F434777

General Info

Members Datasets Scaffolds Average Seq Length
401 188 802 140

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100067238|Ga0070706_1000672382
Length 154
Sequence MWKEFKEFAIKGNAIDLAVAVIVGAAFGSIVTSLVKDIIMPPIGLLAGGLDFSNKFIVLKAAKDGAAVFNTPADALKAGAVTWNYGNFITLVINFLIVAFCIFLVIRGINKMKRPAHAPPVTKDCPACAMTIPIKAKRCPHCTTELSGSVASAT

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.74
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 11.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100067238 3300005467 Bacteria 3314
2 JGI24035J26624_1005102 3300002126 Unclassified 1253
3 Ga0065712_10069732 3300005290 Bacteria 6789
4 Ga0065712_10193573 3300005290 Bacteria 1138
5 Ga0065712_10321915 3300005290 Bacteria 827
6 Ga0065715_10091353 3300005293 Bacteria 5851
7 Ga0065715_10169168 3300005293 Bacteria 1561
8 Ga0065707_10151004 3300005295 Bacteria 1658
9 Ga0070658_10217004 3300005327 Bacteria 1617
10 Ga0070676_10053172 3300005328 Bacteria 2384
11 Ga0070676_10112695 3300005328 Unclassified 1696
12 Ga0070676_10193478 3300005328 Bacteria 1329
13 Ga0070676_10330580 3300005328 Bacteria 1042
14 Ga0070683_100001630 3300005329 Bacteria 17370
15 Ga0070683_102222427 3300005329 Bacteria 527
16 Ga0070690_100027504 3300005330 Bacteria 3516
17 Ga0070690_100610317 3300005330 Bacteria 829
18 Ga0070690_100653354 3300005330 Bacteria 803
19 Ga0070690_101097090 3300005330 Bacteria 631
20 Ga0070670_100024912 3300005331 Bacteria 5148
21 Ga0070670_100108772 3300005331 Bacteria 2389
22 Ga0070670_100119327 3300005331 Bacteria 2275
23 Ga0070670_100124509 3300005331 Bacteria 2225
24 Ga0070677_10427421 3300005333 Bacteria 704
25 Ga0070666_10042236 3300005335 Bacteria 3050
26 Ga0070666_10084090 3300005335 Unclassified 2178
27 Ga0070666_10108722 3300005335 Bacteria 1916
28 Ga0070666_10146706 3300005335 Unclassified 1645
29 Ga0070666_10421168 3300005335 Bacteria 962
30 Ga0070680_100012787 3300005336 Bacteria 6529
31 Ga0070682_100094337 3300005337 Bacteria 1963
32 Ga0068868_100982694 3300005338 Bacteria 771
33 Ga0068868_102047858 3300005338 Bacteria 544
34 Ga0070689_100056069 3300005340 Bacteria 3055
35 Ga0070689_100612718 3300005340 Bacteria 944
36 Ga0070687_101337839 3300005343 Bacteria 533
37 Ga0070661_100163458 3300005344 Unclassified 1687
38 Ga0070668_100074344 3300005347 Bacteria 2651
39 Ga0070668_100157124 3300005347 Unclassified 1843
40 Ga0070668_100962041 3300005347 Bacteria 766
41 Ga0070669_100021682 3300005353 Bacteria 4591
42 Ga0070669_100366845 3300005353 Bacteria 1172
43 Ga0070675_100123284 3300005354 Bacteria 2203
44 Ga0070675_100228189 3300005354 Bacteria 1624
45 Ga0070675_100350490 3300005354 Bacteria 1309
46 Ga0070675_100932081 3300005354 Bacteria 796
47 Ga0070671_100016255 3300005355 Bacteria 6019
48 Ga0070671_100044216 3300005355 Bacteria 3701
49 Ga0070671_100226477 3300005355 Bacteria 1586
50 Ga0070671_101103925 3300005355 Bacteria 697
51 Ga0070674_100249899 3300005356 Unclassified 1392
52 Ga0070674_100308036 3300005356 Bacteria 1265
53 Ga0070673_100014214 3300005364 Bacteria 5534
54 Ga0070673_100034432 3300005364 Bacteria 3834
55 Ga0070673_100066067 3300005364 Bacteria 2888
56 Ga0070673_100346294 3300005364 Bacteria 1318
57 Ga0070673_100642768 3300005364 Bacteria 970
58 Ga0070688_100010820 3300005365 Bacteria 5046
59 Ga0070688_100014538 3300005365 Bacteria 4462
60 Ga0070659_100135668 3300005366 Bacteria 2001
61 Ga0070659_100596000 3300005366 Bacteria 949
62 Ga0070667_100131560 3300005367 Bacteria 2184
63 Ga0070667_100347917 3300005367 Bacteria 1341
64 Ga0070709_10072611 3300005434 Bacteria 2225
65 Ga0070709_10564861 3300005434 Bacteria 872
66 Ga0070709_10862556 3300005434 Bacteria 714
67 Ga0070714_100040749 3300005435 Bacteria 3916
68 Ga0070714_102268371 3300005435 Bacteria 528
69 Ga0070713_100041947 3300005436 Bacteria 3731
70 Ga0070713_100069002 3300005436 Bacteria 2980
71 Ga0070713_100424359 3300005436 Bacteria 1245
72 Ga0070710_10434299 3300005437 Bacteria 887
73 Ga0070711_100156628 3300005439 Bacteria 1723
74 Ga0070711_100305099 3300005439 Bacteria 1267
75 Ga0070711_101033987 3300005439 Bacteria 706
76 Ga0070694_100418837 3300005444 Bacteria 1052
77 Ga0070694_100919295 3300005444 Bacteria 723
78 Ga0070708_100032636 3300005445 Bacteria 4519
79 Ga0070708_100052773 3300005445 Bacteria 3606
80 Ga0070708_101455793 3300005445 Bacteria 639
81 Ga0070663_100339524 3300005455 Unclassified 1213
82 Ga0070663_101897868 3300005455 Bacteria 535
83 Ga0070678_100158917 3300005456 Bacteria 1829
84 Ga0070678_100314521 3300005456 Bacteria 1335
85 Ga0070678_101595366 3300005456 Bacteria 613
86 Ga0070662_100670472 3300005457 Bacteria 876
87 Ga0070662_100805052 3300005457 Bacteria 799
88 Ga0070681_10018996 3300005458 Bacteria 6879
89 Ga0068867_100025031 3300005459 Bacteria 4280
90 Ga0070685_10052235 3300005466 Bacteria 2365
91 Ga0070685_11100994 3300005466 Bacteria 600
92 Ga0070706_100152494 3300005467 Bacteria 2157
93 Ga0070706_100359855 3300005467 Bacteria 1356
94 Ga0070706_101470659 3300005467 Unclassified 623
95 Ga0070707_100012359 3300005468 Bacteria 7972
96 Ga0070707_100064702 3300005468 Bacteria 3511
97 Ga0070707_100110745 3300005468 Bacteria 2663
98 Ga0070707_100128981 3300005468 Bacteria 2458
99 Ga0070707_100172076 3300005468 Bacteria 2110
100 Ga0070707_100296807 3300005468 Bacteria 1570
101 Ga0070707_101875673 3300005468 Unclassified 567
102 Ga0070698_100010992 3300005471 Bacteria 9629
103 Ga0070698_100043777 3300005471 Archaea 4588
104 Ga0070698_101012266 3300005471 Bacteria 778
105 Ga0070699_100075789 3300005518 Bacteria 2928
106 Ga0070699_100378521 3300005518 Unclassified 1278
107 Ga0070699_100428698 3300005518 Unclassified 1198
108 Ga0070679_100013738 3300005530 Bacteria 7756
109 Ga0070684_100019454 3300005535 Bacteria 5617
110 Ga0070697_100002084 3300005536 Bacteria 15300
111 Ga0070697_100014735 3300005536 Bacteria 6139
112 Ga0070697_100028832 3300005536 Bacteria 4447
113 Ga0070697_100214716 3300005536 Unclassified 1639
114 Ga0070697_100429045 3300005536 Bacteria 1149
115 Ga0070672_100143610 3300005543 Bacteria 1971
116 Ga0070672_100147292 3300005543 Bacteria 1946
117 Ga0070672_100269582 3300005543 Bacteria 1437
118 Ga0070686_100995262 3300005544 Unclassified 687
119 Ga0070686_101151481 3300005544 Unclassified 642
120 Ga0070695_100009426 3300005545 Bacteria 5812
121 Ga0070695_100215668 3300005545 Bacteria 1380
122 Ga0070695_101223718 3300005545 Bacteria 618
123 Ga0070696_100655515 3300005546 Bacteria 851
124 Ga0070696_100861828 3300005546 Bacteria 749
125 Ga0070693_100717868 3300005547 Bacteria 733
126 Ga0070693_100872471 3300005547 Bacteria 672
127 Ga0070665_100016081 3300005548 Bacteria 7508
128 Ga0070665_100069510 3300005548 Bacteria 3529
129 Ga0070665_100180927 3300005548 Bacteria 2109
130 Ga0070665_100521361 3300005548 Bacteria 1200
131 Ga0070665_100978142 3300005548 Bacteria 859
132 Ga0070665_101153443 3300005548 Unclassified 786
133 Ga0070704_100370342 3300005549 Bacteria 1214
134 Ga0068855_100313157 3300005563 Bacteria 1736
135 Ga0070664_100032080 3300005564 Bacteria 4394
136 Ga0070664_100195078 3300005564 Bacteria 1805
137 Ga0070664_100224678 3300005564 Unclassified 1681
138 Ga0068857_100441034 3300005577 Bacteria 1216
139 Ga0068857_100752369 3300005577 Bacteria 928
140 Ga0068854_101212712 3300005578 Bacteria 676
141 Ga0068856_100004883 3300005614 Bacteria 13277
142 Ga0068856_100660308 3300005614 Bacteria 1066
143 Ga0068856_102130491 3300005614 Bacteria 570
144 Ga0068852_100297939 3300005616 Unclassified 1560
145 Ga0068859_100282035 3300005617 Bacteria 1754
146 Ga0068859_102073761 3300005617 Bacteria 628
147 Ga0068870_10309230 3300005840 Bacteria 1000
148 Ga0068863_100236567 3300005841 Unclassified 1763
149 Ga0068863_100289345 3300005841 Bacteria 1588
150 Ga0068863_100744273 3300005841 Bacteria 976
151 Ga0068858_100297848 3300005842 Bacteria 1538
152 Ga0068858_100681464 3300005842 Bacteria 1000
153 Ga0068858_101008580 3300005842 Bacteria 816
154 Ga0068858_101538743 3300005842 Bacteria 656
155 Ga0068858_101566153 3300005842 Bacteria 650
156 Ga0068860_100008907 3300005843 Bacteria 10001
157 Ga0068860_100314586 3300005843 Unclassified 1536
158 Ga0068860_100736064 3300005843 Bacteria 997
159 Ga0068862_100094705 3300005844 Bacteria 2605
160 Ga0081455_10003837 3300005937 Bacteria 17144
161 Ga0081455_10006748 3300005937 Bacteria 12253
162 Ga0081455_10059809 3300005937 Bacteria 3215
163 Ga0081539_10112875 3300005985 Bacteria 1364
164 Ga0081539_10189465 3300005985 Bacteria 958
165 Ga0070717_10005474 3300006028 Bacteria 9266
166 Ga0070716_100002804 3300006173 Bacteria 8114
167 Ga0070716_100079075 3300006173 Bacteria 1957
168 Ga0070716_100342851 3300006173 Bacteria 1055
169 Ga0070716_100343907 3300006173 Bacteria 1053
170 Ga0070712_100044857 3300006175 Bacteria 3050
171 Ga0070712_100131541 3300006175 Bacteria 1897
172 Ga0097621_100010066 3300006237 Bacteria 6897
173 Ga0097621_100063894 3300006237 Bacteria 3026
174 Ga0097621_100166989 3300006237 Unclassified 1895
175 Ga0097621_100240200 3300006237 Bacteria 1583
176 Ga0068871_100012815 3300006358 Bacteria 6205
177 Ga0068871_100013964 3300006358 Bacteria 5974
178 Ga0075433_10521553 3300006852 Bacteria 1045
179 Ga0075434_100122433 3300006871 Bacteria 2617
180 Ga0068865_100066983 3300006881 Bacteria 2535
181 Ga0068865_100506609 3300006881 Bacteria 1007
182 Ga0068865_100549800 3300006881 Bacteria 969
183 Ga0068865_100573693 3300006881 Bacteria 950
184 Ga0075436_100025600 3300006914 Bacteria 4061
185 Ga0075436_100045851 3300006914 Bacteria 3015
186 Ga0075436_100544335 3300006914 Bacteria 852
187 Ga0097620_100282046 3300006931 Bacteria 1754
188 Ga0099794_10016178 3300007265 Unclassified 3304
189 Ga0099794_10022067 3300007265 Bacteria 2899
190 Ga0099795_10110024 3300007788 Bacteria 1091
191 Ga0099795_10223291 3300007788 Bacteria 803
192 Ga0105240_10338678 3300009093 Bacteria 1709
193 Ga0105245_10474931 3300009098 Bacteria 1263
194 Ga0105245_11929784 3300009098 Unclassified 644
195 Ga0105241_10121890 3300009174 Bacteria 2101
196 Ga0105242_10021731 3300009176 Bacteria 5041
197 Ga0105242_10034376 3300009176 Bacteria 4063
198 Ga0105242_10088729 3300009176 Bacteria 2598
199 Ga0105248_10248141 3300009177 Bacteria 2004
200 Ga0105237_10073577 3300009545 Bacteria 3409
201 Ga0105237_10209292 3300009545 Bacteria 1950
202 Ga0105239_10446687 3300010375 Bacteria 1467
203 Ga0157374_10037544 3300013296 Bacteria 4447
204 Ga0157374_10259135 3300013296 Bacteria 1713
205 Ga0157374_10387237 3300013296 Bacteria 1393
206 Ga0157378_10000998 3300013297 Bacteria 25932
207 Ga0157378_10008640 3300013297 Bacteria 8864
208 Ga0157378_10036007 3300013297 Bacteria 4380
209 Ga0157378_10037179 3300013297 Bacteria 4311
210 Ga0157378_10223548 3300013297 Unclassified 1791
211 Ga0163162_10033102 3300013306 Bacteria 5134
212 Ga0163162_10123367 3300013306 Bacteria 2696
213 Ga0163162_10170825 3300013306 Bacteria 2299
214 Ga0163162_10870841 3300013306 Bacteria 1015
215 Ga0157372_10018935 3300013307 Bacteria 7409
216 Ga0157372_10048660 3300013307 Bacteria 4712
217 Ga0157375_10012510 3300013308 Bacteria 7532
218 Ga0157375_10057954 3300013308 Bacteria 3830
219 Ga0157375_10184881 3300013308 Unclassified 2237
220 Ga0157375_10315522 3300013308 Bacteria 1728
221 Ga0163163_10120751 3300014325 Bacteria 2655
222 Ga0163163_11438535 3300014325 Bacteria 751
223 Ga0157379_10051315 3300014968 Bacteria 3684
224 Ga0157379_10667701 3300014968 Bacteria 974
225 Ga0157376_10000041 3300014969 Bacteria 120988
226 Ga0157376_10016858 3300014969 Bacteria 5557
227 Ga0157376_10426940 3300014969 Bacteria 1287
228 Ga0163161_10216295 3300017792 Unclassified 1482
229 Ga0213876_10040180 3300021384 Bacteria 2471
230 Ga0213876_10178861 3300021384 Bacteria 1128
231 Ga0207673_1011931 3300025290 Unclassified 1128
232 Ga0207697_10002777 3300025315 Bacteria 8932
233 Ga0207697_10003168 3300025315 Bacteria 8194
234 Ga0207697_10078372 3300025315 Unclassified 1390
235 Ga0207692_10973792 3300025898 Bacteria 559
236 Ga0207688_10025069 3300025901 Bacteria 3273
237 Ga0207680_10088119 3300025903 Bacteria 1967
238 Ga0207680_10093073 3300025903 Bacteria 1922
239 Ga0207680_10139318 3300025903 Bacteria 1607
240 Ga0207680_10346245 3300025903 Bacteria 1043
241 Ga0207645_10022931 3300025907 Bacteria 4056
242 Ga0207645_10119381 3300025907 Unclassified 1711
243 Ga0207645_10132113 3300025907 Bacteria 1625
244 Ga0207645_10251544 3300025907 Unclassified 1169
245 Ga0207705_10157879 3300025909 Unclassified 1702
246 Ga0207684_10027654 3300025910 Bacteria 4830
247 Ga0207684_10133209 3300025910 Bacteria 2133
248 Ga0207684_10284620 3300025910 Unclassified 1426
249 Ga0207684_10753554 3300025910 Bacteria 825
250 Ga0207707_10038303 3300025912 Bacteria 4190
251 Ga0207671_10178204 3300025914 Bacteria 1653
252 Ga0207671_10423306 3300025914 Bacteria 1059
253 Ga0207693_10053399 3300025915 Bacteria 3170
254 Ga0207693_10143417 3300025915 Bacteria 1878
255 Ga0207693_10428300 3300025915 Bacteria 1034
256 Ga0207663_11526282 3300025916 Bacteria 538
257 Ga0207660_10067387 3300025917 Bacteria 2592
258 Ga0207649_10025779 3300025920 Bacteria 3432
259 Ga0207649_10115636 3300025920 Unclassified 1800
260 Ga0207652_10024380 3300025921 Bacteria 5019
261 Ga0207646_10000889 3300025922 Bacteria 38530
262 Ga0207646_10008904 3300025922 Bacteria 9998
263 Ga0207646_10083706 3300025922 Bacteria 2853
264 Ga0207646_10180979 3300025922 Bacteria 1904
265 Ga0207646_10439998 3300025922 Bacteria 1176
266 Ga0207646_10621189 3300025922 Bacteria 969
267 Ga0207681_10115681 3300025923 Unclassified 1958
268 Ga0207681_10478313 3300025923 Bacteria 1017
269 Ga0207681_10600706 3300025923 Bacteria 909
270 Ga0207650_10059255 3300025925 Bacteria 2853
271 Ga0207650_10270291 3300025925 Bacteria 1381
272 Ga0207650_10815896 3300025925 Bacteria 791
273 Ga0207650_10879633 3300025925 Unclassified 760
274 Ga0207659_10063566 3300025926 Bacteria 2668
275 Ga0207659_10075009 3300025926 Bacteria 2481
276 Ga0207659_10342903 3300025926 Bacteria 1238
277 Ga0207659_10512684 3300025926 Bacteria 1016
278 Ga0207687_10440881 3300025927 Bacteria 1078
279 Ga0207700_10052186 3300025928 Bacteria 3056
280 Ga0207700_10886290 3300025928 Bacteria 798
281 Ga0207664_10040893 3300025929 Bacteria 3609
282 Ga0207644_10023457 3300025931 Bacteria 4226
283 Ga0207644_10082900 3300025931 Bacteria 2373
284 Ga0207644_10169068 3300025931 Bacteria 1705
285 Ga0207644_10993457 3300025931 Bacteria 704
286 Ga0207690_10195179 3300025932 Bacteria 1534
287 Ga0207706_10798607 3300025933 Bacteria 802
288 Ga0207686_10010568 3300025934 Bacteria 5030
289 Ga0207686_10054660 3300025934 Bacteria 2502
290 Ga0207670_10158471 3300025936 Unclassified 1687
291 Ga0207670_10297919 3300025936 Bacteria 1262
292 Ga0207669_10134601 3300025937 Unclassified 1704
293 Ga0207704_10104992 3300025938 Bacteria 1894
294 Ga0207704_10962705 3300025938 Bacteria 720
295 Ga0207704_11895189 3300025938 Bacteria 513
296 Ga0207665_10006003 3300025939 Bacteria 8069
297 Ga0207665_10093345 3300025939 Bacteria 2089
298 Ga0207665_10099905 3300025939 Bacteria 2024
299 Ga0207665_10240656 3300025939 Bacteria 1333
300 Ga0207691_10146855 3300025940 Bacteria 2076
301 Ga0207691_10263171 3300025940 Unclassified 1486
302 Ga0207691_10273998 3300025940 Bacteria 1453
303 Ga0207691_10564000 3300025940 Unclassified 965
304 Ga0207711_10862593 3300025941 Bacteria 842
305 Ga0207679_10043215 3300025945 Bacteria 3244
306 Ga0207679_10126569 3300025945 Bacteria 2042
307 Ga0207679_10173820 3300025945 Bacteria 1776
308 Ga0207667_10281926 3300025949 Bacteria 1698
309 Ga0207651_10052773 3300025960 Bacteria 2774
310 Ga0207651_10137210 3300025960 Bacteria 1883
311 Ga0207651_10151171 3300025960 Unclassified 1807
312 Ga0207651_10352388 3300025960 Bacteria 1240
313 Ga0207651_10590208 3300025960 Bacteria 970
314 Ga0207668_10068780 3300025972 Bacteria 2519
315 Ga0207668_10150522 3300025972 Bacteria 1801
316 Ga0207668_10732618 3300025972 Bacteria 871
317 Ga0207658_10022825 3300025986 Bacteria 4359
318 Ga0207658_10109888 3300025986 Bacteria 2177
319 Ga0207658_10182942 3300025986 Bacteria 1736
320 Ga0207658_11311758 3300025986 Bacteria 662
321 Ga0207677_10039394 3300026023 Bacteria 3107
322 Ga0207677_11056933 3300026023 Bacteria 738
323 Ga0207703_10211237 3300026035 Bacteria 1730
324 Ga0207703_10440083 3300026035 Bacteria 1216
325 Ga0207703_10622089 3300026035 Bacteria 1022
326 Ga0207703_10781049 3300026035 Bacteria 911
327 Ga0207702_10149695 3300026078 Bacteria 2122
328 Ga0207702_11670629 3300026078 Bacteria 630
329 Ga0207641_10264406 3300026088 Bacteria 1612
330 Ga0207648_10042894 3300026089 Bacteria 3972
331 Ga0207683_10034483 3300026121 Bacteria 4398
332 Ga0207683_10348771 3300026121 Bacteria 1358
333 Ga0207683_11110310 3300026121 Bacteria 734
334 Ga0207683_11257067 3300026121 Bacteria 686
335 Ga0209179_1094336 3300027512 Bacteria 665
336 Ga0209588_1004561 3300027671 Bacteria 3915
337 Ga0207428_10780967 3300027907 Bacteria 679
338 Ga0268266_10012621 3300028379 Bacteria 7299
339 Ga0268266_10148372 3300028379 Bacteria 2111
340 Ga0268265_10380789 3300028380 Unclassified 1298
341 Ga0268264_10006298 3300028381 Bacteria 10007
342 Ga0268264_10068610 3300028381 Bacteria 2997
343 Ga0307511_10174101 3300030521 Bacteria 1175
344 Ga0316575_10007462 3300031665 Bacteria 3962
345 Ga0373946_0203148 3300035171 Bacteria 950
346 Ga0373931_0187245 3300035691 Bacteria 1229
347 Ga0373931_0446448 3300035691 Bacteria 826
348 Ga0373947_0057665 3300035725 Unclassified 2351
349 Ga0373937_1569167 3300036401 Unclassified 606
350 Ga0373925_0071997 3300037068 Bacteria 2615
351 Ga0373925_0282035 3300037068 Bacteria 1338
352 Ga0395900_0114340 3300037418 Bacteria 2770
353 Ga0436365_0188983 3300039437 Bacteria 2434
354 Ga0436365_0736173 3300039437 Bacteria 2623
355 Ga0436365_1029873 3300039437 Bacteria 4757
356 Ga0436363_1130223 3300039450 Bacteria 2367
357 Ga0451802_0259790 3300041460 Bacteria 729
358 Ga0451853_2489209 3300041512 Bacteria 738
359 Ga0451577_0917522 3300042876 Unclassified 788
360 Ga0451576_1164666 3300045051 Bacteria 806
361 Ga0495641_0021144 3300046461 Bacteria 3281
362 Ga0495580_0000867 3300046472 Bacteria 26092
363 Ga0495582_0002374 3300046473 Bacteria 10535
364 Ga0495662_0581635 3300046476 Bacteria 548
365 Ga0495664_0207131 3300046477 Bacteria 1188
366 Ga0495628_0036718 3300046516 Bacteria 3931
367 Ga0495630_1057700 3300046517 Bacteria 616
368 Ga0495645_0017320 3300046543 Bacteria 5161
369 Ga0495622_0305630 3300046557 Bacteria 693
370 Ga0495647_0193697 3300046681 Unclassified 889
371 Ga0495658_0069629 3300046683 Bacteria 2039
372 Ga0495669_0471043 3300046684 Bacteria 610
373 Ga0495684_0064952 3300047471 Bacteria 2774
374 Ga0496101_0837326 3300048904 Unclassified 725
375 Ga0496102_0003751 3300048905 Bacteria 12846
376 Ga0496102_0129476 3300048905 Bacteria 2361
377 Ga0496102_0580068 3300048905 Bacteria 1044
378 Ga0496104_0122385 3300048907 Bacteria 2498
379 Ga0496104_0363679 3300048907 Bacteria 1359
380 Ga0496105_0120752 3300048908 Bacteria 2161
381 Ga0496107_0312708 3300048910 Bacteria 1169
382 Ga0496107_0566387 3300048910 Bacteria 841
383 Ga0496108_0120393 3300048911 Bacteria 2251
384 Ga0496108_0549217 3300048911 Bacteria 1008
385 Ga0496112_0016662 3300048915 Bacteria 6891
386 Ga0496112_1153289 3300048915 Bacteria 692
387 Ga0496113_0183578 3300048916 Bacteria 1659
388 Ga0496114_0010811 3300048917 Bacteria 7265
389 Ga0496114_0027271 3300048917 Bacteria 4677
390 Ga0496115_0004303 3300048918 Bacteria 10307
391 Ga0496115_0035544 3300048918 Bacteria 3942
392 Ga0496126_1046244 3300048929 Bacteria 610
393 nmdc:mga08y16_771512_c1 3300050511 Unclassified 956
394 nmdc:mga0n895_1357683_c1 3300050512 Bacteria 680
395 nmdc:mga0n895_1835511_c1 3300050512 Bacteria 566
396 nmdc:mga0n895_467361_c1 3300050512 Bacteria 1273
397 nmdc:mga0rr50_565913_c1 3300050513 Bacteria 968
398 nmdc:mga0rr50_929685_c1 3300050513 Bacteria 741
399 nmdc:mga08x19_28409_c1 3300050514 Bacteria 3503
400 nmdc:mga08x19_880211_c1 3300050514 Bacteria 636
401 nmdc:mga0a205_529215_c1 3300050515 Bacteria 1035
402 Ga0070706_100067238
403 JGI24035J26624_1005102
404 Ga0065712_10069732
405 Ga0065712_10193573
406 Ga0065712_10321915
407 Ga0065715_10091353
408 Ga0065715_10169168
409 Ga0065707_10151004
410 Ga0070658_10217004
411 Ga0070676_10053172
412 Ga0070676_10112695
413 Ga0070676_10193478
414 Ga0070676_10330580
415 Ga0070683_100001630
416 Ga0070683_102222427
417 Ga0070690_100027504
418 Ga0070690_100610317
419 Ga0070690_100653354
420 Ga0070690_101097090
421 Ga0070670_100024912
422 Ga0070670_100108772
423 Ga0070670_100119327
424 Ga0070670_100124509
425 Ga0070677_10427421
426 Ga0070666_10042236
427 Ga0070666_10084090
428 Ga0070666_10108722
429 Ga0070666_10146706
430 Ga0070666_10421168
431 Ga0070680_100012787
432 Ga0070682_100094337
433 Ga0068868_100982694
434 Ga0068868_102047858
435 Ga0070689_100056069
436 Ga0070689_100612718
437 Ga0070687_101337839
438 Ga0070661_100163458
439 Ga0070668_100074344
440 Ga0070668_100157124
441 Ga0070668_100962041
442 Ga0070669_100021682
443 Ga0070669_100366845
444 Ga0070675_100123284
445 Ga0070675_100228189
446 Ga0070675_100350490
447 Ga0070675_100932081
448 Ga0070671_100016255
449 Ga0070671_100044216
450 Ga0070671_100226477
451 Ga0070671_101103925
452 Ga0070674_100249899
453 Ga0070674_100308036
454 Ga0070673_100014214
455 Ga0070673_100034432
456 Ga0070673_100066067
457 Ga0070673_100346294
458 Ga0070673_100642768
459 Ga0070688_100010820
460 Ga0070688_100014538
461 Ga0070659_100135668
462 Ga0070659_100596000
463 Ga0070667_100131560
464 Ga0070667_100347917
465 Ga0070709_10072611
466 Ga0070709_10564861
467 Ga0070709_10862556
468 Ga0070714_100040749
469 Ga0070714_102268371
470 Ga0070713_100041947
471 Ga0070713_100069002
472 Ga0070713_100424359
473 Ga0070710_10434299
474 Ga0070711_100156628
475 Ga0070711_100305099
476 Ga0070711_101033987
477 Ga0070694_100418837
478 Ga0070694_100919295
479 Ga0070708_100032636
480 Ga0070708_100052773
481 Ga0070708_101455793
482 Ga0070663_100339524
483 Ga0070663_101897868
484 Ga0070678_100158917
485 Ga0070678_100314521
486 Ga0070678_101595366
487 Ga0070662_100670472
488 Ga0070662_100805052
489 Ga0070681_10018996
490 Ga0068867_100025031
491 Ga0070685_10052235
492 Ga0070685_11100994
493 Ga0070706_100152494
494 Ga0070706_100359855
495 Ga0070706_101470659
496 Ga0070707_100012359
497 Ga0070707_100064702
498 Ga0070707_100110745
499 Ga0070707_100128981
500 Ga0070707_100172076
501 Ga0070707_100296807
502 Ga0070707_101875673
503 Ga0070698_100010992
504 Ga0070698_100043777
505 Ga0070698_101012266
506 Ga0070699_100075789
507 Ga0070699_100378521
508 Ga0070699_100428698
509 Ga0070679_100013738
510 Ga0070684_100019454
511 Ga0070697_100002084
512 Ga0070697_100014735
513 Ga0070697_100028832
514 Ga0070697_100214716
515 Ga0070697_100429045
516 Ga0070672_100143610
517 Ga0070672_100147292
518 Ga0070672_100269582
519 Ga0070686_100995262
520 Ga0070686_101151481
521 Ga0070695_100009426
522 Ga0070695_100215668
523 Ga0070695_101223718
524 Ga0070696_100655515
525 Ga0070696_100861828
526 Ga0070693_100717868
527 Ga0070693_100872471
528 Ga0070665_100016081
529 Ga0070665_100069510
530 Ga0070665_100180927
531 Ga0070665_100521361
532 Ga0070665_100978142
533 Ga0070665_101153443
534 Ga0070704_100370342
535 Ga0068855_100313157
536 Ga0070664_100032080
537 Ga0070664_100195078
538 Ga0070664_100224678
539 Ga0068857_100441034
540 Ga0068857_100752369
541 Ga0068854_101212712
542 Ga0068856_100004883
543 Ga0068856_100660308
544 Ga0068856_102130491
545 Ga0068852_100297939
546 Ga0068859_100282035
547 Ga0068859_102073761
548 Ga0068870_10309230
549 Ga0068863_100236567
550 Ga0068863_100289345
551 Ga0068863_100744273
552 Ga0068858_100297848
553 Ga0068858_100681464
554 Ga0068858_101008580
555 Ga0068858_101538743
556 Ga0068858_101566153
557 Ga0068860_100008907
558 Ga0068860_100314586
559 Ga0068860_100736064
560 Ga0068862_100094705
561 Ga0081455_10003837
562 Ga0081455_10006748
563 Ga0081455_10059809
564 Ga0081539_10112875
565 Ga0081539_10189465
566 Ga0070717_10005474
567 Ga0070716_100002804
568 Ga0070716_100079075
569 Ga0070716_100342851
570 Ga0070716_100343907
571 Ga0070712_100044857
572 Ga0070712_100131541
573 Ga0097621_100010066
574 Ga0097621_100063894
575 Ga0097621_100166989
576 Ga0097621_100240200
577 Ga0068871_100012815
578 Ga0068871_100013964
579 Ga0075433_10521553
580 Ga0075434_100122433
581 Ga0068865_100066983
582 Ga0068865_100506609
583 Ga0068865_100549800
584 Ga0068865_100573693
585 Ga0075436_100025600
586 Ga0075436_100045851
587 Ga0075436_100544335
588 Ga0097620_100282046
589 Ga0099794_10016178
590 Ga0099794_10022067
591 Ga0099795_10110024
592 Ga0099795_10223291
593 Ga0105240_10338678
594 Ga0105245_10474931
595 Ga0105245_11929784
596 Ga0105241_10121890
597 Ga0105242_10021731
598 Ga0105242_10034376
599 Ga0105242_10088729
600 Ga0105248_10248141
601 Ga0105237_10073577
602 Ga0105237_10209292
603 Ga0105239_10446687
604 Ga0157374_10037544
605 Ga0157374_10259135
606 Ga0157374_10387237
607 Ga0157378_10000998
608 Ga0157378_10008640
609 Ga0157378_10036007
610 Ga0157378_10037179
611 Ga0157378_10223548
612 Ga0163162_10033102
613 Ga0163162_10123367
614 Ga0163162_10170825
615 Ga0163162_10870841
616 Ga0157372_10018935
617 Ga0157372_10048660
618 Ga0157375_10012510
619 Ga0157375_10057954
620 Ga0157375_10184881
621 Ga0157375_10315522
622 Ga0163163_10120751
623 Ga0163163_11438535
624 Ga0157379_10051315
625 Ga0157379_10667701
626 Ga0157376_10000041
627 Ga0157376_10016858
628 Ga0157376_10426940
629 Ga0163161_10216295
630 Ga0213876_10040180
631 Ga0213876_10178861
632 Ga0207673_1011931
633 Ga0207697_10002777
634 Ga0207697_10003168
635 Ga0207697_10078372
636 Ga0207692_10973792
637 Ga0207688_10025069
638 Ga0207680_10088119
639 Ga0207680_10093073
640 Ga0207680_10139318
641 Ga0207680_10346245
642 Ga0207645_10022931
643 Ga0207645_10119381
644 Ga0207645_10132113
645 Ga0207645_10251544
646 Ga0207705_10157879
647 Ga0207684_10027654
648 Ga0207684_10133209
649 Ga0207684_10284620
650 Ga0207684_10753554
651 Ga0207707_10038303
652 Ga0207671_10178204
653 Ga0207671_10423306
654 Ga0207693_10053399
655 Ga0207693_10143417
656 Ga0207693_10428300
657 Ga0207663_11526282
658 Ga0207660_10067387
659 Ga0207649_10025779
660 Ga0207649_10115636
661 Ga0207652_10024380
662 Ga0207646_10000889
663 Ga0207646_10008904
664 Ga0207646_10083706
665 Ga0207646_10180979
666 Ga0207646_10439998
667 Ga0207646_10621189
668 Ga0207681_10115681
669 Ga0207681_10478313
670 Ga0207681_10600706
671 Ga0207650_10059255
672 Ga0207650_10270291
673 Ga0207650_10815896
674 Ga0207650_10879633
675 Ga0207659_10063566
676 Ga0207659_10075009
677 Ga0207659_10342903
678 Ga0207659_10512684
679 Ga0207687_10440881
680 Ga0207700_10052186
681 Ga0207700_10886290
682 Ga0207664_10040893
683 Ga0207644_10023457
684 Ga0207644_10082900
685 Ga0207644_10169068
686 Ga0207644_10993457
687 Ga0207690_10195179
688 Ga0207706_10798607
689 Ga0207686_10010568
690 Ga0207686_10054660
691 Ga0207670_10158471
692 Ga0207670_10297919
693 Ga0207669_10134601
694 Ga0207704_10104992
695 Ga0207704_10962705
696 Ga0207704_11895189
697 Ga0207665_10006003
698 Ga0207665_10093345
699 Ga0207665_10099905
700 Ga0207665_10240656
701 Ga0207691_10146855
702 Ga0207691_10263171
703 Ga0207691_10273998
704 Ga0207691_10564000
705 Ga0207711_10862593
706 Ga0207679_10043215
707 Ga0207679_10126569
708 Ga0207679_10173820
709 Ga0207667_10281926
710 Ga0207651_10052773
711 Ga0207651_10137210
712 Ga0207651_10151171
713 Ga0207651_10352388
714 Ga0207651_10590208
715 Ga0207668_10068780
716 Ga0207668_10150522
717 Ga0207668_10732618
718 Ga0207658_10022825
719 Ga0207658_10109888
720 Ga0207658_10182942
721 Ga0207658_11311758
722 Ga0207677_10039394
723 Ga0207677_11056933
724 Ga0207703_10211237
725 Ga0207703_10440083
726 Ga0207703_10622089
727 Ga0207703_10781049
728 Ga0207702_10149695
729 Ga0207702_11670629
730 Ga0207641_10264406
731 Ga0207648_10042894
732 Ga0207683_10034483
733 Ga0207683_10348771
734 Ga0207683_11110310
735 Ga0207683_11257067
736 Ga0209179_1094336
737 Ga0209588_1004561
738 Ga0207428_10780967
739 Ga0268266_10012621
740 Ga0268266_10148372
741 Ga0268265_10380789
742 Ga0268264_10006298
743 Ga0268264_10068610
744 Ga0307511_10174101
745 Ga0316575_10007462
746 Ga0373946_0203148
747 Ga0373931_0187245
748 Ga0373931_0446448
749 Ga0373947_0057665
750 Ga0373937_1569167
751 Ga0373925_0071997
752 Ga0373925_0282035
753 Ga0395900_0114340
754 Ga0436365_0188983
755 Ga0436365_0736173
756 Ga0436365_1029873
757 Ga0436363_1130223
758 Ga0451802_0259790
759 Ga0451853_2489209
760 Ga0451577_0917522
761 Ga0451576_1164666
762 Ga0495641_0021144
763 Ga0495580_0000867
764 Ga0495582_0002374
765 Ga0495662_0581635
766 Ga0495664_0207131
767 Ga0495628_0036718
768 Ga0495630_1057700
769 Ga0495645_0017320
770 Ga0495622_0305630
771 Ga0495647_0193697
772 Ga0495658_0069629
773 Ga0495669_0471043
774 Ga0495684_0064952
775 Ga0496101_0837326
776 Ga0496102_0003751
777 Ga0496102_0129476
778 Ga0496102_0580068
779 Ga0496104_0122385
780 Ga0496104_0363679
781 Ga0496105_0120752
782 Ga0496107_0312708
783 Ga0496107_0566387
784 Ga0496108_0120393
785 Ga0496108_0549217
786 Ga0496112_0016662
787 Ga0496112_1153289
788 Ga0496113_0183578
789 Ga0496114_0010811
790 Ga0496114_0027271
791 Ga0496115_0004303
792 Ga0496115_0035544
793 Ga0496126_1046244
794 nmdc:mga08y16_771512_c1
795 nmdc:mga0n895_1357683_c1
796 nmdc:mga0n895_1835511_c1
797 nmdc:mga0n895_467361_c1
798 nmdc:mga0rr50_565913_c1
799 nmdc:mga0rr50_929685_c1
800 nmdc:mga08x19_28409_c1
801 nmdc:mga08x19_880211_c1
802 nmdc:mga0a205_529215_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

1

137

0.9

Map