F434784

General Info

Members Datasets Scaffolds Average Seq Length
401 342 802 337

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100218071|Ga0070698_1002180711
Length 332
Sequence MSYAVDARQDQSHKAKPVRGDWDRAEADALYDLPFADLMFRAQSIHRDNFDPNHVETASLLSIKTGGCPEDCGYCSQSAHYDTGLKATRLMEQADVVATAQRAKEAGASRFCMAAAWRNPKDRDLDQVCEMVSAVKGLGMETCVTLGGMLTPNQAARLHDAGLDFYNHNVDTSPEYYDKIISTRTLQDRIDTLAHVRDAGIKVCCGGIVGMGERVADRLGMLVLLANLPSHPESVPSNLWNEVKGVPVNDTAERPDPIALVRLIAVARILMPKSVVRLSAGRQYMTDELQALCFLAGANSIFIGDVLLTTKNPQRDRDASLLERLGIKSRLA

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
33 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
34 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
69 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
70 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
71 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
72 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
175 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
179 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
182 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
186 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
190 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
191 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
192 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
195 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
196 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
197 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
198 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
199 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
200 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
201 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
202 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
203 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
204 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
205 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
206 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
207 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
208 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
209 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
210 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
211 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
212 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
213 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
214 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
215 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
216 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
217 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
218 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
219 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
220 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
221 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
222 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
223 2791355199
224 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
225 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
226 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
227 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
228 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
229 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
230 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
231 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
232 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
233 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
234 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
235 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
236 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
237 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
238 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
239 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
240 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
241 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
242 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
243 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
244 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
245 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
246 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
247 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
248 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
249 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
250 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
251 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
252 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
253 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
254 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
255 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
256 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
257 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
258 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
259 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
260 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
261 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
262 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
263 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
264 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
265 2904699407
266 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
267 2906610324
268 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
269 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
270 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
271 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
272 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
273 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
274 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
275 2922425934
276 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
277 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
278 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
279 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
280 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
281 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
282 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
283 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
284 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
285 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
286 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
287 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
288 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
289 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
290 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
291 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
292 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
293 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
294 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
295 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
296 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
297 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
298 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
299 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
300 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
301 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
302 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
303 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
304 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
305 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
306 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
307 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
308 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
309 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
310 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
311 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
312 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
313 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
314 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
315 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
316 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
317 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
318 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
319 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
320 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
321 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
322 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
323 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
324 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
325 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
326 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
327 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
328 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
329 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
330 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
331 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
332 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
333 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
334 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
335 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
336 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
337 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
338 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
339 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
340 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
341 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
342 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.93
Metatranscriptomes 0
Isolates 42.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.22
Nodule 35.66
Rhizoplane 5.24
Rhizosphere 34.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100218071 3300005471 Bacteria 1842
2 Ga0070660_100155837 3300005339 Bacteria 1838
3 Ga0070661_100110544 3300005344 Bacteria 2052
4 Ga0070671_100221463 3300005355 Bacteria 1605
5 Ga0070674_100065486 3300005356 Bacteria 2550
6 Ga0070714_100309724 3300005435 Bacteria 1474
7 Ga0070713_100027592 3300005436 Bacteria 4471
8 Ga0070710_10012831 3300005437 Bacteria 4174
9 Ga0070701_10042311 3300005438 Bacteria 2325
10 Ga0070711_100228319 3300005439 Bacteria 1450
11 Ga0070663_100053690 3300005455 Bacteria 2878
12 Ga0070678_100010831 3300005456 Bacteria 5591
13 Ga0068867_100050994 3300005459 Bacteria 3051
14 Ga0068867_100264251 3300005459 Bacteria 1404
15 Ga0070706_100032749 3300005467 Bacteria 4796
16 Ga0070684_100155424 3300005535 Bacteria 2074
17 Ga0070697_100118558 3300005536 Bacteria 2212
18 Ga0070672_100335224 3300005543 Bacteria 1287
19 Ga0070664_100069875 3300005564 Bacteria 3006
20 Ga0068857_100012100 3300005577 Bacteria 7503
21 Ga0068856_100145926 3300005614 Bacteria 2374
22 Ga0070702_100239448 3300005615 Bacteria 1224
23 Ga0068851_10022167 3300005834 Bacteria 3091
24 Ga0081540_1071472 3300005983 Bacteria 1603
25 Ga0075365_10012136 3300006038 Bacteria 5101
26 Ga0075364_10014883 3300006051 Bacteria 4814
27 Ga0075364_10069178 3300006051 Bacteria 2322
28 Ga0070712_100001472 3300006175 Bacteria 14360
29 Ga0075367_10013925 3300006178 Bacteria 4340
30 Ga0075367_10094665 3300006178 Bacteria 1821
31 Ga0075369_10001752 3300006186 Bacteria 7523
32 Ga0097621_100055697 3300006237 Bacteria 3230
33 Ga0075370_10182676 3300006353 Bacteria 1235
34 Ga0068871_100176491 3300006358 Bacteria 1834
35 Ga0099825_1026055 3300006941 Bacteria 3170
36 Ga0099824_1031859 3300006942 Bacteria 1950
37 Ga0099823_1043414 3300006944 Bacteria 3101
38 Ga0105240_10056822 3300009093 Bacteria 4895
39 Ga0111539_10086008 3300009094 Bacteria 3695
40 Ga0105245_10076371 3300009098 Bacteria 3051
41 Ga0105249_10479481 3300009553 Bacteria 1286
42 Ga0105239_10171512 3300010375 Bacteria 2426
43 Ga0105246_10016427 3300011119 Bacteria 4688
44 Ga0157370_10141829 3300013104 Bacteria 2239
45 Ga0157369_10001194 3300013105 Bacteria 32366
46 Ga0157369_10402586 3300013105 Bacteria 1420
47 Ga0157374_10264896 3300013296 Bacteria 1694
48 Ga0157378_10044185 3300013297 Bacteria 3956
49 Ga0163162_10014097 3300013306 Bacteria 7812
50 Ga0163162_10240789 3300013306 Bacteria 1940
51 Ga0157375_10035905 3300013308 Bacteria 4736
52 Ga0163163_10444944 3300014325 Bacteria 1356
53 Ga0157376_10319863 3300014969 Bacteria 1475
54 Ga0209455_1006849 3300025272 Bacteria 3310
55 Ga0209564_1000522 3300025295 Bacteria 62793
56 Ga0209564_1006832 3300025295 Bacteria 6027
57 Ga0207685_10058827 3300025905 Bacteria 1513
58 Ga0207684_10023351 3300025910 Bacteria 5280
59 Ga0207684_10106400 3300025910 Bacteria 2399
60 Ga0207695_10147821 3300025913 Bacteria 2292
61 Ga0207693_10003335 3300025915 Bacteria 13737
62 Ga0207663_10015740 3300025916 Bacteria 4181
63 Ga0207649_10080902 3300025920 Bacteria 2102
64 Ga0207706_10032110 3300025933 Bacteria 4675
65 Ga0207711_10071795 3300025941 Bacteria 3005
66 Ga0207679_10085024 3300025945 Bacteria 2429
67 Ga0207712_10013104 3300025961 Bacteria 5312
68 Ga0207668_10158763 3300025972 Bacteria 1759
69 Ga0207639_10082362 3300026041 Bacteria 2551
70 Ga0207678_10026725 3300026067 Bacteria 5035
71 Ga0207678_10059003 3300026067 Bacteria 3302
72 Ga0207702_10221050 3300026078 Bacteria 1765
73 Ga0207648_10315158 3300026089 Bacteria 1405
74 Ga0207674_10039636 3300026116 Bacteria 4883
75 Ga0207675_100055703 3300026118 Bacteria 3689
76 Ga0209389_1000048 3300027296 Bacteria 115074
77 Ga0209389_1000659 3300027296 Bacteria 21422
78 Ga0209589_1000004 3300027357 Bacteria 578529
79 Ga0209589_1000034 3300027357 Bacteria 138086
80 Ga0209489_100004 3300027361 Bacteria 578529
81 Ga0209489_100009 3300027361 Bacteria 263873
82 Ga0209489_104793 3300027361 Bacteria 24481
83 Ga0209700_100004 3300027363 Bacteria 578529
84 Ga0209700_100020 3300027363 Bacteria 235733
85 Ga0209588_1008808 3300027671 Bacteria 3001
86 Ga0268266_10098418 3300028379 Bacteria 2574
87 Ga0265319_1012596 3300028563 Bacteria 3412
88 Ga0265334_10003663 3300028573 Bacteria 6953
89 Ga0265318_10005492 3300028577 Bacteria 5950
90 Ga0265323_10000276 3300028653 Bacteria 29667
91 Ga0265336_10000268 3300028666 Bacteria 36633
92 Ga0265338_10000280 3300028800 Bacteria 91942
93 Ga0265339_10017557 3300031249 Bacteria 4234
94 Ga0265331_10006679 3300031250 Bacteria 6775
95 Ga0265314_10024378 3300031711 Bacteria 4587
96 Ga0265342_10019143 3300031712 Bacteria 4416
97 Ga0307412_10147543 3300031911 Bacteria 1731
98 Ga0307510_10016030 3300033180 Bacteria 8849
99 Ga0315911_1000019 3300033442 Bacteria 146597
100 Ga0373934_0051262 3300035086 Bacteria 1636
101 Ga0373923_0013168 3300035111 Bacteria 3076
102 Ga0373956_0027379 3300035119 Bacteria 2475
103 Ga0373955_0018136 3300035172 Bacteria 3495
104 Ga0373933_0123315 3300035724 Bacteria 1624
105 Ga0395905_0078991 3300037471 Bacteria 3083
106 Ga0395905_0119941 3300037471 Bacteria 2472
107 Ga0466959_0073763 3300045049 Bacteria 2468
108 Ga0495592_0161556 3300046454 Bacteria 1541
109 Ga0495603_0003318 3300046455 Bacteria 9581
110 Ga0495638_0013556 3300046460 Bacteria 5541
111 Ga0495653_0180060 3300046463 Bacteria 1451
112 Ga0495596_0061669 3300046500 Bacteria 1460
113 Ga0495583_0018801 3300046506 Bacteria 3627
114 Ga0495616_0077950 3300046513 Bacteria 1590
115 Ga0495618_0170029 3300046514 Bacteria 1387
116 Ga0495620_0058693 3300046515 Bacteria 1610
117 Ga0495628_0183172 3300046516 Bacteria 1583
118 Ga0495643_0048760 3300046522 Bacteria 2287
119 Ga0495666_0061012 3300046526 Bacteria 1802
120 Ga0495652_0231788 3300046529 Bacteria 1380
121 Ga0495597_0040596 3300046542 Bacteria 2080
122 Ga0495645_0016300 3300046543 Bacteria 5303
123 Ga0495668_0075122 3300046616 Bacteria 1856
124 Ga0495625_0220688 3300046660 Bacteria 1242
125 Ga0495657_0206440 3300046675 Bacteria 1195
126 Ga0495599_0042497 3300046678 Bacteria 2852
127 Ga0495623_0035808 3300046679 Bacteria 3181
128 Ga0495671_0015569 3300046692 Bacteria 4071
129 Ga0495672_0069714 3300047320 Bacteria 1995
130 Ga0495680_0056251 3300047322 Bacteria 3046
131 Ga0495684_0287532 3300047471 Bacteria 1184
132 Ga0495686_0022340 3300047472 Bacteria 4187
133 Ga0495602_0098099 3300048088 Bacteria 2412
134 Ga0496102_0008228 3300048905 Bacteria 8928
135 Ga0496102_0181195 3300048905 Bacteria 1985
136 Ga0496103_0009964 3300048906 Bacteria 5620
137 Ga0496104_0034318 3300048907 Bacteria 4730
138 Ga0496105_0094906 3300048908 Bacteria 2464
139 Ga0496106_0155024 3300048909 Bacteria 1808
140 Ga0496106_0345127 3300048909 Bacteria 1196
141 Ga0496107_0230664 3300048910 Bacteria 1378
142 Ga0496108_0421506 3300048911 Bacteria 1166
143 Ga0496109_0117727 3300048912 Bacteria 2473
144 Ga0496109_0217284 3300048912 Bacteria 1798
145 Ga0496110_0022901 3300048913 Bacteria 5308
146 Ga0496111_0066755 3300048914 Bacteria 2613
147 Ga0496112_0014509 3300048915 Bacteria 7316
148 Ga0496112_0015330 3300048915 Bacteria 7148
149 Ga0496113_0065246 3300048916 Bacteria 2755
150 Ga0496114_0008218 3300048917 Bacteria 8270
151 Ga0496114_0587739 3300048917 Bacteria 982
152 Ga0496115_0064181 3300048918 Bacteria 2964
153 Ga0496118_0038445 3300048921 Bacteria 3835
154 Ga0496120_0017719 3300048923 Bacteria 4606
155 Ga0496120_0017792 3300048923 Bacteria 4596
156 Ga0496121_0017543 3300048924 Bacteria 7302
157 Ga0496121_0100054 3300048924 Bacteria 2239
158 Ga0496121_0208285 3300048924 Bacteria 1387
159 Ga0496122_0013843 3300048925 Bacteria 7854
160 Ga0496123_0023755 3300048926 Bacteria 4683
161 Ga0496125_0001982 3300048928 Bacteria 27855
162 Ga0496125_0040741 3300048928 Bacteria 3980
163 Ga0496126_0016759 3300048929 Bacteria 7318
164 Ga0496126_0044445 3300048929 Bacteria 4090
165 Ga0496126_0052744 3300048929 Bacteria 3694
166 Ga0496126_0088506 3300048929 Bacteria 2727
167 Ga0496126_0121782 3300048929 Bacteria 2261
168 Ga0501031_0000072 3300049568 Bacteria 53648
169 Ga0501032_0000110 3300049569 Bacteria 70189
170 Ga0501033_0000562 3300049570 Bacteria 34520
171 Ga0501034_0000181 3300049571 Bacteria 117767
172 Ga0501036_0003302 3300049572 Bacteria 12872
173 Ga0501037_0000059 3300049573 Bacteria 101459
174 Ga0501038_0000143 3300049574 Bacteria 61292
175 Ga0501039_0000400 3300049575 Bacteria 31170
176 Ga0501043_0000188 3300049579 Bacteria 56057
177 Ga0501046_0000153 3300049580 Bacteria 71187
178 Ga0501046_0110729 3300049580 Bacteria 2098
179 Ga0501048_0000328 3300049582 Bacteria 32753
180 Ga0501067_0000706 3300049583 Bacteria 17982
181 Ga0501068_0005743 3300049584 Bacteria 6803
182 Ga0501069_0002363 3300049585 Bacteria 9567
183 Ga0501070_0001602 3300049586 Bacteria 20078
184 Ga0501073_0000436 3300049589 Bacteria 28732
185 Ga0501074_0000156 3300049590 Bacteria 35744
186 Ga0501079_0001337 3300049741 Bacteria 17334
187 Ga0501080_0003222 3300049742 Bacteria 14400
188 Ga0501083_0000244 3300049744 Bacteria 34784
189 Ga0501035_0000383 3300049822 Bacteria 50837
190 Ga0501044_0003412 3300049823 Bacteria 17902
191 Ga0501044_0147063 3300049823 Bacteria 2341
192 Ga0501045_0010824 3300049824 Bacteria 6393
193 nmdc:mga00v17_31493_c1 3300050491 Bacteria 3128
194 nmdc:mga07m45_167776_c1 3300050496 Bacteria 1275
195 nmdc:mga08y16_248079_c1 3300050511 Bacteria 1840
196 nmdc:mga0sz30_2251_c1 3300050516 Bacteria 6905
197 Ga0495612_0054069 3300053078 Bacteria 1654
198 Ga0500635_0000423 3300053080 Bacteria 12481
199 Ga0495595_0107648 3300053084 Bacteria 1349
200 Ga0500581_024264 3300053089 Bacteria 3078
201 Ga0500566_0000227 3300053094 Bacteria 30040
202 Ga0500641_0011358 3300053096 Bacteria 3230
203 Ga0500650_0095292 3300053098 Bacteria 1393
204 Ga0500554_003733 3300053102 Bacteria 3146
205 Ga0500556_0000005 3300053104 Bacteria 581135
206 Ga0500572_001007 3300053111 Bacteria 8500
207 Ga0500591_064677 3300053115 Bacteria 1675
208 Ga0500592_001438 3300053116 Bacteria 3854
209 Ga0500608_003363 3300053122 Bacteria 5989
210 Ga0500614_000333 3300053123 Bacteria 12176
211 Ga0500642_0000009 3300053130 Bacteria 286829
212 Ga0500652_000316 3300053131 Bacteria 17284
213 Ga0500568_0000871 3300053139 Bacteria 21168
214 Ga0500586_012375 3300053145 Bacteria 2480
215 Ga0500603_000051 3300053150 Bacteria 28687
216 Ga0500603_000146 3300053150 Bacteria 17086
217 Ga0500604_0002441 3300053151 Bacteria 5068
218 Ga0500616_0000118 3300053153 Bacteria 143496
219 Ga0500622_0001397 3300053156 Bacteria 19447
220 Ga0500630_000387 3300053159 Bacteria 18759
221 Ga0500633_0033197 3300053160 Bacteria 1682
222 Ga0500639_000022 3300053163 Bacteria 87814
223 Ga0500636_0016355 3300053177 Bacteria 4375
224 Ga0500636_0049393 3300053177 Bacteria 2475
225 Ga0500637_0000665 3300053178 Bacteria 13638
226 Ga0500637_0011647 3300053178 Bacteria 4555
227 Ga0500637_0062494 3300053178 Bacteria 2134
228 Ga0500637_0168466 3300053178 Bacteria 1260
229 Ga0500611_020289 3300053727 Bacteria 1253
230 Ga0500596_000113 3300053735 Bacteria 11428
231 2507506408 2507262055 Bacteria 8048963
232 2507506631 2507262055 Bacteria 8048963
233 2508540619 2508501009 Bacteria 7784016
234 2508540702 2508501009 Bacteria 7784016
235 2508696688 2508501042 Bacteria 8719808
236 2509149438 2508501128 Bacteria 8613869
237 2513622813 2513237092 Bacteria 8341956
238 2513625932 2513237092 Bacteria 8341956
239 2513643972 2513237094 Bacteria 8789602
240 2513644245 2513237094 Bacteria 8789602
241 2513653284 2513237095 Bacteria 8976980
242 2513658540 2513237096 Bacteria 8722461
243 2513674536 2513237098 Bacteria 9902361
244 2513695526 2513237101 Bacteria 7952346
245 2513860122 2513237137 Bacteria 9558895
246 2513920656 2513237145 Bacteria 8979722
247 2514017515 2513237161 Bacteria 8871253
248 2515630652 2515154112 Bacteria 8294334
249 2517108262 2517093001 Bacteria 9002274
250 2517888578 2517572143 Bacteria 9484767
251 2524442648 2524023205 Bacteria 8918781
252 2524463735 2524023210 Bacteria 9029266
253 2524535109 2524023228 Bacteria 10118060
254 2603858034 2602042107 Bacteria 6226103
255 2617353379 2617270735 Bacteria 9163226
256 2671119758 2667528175 Bacteria 7532676
257 2723843922 2721755755 Bacteria 8322773
258 2728753470 2728368998 Bacteria 8720350
259 2745074983 2744054633 Bacteria 8678936
260 2745082529 2744054633 Bacteria 8678936
261 2793067398 2791355197 Bacteria 8420563
262 2793082546
263 2805922015 2802429603 Bacteria 8777136
264 2805922164 2802429603 Bacteria 8777136
265 2824609414 2824609381 Bacteria 8672835
266 2824626942 2824626560 Bacteria 8813858
267 2824635388 2824635225 Bacteria 8785348
268 2824644227 2824644064 Bacteria 8743947
269 2824654691 2824653114 Bacteria 8493680
270 2824662716 2824661429 Bacteria 9877870
271 2824679684 2824679649 Bacteria 8248951
272 2824704824 2824704595 Bacteria 9667483
273 2824714899 2824714736 Bacteria 8717648
274 2824724037 2824723954 Bacteria 8758240
275 2824733434 2824732956 Bacteria 7810675
276 2824754827 2824753945 Bacteria 9787441
277 2824764577 2824763712 Bacteria 9792355
278 2824779609 2824773399 Bacteria 8360218
279 2838124948 2838122688 Bacteria 8803140
280 2841965899 2841957949 Bacteria 8652217
281 2841976696 2841974524 Bacteria 8931498
282 2841986169 2841983080 Bacteria 8395090
283 2847933502 2847930680 Bacteria 9342022
284 2857527416 2857524615 Bacteria 6615449
285 2874595063 2874590934 Bacteria 8299676
286 2874612089 2874604998 Bacteria 7834745
287 2874613734 2874612657 Bacteria 8252029
288 2876767307 2876761206 Bacteria 10111113
289 2876774581 2876771140 Bacteria 8287509
290 2876823319 2876818435 Bacteria 8274608
291 2879079150 2879074833 Bacteria 8279565
292 2879088882 2879083081 Bacteria 8587928
293 2879100798 2879099564 Bacteria 10442239
294 2879114021 2879110137 Bacteria 8907982
295 2881666803 2881665667 Bacteria 8175609
296 2885372434 2885366525 Bacteria 8326213
297 2885381797 2885374607 Bacteria 8927485
298 2885383490 2885383462 Bacteria 9473874
299 2888380689 2888378607 Bacteria 9652610
300 2889041884 2889033259 Bacteria 9099371
301 2903754581 2903748898 Bacteria 9972761
302 2903769370 2903768456 Bacteria 9749579
303 2904666786 2904666416 Bacteria 8226587
304 2904692877 2904690495 Bacteria 9412302
305 2904697130 2904690495 Bacteria 9412302
306 2904708186
307 2904713039 2904711408 Bacteria 9771557
308 2906614067
309 2906630897 2906626472 Bacteria 8826946
310 2906637737 2906635258 Bacteria 8601019
311 2906650744 2906643746 Bacteria 8722424
312 2906668305 2906660503 Bacteria 8595048
313 2908758297 2908756301 Bacteria 8864324
314 2908762559 2908756301 Bacteria 8864324
315 2922366266 2922361189 Bacteria 7436256
316 2922386668 2922386360 Bacteria 7017218
317 2922434554
318 2932793685 2932784394 Bacteria 9704911
319 2932801101 2932794094 Bacteria 7915132
320 2935613973 2935608549 Bacteria 8203142
321 2935637592 2935630451 Bacteria 8169952
322 2935646762 2935638405 Bacteria 10015038
323 2935647710 2935638405 Bacteria 10015038
324 2935652694 2935648319 Bacteria 8801166
325 2935661321 2935656913 Bacteria 8965014
326 2935674536 2935665750 Bacteria 9571747
327 2935690671 2935684952 Bacteria 9590419
328 2935712407 2935703347 Bacteria 10242284
329 2935717633 2935713505 Bacteria 9608509
330 2935727217 2935722832 Bacteria 9608746
331 2935735987 2935732158 Bacteria 9706831
332 2935744742 2935741537 Bacteria 9707219
333 2935755680 2935750917 Bacteria 9590372
334 2935781603 2935777560 Bacteria 8077691
335 2935784751 2935777560 Bacteria 8077691
336 2935836048 2935827899 Bacteria 10038562
337 2935836405 2935827899 Bacteria 10038562
338 2935854502 2935847175 Bacteria 8228321
339 2935872857 2935864058 Bacteria 9784707
340 2935882167 2935873716 Bacteria 9632195
341 2935882816 2935873716 Bacteria 9632195
342 2935889050 2935883170 Bacteria 7964738
343 2935889578 2935883170 Bacteria 7964738
344 2935967130 2935959822 Bacteria 7869783
345 2935983318 2935975950 Bacteria 8347125
346 2935991592 2935984226 Bacteria 8302647
347 2936000025 2935992306 Bacteria 9802711
348 2936015608 2936011229 Bacteria 8801034
349 2936024242 2936019824 Bacteria 8804134
350 2936033493 2936028420 Bacteria 8965941
351 2936051351 2936046547 Bacteria 8903709
352 2936062549 2936055302 Bacteria 8785755
353 2940561039 2940556831 Bacteria 9590747
354 2941514171 2941507105 Bacteria 8166816
355 2941522132 2941515067 Bacteria 8166720
356 2941529870 2941523033 Bacteria 8169134
357 2941546435 2941538514 Bacteria 9402094
358 3005483675 3005474847 Bacteria 9259049
359 3005490715 3005483717 Bacteria 7877331
360 8006936530 8006933436 Bacteria 10410654
361 8006968037 8006964411 Bacteria 8966052
362 8006976496 8006973647 Bacteria 10679141
363 8006992219 8006984368 Bacteria 9651211
364 8006999389 8006994254 Bacteria 8309700
365 8016522482 8016522445 Bacteria 8156687
366 8016527612 8016522445 Bacteria 8156687
367 8016531252 8016530956 Bacteria 8155261
368 8016532709 8016530956 Bacteria 8155261
369 8016544179 8016539877 Bacteria 8155419
370 8016545936 8016539877 Bacteria 8155419
371 8016548871 8016548790 Bacteria 8155074
372 8016556174 8016548790 Bacteria 8155074
373 8016564542 8016557553 Bacteria 8154380
374 8016566123 8016557553 Bacteria 8154380
375 8016571014 8016566248 Bacteria 8158151
376 8016575228 8016566248 Bacteria 8158151
377 8016575634 8016575299 Bacteria 8154085
378 8016583520 8016575299 Bacteria 8154085
379 8016584176 8016583857 Bacteria 10421953
380 8016584475 8016583857 Bacteria 10421953
381 8016595297 8016595262 Bacteria 8149947
382 8016602199 8016595262 Bacteria 8149947
383 8016612877 8016603502 Bacteria 8731218
384 8019530444 8019530166 Bacteria 8155624
385 8019532523 8019530166 Bacteria 8155624
386 8019562127 8019555841 Bacteria 9642137
387 8019572193 8019565922 Bacteria 9639779
388 8019585720 8019576017 Bacteria 10049540
389 8019593659 8019586578 Bacteria 10212056
390 8019597767 8019597564 Bacteria 10041141
391 8019610618 8019608314 Bacteria 10042931
392 8019621161 8019619141 Bacteria 9218857
393 8019629378 8019629233 Bacteria 8687553
394 8019648599 8019638758 Bacteria 9062356
395 8019654318 8019648815 Bacteria 10014479
396 8019655055 8019648815 Bacteria 10014479
397 8019659493 8019659431 Bacteria 8577854
398 8019668993 8019668869 Bacteria 8791617
399 8019678438 8019678201 Bacteria 8863603
400 8019678521 8019678201 Bacteria 8863603
401 8056694898 8056689827 Bacteria 6712655
402 Ga0070698_100218071
403 Ga0070660_100155837
404 Ga0070661_100110544
405 Ga0070671_100221463
406 Ga0070674_100065486
407 Ga0070714_100309724
408 Ga0070713_100027592
409 Ga0070710_10012831
410 Ga0070701_10042311
411 Ga0070711_100228319
412 Ga0070663_100053690
413 Ga0070678_100010831
414 Ga0068867_100050994
415 Ga0068867_100264251
416 Ga0070706_100032749
417 Ga0070684_100155424
418 Ga0070697_100118558
419 Ga0070672_100335224
420 Ga0070664_100069875
421 Ga0068857_100012100
422 Ga0068856_100145926
423 Ga0070702_100239448
424 Ga0068851_10022167
425 Ga0081540_1071472
426 Ga0075365_10012136
427 Ga0075364_10014883
428 Ga0075364_10069178
429 Ga0070712_100001472
430 Ga0075367_10013925
431 Ga0075367_10094665
432 Ga0075369_10001752
433 Ga0097621_100055697
434 Ga0075370_10182676
435 Ga0068871_100176491
436 Ga0099825_1026055
437 Ga0099824_1031859
438 Ga0099823_1043414
439 Ga0105240_10056822
440 Ga0111539_10086008
441 Ga0105245_10076371
442 Ga0105249_10479481
443 Ga0105239_10171512
444 Ga0105246_10016427
445 Ga0157370_10141829
446 Ga0157369_10001194
447 Ga0157369_10402586
448 Ga0157374_10264896
449 Ga0157378_10044185
450 Ga0163162_10014097
451 Ga0163162_10240789
452 Ga0157375_10035905
453 Ga0163163_10444944
454 Ga0157376_10319863
455 Ga0209455_1006849
456 Ga0209564_1000522
457 Ga0209564_1006832
458 Ga0207685_10058827
459 Ga0207684_10023351
460 Ga0207684_10106400
461 Ga0207695_10147821
462 Ga0207693_10003335
463 Ga0207663_10015740
464 Ga0207649_10080902
465 Ga0207706_10032110
466 Ga0207711_10071795
467 Ga0207679_10085024
468 Ga0207712_10013104
469 Ga0207668_10158763
470 Ga0207639_10082362
471 Ga0207678_10026725
472 Ga0207678_10059003
473 Ga0207702_10221050
474 Ga0207648_10315158
475 Ga0207674_10039636
476 Ga0207675_100055703
477 Ga0209389_1000048
478 Ga0209389_1000659
479 Ga0209589_1000004
480 Ga0209589_1000034
481 Ga0209489_100004
482 Ga0209489_100009
483 Ga0209489_104793
484 Ga0209700_100004
485 Ga0209700_100020
486 Ga0209588_1008808
487 Ga0268266_10098418
488 Ga0265319_1012596
489 Ga0265334_10003663
490 Ga0265318_10005492
491 Ga0265323_10000276
492 Ga0265336_10000268
493 Ga0265338_10000280
494 Ga0265339_10017557
495 Ga0265331_10006679
496 Ga0265314_10024378
497 Ga0265342_10019143
498 Ga0307412_10147543
499 Ga0307510_10016030
500 Ga0315911_1000019
501 Ga0373934_0051262
502 Ga0373923_0013168
503 Ga0373956_0027379
504 Ga0373955_0018136
505 Ga0373933_0123315
506 Ga0395905_0078991
507 Ga0395905_0119941
508 Ga0466959_0073763
509 Ga0495592_0161556
510 Ga0495603_0003318
511 Ga0495638_0013556
512 Ga0495653_0180060
513 Ga0495596_0061669
514 Ga0495583_0018801
515 Ga0495616_0077950
516 Ga0495618_0170029
517 Ga0495620_0058693
518 Ga0495628_0183172
519 Ga0495643_0048760
520 Ga0495666_0061012
521 Ga0495652_0231788
522 Ga0495597_0040596
523 Ga0495645_0016300
524 Ga0495668_0075122
525 Ga0495625_0220688
526 Ga0495657_0206440
527 Ga0495599_0042497
528 Ga0495623_0035808
529 Ga0495671_0015569
530 Ga0495672_0069714
531 Ga0495680_0056251
532 Ga0495684_0287532
533 Ga0495686_0022340
534 Ga0495602_0098099
535 Ga0496102_0008228
536 Ga0496102_0181195
537 Ga0496103_0009964
538 Ga0496104_0034318
539 Ga0496105_0094906
540 Ga0496106_0155024
541 Ga0496106_0345127
542 Ga0496107_0230664
543 Ga0496108_0421506
544 Ga0496109_0117727
545 Ga0496109_0217284
546 Ga0496110_0022901
547 Ga0496111_0066755
548 Ga0496112_0014509
549 Ga0496112_0015330
550 Ga0496113_0065246
551 Ga0496114_0008218
552 Ga0496114_0587739
553 Ga0496115_0064181
554 Ga0496118_0038445
555 Ga0496120_0017719
556 Ga0496120_0017792
557 Ga0496121_0017543
558 Ga0496121_0100054
559 Ga0496121_0208285
560 Ga0496122_0013843
561 Ga0496123_0023755
562 Ga0496125_0001982
563 Ga0496125_0040741
564 Ga0496126_0016759
565 Ga0496126_0044445
566 Ga0496126_0052744
567 Ga0496126_0088506
568 Ga0496126_0121782
569 Ga0501031_0000072
570 Ga0501032_0000110
571 Ga0501033_0000562
572 Ga0501034_0000181
573 Ga0501036_0003302
574 Ga0501037_0000059
575 Ga0501038_0000143
576 Ga0501039_0000400
577 Ga0501043_0000188
578 Ga0501046_0000153
579 Ga0501046_0110729
580 Ga0501048_0000328
581 Ga0501067_0000706
582 Ga0501068_0005743
583 Ga0501069_0002363
584 Ga0501070_0001602
585 Ga0501073_0000436
586 Ga0501074_0000156
587 Ga0501079_0001337
588 Ga0501080_0003222
589 Ga0501083_0000244
590 Ga0501035_0000383
591 Ga0501044_0003412
592 Ga0501044_0147063
593 Ga0501045_0010824
594 nmdc:mga00v17_31493_c1
595 nmdc:mga07m45_167776_c1
596 nmdc:mga08y16_248079_c1
597 nmdc:mga0sz30_2251_c1
598 Ga0495612_0054069
599 Ga0500635_0000423
600 Ga0495595_0107648
601 Ga0500581_024264
602 Ga0500566_0000227
603 Ga0500641_0011358
604 Ga0500650_0095292
605 Ga0500554_003733
606 Ga0500556_0000005
607 Ga0500572_001007
608 Ga0500591_064677
609 Ga0500592_001438
610 Ga0500608_003363
611 Ga0500614_000333
612 Ga0500642_0000009
613 Ga0500652_000316
614 Ga0500568_0000871
615 Ga0500586_012375
616 Ga0500603_000051
617 Ga0500603_000146
618 Ga0500604_0002441
619 Ga0500616_0000118
620 Ga0500622_0001397
621 Ga0500630_000387
622 Ga0500633_0033197
623 Ga0500639_000022
624 Ga0500636_0016355
625 Ga0500636_0049393
626 Ga0500637_0000665
627 Ga0500637_0011647
628 Ga0500637_0062494
629 Ga0500637_0168466
630 Ga0500611_020289
631 Ga0500596_000113
632 2507506408
633 2507506631
634 2508540619
635 2508540702
636 2508696688
637 2509149438
638 2513622813
639 2513625932
640 2513643972
641 2513644245
642 2513653284
643 2513658540
644 2513674536
645 2513695526
646 2513860122
647 2513920656
648 2514017515
649 2515630652
650 2517108262
651 2517888578
652 2524442648
653 2524463735
654 2524535109
655 2603858034
656 2617353379
657 2671119758
658 2723843922
659 2728753470
660 2745074983
661 2745082529
662 2793067398
663 2793082546
664 2805922015
665 2805922164
666 2824609414
667 2824626942
668 2824635388
669 2824644227
670 2824654691
671 2824662716
672 2824679684
673 2824704824
674 2824714899
675 2824724037
676 2824733434
677 2824754827
678 2824764577
679 2824779609
680 2838124948
681 2841965899
682 2841976696
683 2841986169
684 2847933502
685 2857527416
686 2874595063
687 2874612089
688 2874613734
689 2876767307
690 2876774581
691 2876823319
692 2879079150
693 2879088882
694 2879100798
695 2879114021
696 2881666803
697 2885372434
698 2885381797
699 2885383490
700 2888380689
701 2889041884
702 2903754581
703 2903769370
704 2904666786
705 2904692877
706 2904697130
707 2904708186
708 2904713039
709 2906614067
710 2906630897
711 2906637737
712 2906650744
713 2906668305
714 2908758297
715 2908762559
716 2922366266
717 2922386668
718 2922434554
719 2932793685
720 2932801101
721 2935613973
722 2935637592
723 2935646762
724 2935647710
725 2935652694
726 2935661321
727 2935674536
728 2935690671
729 2935712407
730 2935717633
731 2935727217
732 2935735987
733 2935744742
734 2935755680
735 2935781603
736 2935784751
737 2935836048
738 2935836405
739 2935854502
740 2935872857
741 2935882167
742 2935882816
743 2935889050
744 2935889578
745 2935967130
746 2935983318
747 2935991592
748 2936000025
749 2936015608
750 2936024242
751 2936033493
752 2936051351
753 2936062549
754 2940561039
755 2941514171
756 2941522132
757 2941529870
758 2941546435
759 3005483675
760 3005490715
761 8006936530
762 8006968037
763 8006976496
764 8006992219
765 8006999389
766 8016522482
767 8016527612
768 8016531252
769 8016532709
770 8016544179
771 8016545936
772 8016548871
773 8016556174
774 8016564542
775 8016566123
776 8016571014
777 8016575228
778 8016575634
779 8016583520
780 8016584176
781 8016584475
782 8016595297
783 8016602199
784 8016612877
785 8019530444
786 8019532523
787 8019562127
788 8019572193
789 8019585720
790 8019593659
791 8019597767
792 8019610618
793 8019621161
794 8019629378
795 8019648599
796 8019654318
797 8019655055
798 8019659493
799 8019668993
800 8019678438
801 8019678521
802 8056694898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06968

BATS

Biotin and Thiamin Synthesis associated domain

236

328

0.96

PF04055

Radical_SAM

Radical SAM superfamily

62

225

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r30-assembly1.cif.gz_A the crystal structure of biotin synthase, an s-adenosylmethionine-dependent radical enzyme 0.9467 19 327
1r30-assembly1.cif.gz_A the crystal structure of biotin synthase, an s-adenosylmethionine-dependent radical enzyme 0.9321 19 327
4wcx-assembly1.cif.gz_A crystal structure of hydg: a maturase of the [fefe]-hydrogenase 0.8379 22 326
4wcx-assembly2.cif.gz_C crystal structure of hydg: a maturase of the [fefe]-hydrogenase 0.8251 23 323
7o1p-assembly1.cif.gz_A [fefe]-hydrogenase maturase hyde from t. maritima (c-ter stretch absent) 0.8235 22 327
ID Description Score Start End Superfamily
af_O59778_20_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9449 19 327 3.20.20.70
af_A0A1D6M1W1_19_103_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9372 252 320 3.40.50.10800
af_O59778_20_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9219 19 327 3.20.20.70
af_Q2FVJ7_11_319_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8929 21 327 3.20.20.70
af_P9WPQ7_39_344_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8865 25 326 3.20.20.70
ID Description Score Start End GO Terms
AF-H0SDD9-F1-model_v4 Biotin synthase (EC 2.8.1.6) 0.955 15 330 GO:0004076
GO:0005506
GO:0009102
GO:0051537
GO:0051539
AF-A0A522ACY0-F1-model_v4 Biotin synthase (EC 2.8.1.6) 0.9546 19 327 GO:0004076
GO:0005506
GO:0009102
GO:0051537
GO:0051539
AF-A0A1D8UX94-F1-model_v4 Biotin synthase (EC 2.8.1.6) 0.9546 19 327 GO:0004076
GO:0005506
GO:0009102
GO:0051537
GO:0051539
AF-A0A2E5J7G7-F1-model_v4 Biotin synthase (EC 2.8.1.6) 0.9537 14 327 GO:0004076
GO:0005506
GO:0009102
GO:0051537
GO:0051539
AF-A0A7C7UDL9-F1-model_v4 biotin synthase (EC 2.8.1.6) 0.9536 112 328 GO:0004076
GO:0009102
GO:0046872
GO:0051537
GO:0051539

Map