472 Bacteria 5052
316 Ga0495580_0020449 3300046472 Bacteria 4897
317 Ga0495580_0056036 3300046472 Bacteria 2776
318 Ga0495580_0064344 3300046472 Unclassified 2571
319 Ga0495582_0002852 3300046473 Bacteria 9672
320 Ga0495664_0056936 3300046477 Bacteria 2326
321 Ga0495608_0051112 3300046511 Bacteria 2740
322 Ga0495630_0001627 3300046517 Bacteria 15623
323 Ga0495587_0061562 3300046536 Bacteria 2199
324 Ga0495587_0078425 3300046536 Bacteria 1916
325 Ga0495621_0022155 3300046539 Unclassified 2103
326 Ga0495645_0011825 3300046543 Bacteria 6150
327 Ga0495645_0116235 3300046543 Bacteria 1888
328 Ga0495633_0026207 3300046558 Bacteria 2863
329 Ga0495667_0044154 3300046559 Bacteria 2952
330 Ga0495599_0002231 3300046678 Bacteria 11281
331 Ga0495658_0059619 3300046683 Bacteria 2186
332 Ga0495613_0000545 3300046689 Bacteria 31217
333 Ga0495600_0009451 3300046809 Bacteria 6024
334 Ga0495636_0018939 3300047318 Bacteria 2764
335 Ga0495675_0020440 3300047444 Bacteria 4210
336 Ga0495684_0000211 3300047471 Bacteria 45257
337 Ga0495684_0054837 3300047471 Bacteria 3040
338 Ga0495684_0066495 3300047471 Bacteria 2741
339 Ga0495602_0001933 3300048088 Bacteria 20761
340 Ga0496105_0050214 3300048908 Bacteria 3446
341 Ga0496108_0028714 3300048911 Bacteria 4603
342 Ga0496109_0000016 3300048912 Bacteria 212455
343 Ga0496112_0004952 3300048915 Bacteria 11407
344 Ga0496113_0041040 3300048916 Bacteria 3412
345 Ga0496114_0001143 3300048917 Bacteria 20053
346 Ga0496114_0029085 3300048917 Unclassified 4539
347 Ga0501036_0032988 3300049572 Bacteria 4378
348 Ga0501040_0010391 3300049576 Bacteria 6084
349 Ga0501041_0001132 3300049577 Bacteria 14621
350 Ga0501042_0018391 3300049578 Bacteria 4837
351 Ga0501046_0062944 3300049580 Unclassified 2898
352 Ga0501047_0064959 3300049581 Bacteria 3519
353 Ga0501070_0041235 3300049586 Bacteria 3846
354 Ga0501075_0011990 3300049591 Bacteria 6152
355 Ga0501079_0047368 3300049741 Unclassified 3316
356 Ga0501081_0005259 3300049743 Bacteria 8340
357 Ga0501035_0084514 3300049822 Unclassified 2799
358 Ga0501044_0002596 3300049823 Bacteria 20527
359 nmdc:mga05p37_105921_c1 3300050507 Bacteria 3459
360 nmdc:mga05p37_162840_c1 3300050507 Bacteria 2724
361 nmdc:mga05p37_16493_c1 3300050507 Bacteria 8898
362 nmdc:mga05p37_39534_c1 3300050507 Bacteria 5792
363 nmdc:mga05p37_47517_c1 3300050507 Bacteria 5278
364 nmdc:mga05p37_75108_c1 3300050507 Bacteria 4161
365 nmdc:mga05p37_94621_c1 3300050507 Bacteria 3681
366 nmdc:mga0qj67_63582_c1 3300050509 Unclassified 2934
367 nmdc:mga06r32_106047_c1 3300050510 Bacteria 2761
368 nmdc:mga06r32_176612_c1 3300050510 Bacteria 2120
369 nmdc:mga06r32_19301_c1 3300050510 Bacteria 6255
370 nmdc:mga08y16_2405_c1 3300050511 Bacteria 19218
371 nmdc:mga0n895_20068_c1 3300050512 Bacteria 6223
372 nmdc:mga0n895_21409_c1 3300050512 Bacteria 6046
373 nmdc:mga0n895_41422_c1 3300050512 Unclassified 4478
374 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
375 nmdc:mga0n895_81846_c1 3300050512 Bacteria 3218
376 nmdc:mga0rr50_2498_c1 3300050513 Bacteria 10398
377 nmdc:mga0rr50_269_c1 3300050513 Bacteria 28252
378 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
379 nmdc:mga0rr50_7473_c1 3300050513 Bacteria 6744
380 nmdc:mga0rr50_77942_c1 3300050513 Bacteria 2548
381 nmdc:mga08x19_102_c1 3300050514 Bacteria 75432
382 nmdc:mga08x19_20313_c1 3300050514 Bacteria 4090
383 nmdc:mga08x19_27433_c1 3300050514 Bacteria 3562
384 nmdc:mga0a205_20603_c1 3300050515 Bacteria 6225
385 nmdc:mga0a205_21252_c1 3300050515 Bacteria 6138
386 Ga0495601_0019220 3300053077 Bacteria 4165
387 Ga0495601_0028918 3300053077 Bacteria 3435
388 Ga0495595_0024944 3300053084 Bacteria 2644
389 Ga0495619_0001960 3300053085 Bacteria 13732
390 Ga0495619_0070716 3300053085 Bacteria 2334
391 Ga0500641_0008089 3300053096 Unclassified 3747
392 Ga0500588_0001500 3300053146 Bacteria 4461
393 Ga0501084_0088964 3300054114 Bacteria 2592
394 Ga0501084_0148916 3300054114 Bacteria 1972
395 Ga0590071_000051 3300059421 Bacteria 31026
396 Ga0590075_000109 3300059424 Bacteria 21268
397 Ga0590077_000102 3300059426 Bacteria 22388
398 Ga0590077_003569 3300059426 Bacteria 3218
399 Ga0501082_0030880 3300060353 Bacteria 4618
400 Ga0501082_0040049 3300060353 Bacteria 4042
401 Ga0530510_0014721 3300061734 Bacteria 5522
402 Ga0105238_10003913
403 Ga0065712_10001403
404 Ga0065712_10077537
405 Ga0070658_10015924
406 Ga0070676_10010074
407 Ga0070683_100001153
408 Ga0070683_100009403
409 Ga0070683_100028577
410 Ga0070683_100043531
411 Ga0070690_100004751
412 Ga0070690_100014548
413 Ga0070677_10003501
414 Ga0068869_100048966
415 Ga0070666_10005143
416 Ga0070666_10006097
417 Ga0070680_100019880
418 Ga0068868_100013968
419 Ga0068868_100074245
420 Ga0070689_100012668
421 Ga0070691_10000325
422 Ga0070691_10005457
423 Ga0070687_100009917
424 Ga0070669_100006268
425 Ga0070669_100021597
426 Ga0070669_100022481
427 Ga0070669_100082302
428 Ga0070671_100030991
429 Ga0070674_100003018
430 Ga0070709_10003546
431 Ga0070714_100058082
432 Ga0070711_100054105
433 Ga0070705_100003584
434 Ga0070700_100008763
435 Ga0070700_100072024
436 Ga0070694_100001409
437 Ga0070694_100001660
438 Ga0070694_100002088
439 Ga0070694_100045211
440 Ga0070694_100090529
441 Ga0070681_10036305
442 Ga0068867_100019180
443 Ga0068867_100036569
444 Ga0070707_100024745
445 Ga0070707_100109056
446 Ga0070699_100052135
447 Ga0070699_100076136
448 Ga0070699_100117775
449 Ga0070699_100118120
450 Ga0070679_100056971
451 Ga0070679_100149916
452 Ga0070684_100000512
453 Ga0070684_100014536
454 Ga0070684_100104287
455 Ga0070697_100000949
456 Ga0070697_100012102
457 Ga0068853_100010637
458 Ga0070672_100051092
459 Ga0070672_100083249
460 Ga0070686_100002146
461 Ga0070686_100032352
462 Ga0070695_100004461
463 Ga0070696_100002743
464 Ga0070665_100001616
465 Ga0070665_100037823
466 Ga0070665_100058129
467 Ga0070665_100073407
468 Ga0070704_100019721
469 Ga0070704_100026521
470 Ga0068855_100003854
471 Ga0068855_100018046
472 Ga0068855_100032116
473 Ga0070664_100041344
474 Ga0070664_100108144
475 Ga0068857_100002676
476 Ga0068854_100007771
477 Ga0068856_100009340
478 Ga0068856_100032267
479 Ga0068856_100084199
480 Ga0070702_100011652
481 Ga0070702_100021170
482 Ga0068852_100050711
483 Ga0068859_100003168
484 Ga0068859_100028393
485 Ga0068859_100059627
486 Ga0068859_100147770
487 Ga0068864_100002112
488 Ga0068866_10004267
489 Ga0068870_10025908
490 Ga0068863_100138949
491 Ga0068858_100001895
492 Ga0068858_100002759
493 Ga0068858_100005285
494 Ga0068858_100047376
495 Ga0068858_100129895
496 Ga0068860_100003818
497 Ga0068860_100097774
498 Ga0068860_100150339
499 Ga0068860_100159530
500 Ga0081539_10000047
501 Ga0097621_100000879
502 Ga0097621_100002908
503 Ga0097621_100020648
504 Ga0097621_100043281
505 Ga0097621_100088641
506 Ga0068871_100001795
507 Ga0068871_100032293
508 Ga0075428_100004528
509 Ga0075431_100013432
510 Ga0075433_10076494
511 Ga0075434_100003264
512 Ga0075434_100003612
513 Ga0075434_100024569
514 Ga0075434_100027563
515 Ga0075434_100051853
516 Ga0068865_100025877
517 Ga0075436_100017140
518 Ga0075436_100101357
519 Ga0097620_100003168
520 Ga0097620_100028394
521 Ga0097620_100059623
522 Ga0097620_100147761
523 Ga0075435_100000051
524 Ga0075435_100000891
525 Ga0075435_100002569
526 Ga0075435_100046219
527 Ga0075435_100073301
528 Ga0105240_10001705
529 Ga0105240_10002620
530 Ga0105240_10111830
531 Ga0105240_10126328
532 Ga0111539_10002255
533 Ga0111539_10005752
534 Ga0111539_10030272
535 Ga0111539_10129199
536 Ga0105245_10002686
537 Ga0105245_10004750
538 Ga0105245_10197754
539 Ga0105247_10032236
540 Ga0114129_10002095
541 Ga0114129_10012483
542 Ga0114129_10030933
543 Ga0114129_10038458
544 Ga0114129_10040486
545 Ga0114129_10132215
546 Ga0114129_10143289
547 Ga0114129_10154041
548 Ga0114129_10247215
549 Ga0105243_10001313
550 Ga0105243_10003063
551 Ga0105243_10016139
552 Ga0105243_10155418
553 Ga0105241_10002691
554 Ga0105242_10000997
555 Ga0105242_10018059
556 Ga0105242_10021497
557 Ga0105242_10071895
558 Ga0105248_10005764
559 Ga0105248_10005975
560 Ga0105248_10009023
561 Ga0105248_10039664
562 Ga0105237_10020501
563 Ga0105238_10005907
564 Ga0105238_10023366
565 Ga0105238_10033378
566 Ga0105239_10001560
567 Ga0105239_10006411
568 Ga0105239_10117420
569 Ga0105246_10082564
570 Ga0157370_10016761
571 Ga0157370_10026109
572 Ga0157369_10003094
573 Ga0157369_10007863
574 Ga0157374_10008917
575 Ga0157374_10079161
576 Ga0157372_10022795
577 Ga0157372_10039142
578 Ga0157372_10110869
579 Ga0157375_10009837
580 Ga0157375_10027642
581 Ga0163163_10022620
582 Ga0163163_10027149
583 Ga0163163_10040328
584 Ga0163163_10068754
585 Ga0157380_10026407
586 Ga0157380_10045420
587 Ga0157377_10011997
588 Ga0157377_10029093
589 Ga0157379_10010434
590 Ga0157379_10014200
591 Ga0157379_10020785
592 Ga0157376_10015925
593 Ga0157376_10040530
594 Ga0157376_10128459
595 Ga0163161_10054542
596 Ga0207682_10001038
597 Ga0207642_10012849
598 Ga0207680_10023678
599 Ga0207680_10050427
600 Ga0207699_10085343
601 Ga0207645_10006944
602 Ga0207643_10007517
603 Ga0207643_10044855
604 Ga0207643_10051767
605 Ga0207707_10001082
606 Ga0207695_10001264
607 Ga0207695_10038175
608 Ga0207671_10077328
609 Ga0207663_10046272
610 Ga0207660_10088967
611 Ga0207662_10008177
612 Ga0207662_10016612
613 Ga0207652_10023445
614 Ga0207681_10014361
615 Ga0207681_10048648
616 Ga0207694_10000985
617 Ga0207694_10006061
618 Ga0207694_10059147
619 Ga0207650_10007265
620 Ga0207650_10062796
621 Ga0207659_10001310
622 Ga0207659_10117988
623 Ga0207687_10001962
624 Ga0207687_10052757
625 Ga0207700_10029511
626 Ga0207644_10003483
627 Ga0207644_10113380
628 Ga0207706_10078009
629 Ga0207706_10190115
630 Ga0207686_10000208
631 Ga0207686_10012328
632 Ga0207686_10028531
633 Ga0207686_10042135
634 Ga0207709_10000029
635 Ga0207709_10058479
636 Ga0207669_10037956
637 Ga0207704_10015954
638 Ga0207704_10091823
639 Ga0207691_10018083
640 Ga0207691_10018098
641 Ga0207691_10045225
642 Ga0207711_10013429
643 Ga0207711_10013819
644 Ga0207711_10061094
645 Ga0207689_10057948
646 Ga0207661_10113829
647 Ga0207679_10016395
648 Ga0207679_10054478
649 Ga0207667_10002201
650 Ga0207667_10004907
651 Ga0207651_10102241
652 Ga0207712_10109741
653 Ga0207640_10028390
654 Ga0207677_10048755
655 Ga0207703_10088466
656 Ga0207639_10008587
657 Ga0207708_10006412
658 Ga0207708_10015877
659 Ga0207702_10044406
660 Ga0207702_10075450
661 Ga0207641_10052546
662 Ga0207648_10013095
663 Ga0207648_10024402
664 Ga0207648_10039074
665 Ga0207674_10000042
666 Ga0207675_100003240
667 Ga0207675_100020707
668 Ga0207675_100091534
669 Ga0207683_10024531
670 Ga0207683_10033870
671 Ga0207428_10004863
672 Ga0207428_10005688
673 Ga0268266_10025685
674 Ga0268266_10026809
675 Ga0268265_10012153
676 Ga0268264_10078163
677 Ga0265314_10000503
678 Ga0265314_10042309
679 Ga0265314_10062172
680 Ga0265342_10039747
681 Ga0307405_10025277
682 Ga0307412_10038465
683 Ga0307414_10105495
684 Ga0373959_0000310
685 Ga0373928_0009425
686 Ga0373929_0000254
687 Ga0373929_0001011
688 Ga0373940_0002303
689 Ga0373952_0000110
690 Ga0373952_0009755
691 Ga0373923_0009039
692 Ga0373932_0000628
693 Ga0373932_0005199
694 Ga0373939_0000627
695 Ga0373941_0000188
696 Ga0373941_0002930
697 Ga0373954_0001256
698 Ga0373954_0010403
699 Ga0373960_0002114
700 Ga0373960_0007795
701 Ga0373942_0001025
702 Ga0373942_0001175
703 Ga0373961_0001297
704 Ga0373931_0015244
705 Ga0373933_0004203
706 Ga0373947_0006085
707 Ga0373937_0004570
708 Ga0373937_0013882
709 Ga0373937_0019501
710 Ga0373925_0004404
711 Ga0373925_0098811
712 Ga0436361_1146333
713 Ga0451853_3154446
714 Ga0451576_0005900
715 Ga0495592_0026231
716 Ga0495580_0019401
717 Ga0495580_0020449
718 Ga0495580_0056036
719 Ga0495580_0064344
720 Ga0495582_0002852
721 Ga0495664_0056936
722 Ga0495608_0051112
723 Ga0495630_0001627
724 Ga0495587_0061562
725 Ga0495587_0078425
726 Ga0495621_0022155
727 Ga0495645_0011825
728 Ga0495645_0116235
729 Ga0495633_0026207
730 Ga0495667_0044154
731 Ga0495599_0002231
732 Ga0495658_0059619
733 Ga0495613_0000545
734 Ga0495600_0009451
735 Ga0495636_0018939
736 Ga0495675_0020440
737 Ga0495684_0000211
738 Ga0495684_0054837
739 Ga0495684_0066495
740 Ga0495602_0001933
741 Ga0496105_0050214
742 Ga0496108_0028714
743 Ga0496109_0000016
744 Ga0496112_0004952
745 Ga0496113_0041040
746 Ga0496114_0001143
747 Ga0496114_0029085
748 Ga0501036_0032988
749 Ga0501040_0010391
750 Ga0501041_0001132
751 Ga0501042_0018391
752 Ga0501046_0062944
753 Ga0501047_0064959
754 Ga0501070_0041235
755 Ga0501075_0011990
756 Ga0501079_0047368
757 Ga0501081_0005259
758 Ga0501035_0084514
759 Ga0501044_0002596
760 nmdc:mga05p37_105921_c1
761 nmdc:mga05p37_162840_c1
762 nmdc:mga05p37_16493_c1
763 nmdc:mga05p37_39534_c1
764 nmdc:mga05p37_47517_c1
765 nmdc:mga05p37_75108_c1
766 nmdc:mga05p37_94621_c1
767 nmdc:mga0qj67_63582_c1
768 nmdc:mga06r32_106047_c1
769 nmdc:mga06r32_176612_c1
770 nmdc:mga06r32_19301_c1
771 nmdc:mga08y16_2405_c1
772 nmdc:mga0n895_20068_c1
773 nmdc:mga0n895_21409_c1
774 nmdc:mga0n895_41422_c1
775 nmdc:mga0n895_4_c1
776 nmdc:mga0n895_81846_c1
777 nmdc:mga0rr50_2498_c1
778 nmdc:mga0rr50_269_c1
779 nmdc:mga0rr50_4_c1
780 nmdc:mga0rr50_7473_c1
781 nmdc:mga0rr50_77942_c1
782 nmdc:mga08x19_102_c1
783 nmdc:mga08x19_20313_c1
784 nmdc:mga08x19_27433_c1
785 nmdc:mga0a205_20603_c1
786 nmdc:mga0a205_21252_c1
787 Ga0495601_0019220
788 Ga0495601_0028918
789 Ga0495595_0024944
790 Ga0495619_0001960
791 Ga0495619_0070716
792 Ga0500641_0008089
793 Ga0500588_0001500
794 Ga0501084_0088964
795 Ga0501084_0148916
796 Ga0590071_000051
797 Ga0590075_000109
798 Ga0590077_000102
799 Ga0590077_003569
800 Ga0501082_0030880
801 Ga0501082_0040049
802 Ga0530510_0014721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13360

PQQ_2

PQQ-like domain

199

436

0.79

PF13360

PQQ_2

PQQ-like domain

477

657

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g6q-assembly2.cif.gz_D crystal structure of the computationally designed ika4 protein 0.8254 398 577
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.7438 131 596
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.7432 134 596
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7396 400 543
5wg6-assembly2.cif.gz_D human polycomb repressive complex 2 in complex with gsk126 inhibitor 0.7194 396 534
ID Description Score Start End Superfamily
af_Q4L235_966_1098_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8569 321 482 2.40.128.630
af_Q9VLL0_923_1012_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8507 398 481 2.40.10.480
af_D4A5F5_744_892_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8365 396 543 2.40.128.630
af_A0A0P0WS15_683_864_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8356 391 596 2.130.10.10
af_Q55E07_784_923_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8325 413 588 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A523DIY9-F1-model_v4 Dehydrogenase 0.9768 512 596 GO:0016020
AF-A0A2E8L0I8-F1-model_v4 Uncharacterized protein 0.9636 518 594
AF-A0A2V8XKJ1-F1-model_v4 Cytochrome C oxidase Cbb3 0.9623 140 595 GO:0016491
AF-A0A2V8M621-F1-model_v4 Cytochrome C oxidase Cbb3 0.9581 271 456 GO:0016491
AF-A0A3N5GU66-F1-model_v4 Cytochrome C oxidase Cbb3 0.9575 136 595 GO:0016491

Map