F434670
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 400 | 292 | 397 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300047471|Ga0495684_0048138|Ga0495684_0048138_465_1436 |
| Length | 323 |
| Sequence | MSSQSTGTPAQAEPSSGVELVLLPRAHDLGGFEVRRALPAKERQMIGPFIFFDQMGPGEFLAGRGLDVRPHPHIGLSTVTYLFDGEIMHRDSLGSHQSIVPGDVNWMTAGRGIAHSERTDQTLRANRNRLFGIQSWVALPKMAEETAPGFVHHPAASLPLVEDAGVRLRLIAGTGWGLTAPVTIASSLFYADALLAPDAVLQMPDGHEERAAYVVAGEVDVAGDRFEPGRMLIFRPKDHPVLRSGPQGARVLLLGGAVMDGPRYLFWNFVSSSRERIEQAKADWKAGRFAKVPDDDVEFIPLPEERAPAQADGQQVSKGSPTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 157 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 291 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0 |
| Isolates | 0.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.25 |
| Nodule | 0 |
| Rhizoplane | 3.75 |
| Rhizosphere | 86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000990 | 3300001977 | Bacteria | 4463 |
| 2 | JGI24737J22298_10016345 | 3300001990 | Bacteria | 2396 |
| 3 | JGI24750J21931_1001457 | 3300002070 | Bacteria | 2947 |
| 4 | JGI24738J21930_10018916 | 3300002075 | Bacteria | 1439 |
| 5 | JGI24744J21845_10000413 | 3300002077 | Bacteria | 7434 |
| 6 | JGI24742J22300_10000805 | 3300002244 | Bacteria | 4775 |
| 7 | JGI24751J29686_10020193 | 3300002459 | Bacteria | 1379 |
| 8 | JGI25406J46586_10000621 | 3300003203 | Bacteria | 16616 |
| 9 | JGI25405J52794_10007240 | 3300003911 | Bacteria | 2044 |
| 10 | Ga0070683_100102104 | 3300005329 | Bacteria | 2701 |
| 11 | Ga0070690_100068791 | 3300005330 | Bacteria | 2297 |
| 12 | Ga0068869_100040563 | 3300005334 | Bacteria | 3329 |
| 13 | Ga0070666_10018911 | 3300005335 | Bacteria | 4439 |
| 14 | Ga0070682_100025802 | 3300005337 | Bacteria | 3510 |
| 15 | Ga0068868_100039788 | 3300005338 | Bacteria | 3655 |
| 16 | Ga0070660_100027790 | 3300005339 | Bacteria | 4226 |
| 17 | Ga0070668_100097567 | 3300005347 | Bacteria | 2324 |
| 18 | Ga0070669_100051774 | 3300005353 | Bacteria | 3002 |
| 19 | Ga0070669_100096477 | 3300005353 | Bacteria | 2224 |
| 20 | Ga0070675_100037573 | 3300005354 | Bacteria | 3945 |
| 21 | Ga0070671_100018449 | 3300005355 | Bacteria | 5667 |
| 22 | Ga0070674_100095112 | 3300005356 | Bacteria | 2159 |
| 23 | Ga0070673_100030123 | 3300005364 | Bacteria | 4055 |
| 24 | Ga0070667_100144323 | 3300005367 | Bacteria | 2087 |
| 25 | Ga0070667_100282563 | 3300005367 | Bacteria | 1490 |
| 26 | Ga0070713_100238033 | 3300005436 | Bacteria | 1657 |
| 27 | Ga0070710_10047429 | 3300005437 | Bacteria | 2396 |
| 28 | Ga0070705_100034600 | 3300005440 | Bacteria | 2825 |
| 29 | Ga0070678_100030353 | 3300005456 | Bacteria | 3715 |
| 30 | Ga0070678_100163596 | 3300005456 | Bacteria | 1805 |
| 31 | Ga0070662_100006202 | 3300005457 | Bacteria | 7699 |
| 32 | Ga0070681_10036297 | 3300005458 | Bacteria | 4949 |
| 33 | Ga0068867_100025735 | 3300005459 | Bacteria | 4223 |
| 34 | Ga0068867_100393628 | 3300005459 | Bacteria | 1167 |
| 35 | Ga0070698_100106717 | 3300005471 | Bacteria | 2769 |
| 36 | Ga0070699_100001443 | 3300005518 | Bacteria | 21833 |
| 37 | Ga0070679_100091736 | 3300005530 | Bacteria | 3025 |
| 38 | Ga0070697_100141268 | 3300005536 | Bacteria | 2025 |
| 39 | Ga0068853_100157808 | 3300005539 | Bacteria | 2045 |
| 40 | Ga0070672_100040448 | 3300005543 | Bacteria | 3577 |
| 41 | Ga0070672_100177736 | 3300005543 | Bacteria | 1772 |
| 42 | Ga0070665_100195512 | 3300005548 | Bacteria | 2023 |
| 43 | Ga0070704_100180804 | 3300005549 | Bacteria | 1686 |
| 44 | Ga0070664_100095944 | 3300005564 | Bacteria | 2573 |
| 45 | Ga0068857_100134794 | 3300005577 | Bacteria | 2229 |
| 46 | Ga0068856_100050165 | 3300005614 | Bacteria | 4114 |
| 47 | Ga0070702_100011224 | 3300005615 | Bacteria | 4449 |
| 48 | Ga0070702_100177455 | 3300005615 | Bacteria | 1391 |
| 49 | Ga0068859_100006960 | 3300005617 | Bacteria | 11481 |
| 50 | Ga0068859_100247567 | 3300005617 | Bacteria | 1872 |
| 51 | Ga0068864_100035728 | 3300005618 | Bacteria | 4232 |
| 52 | Ga0068864_100062494 | 3300005618 | Bacteria | 3226 |
| 53 | Ga0068866_10020641 | 3300005718 | Bacteria | 3021 |
| 54 | Ga0068870_10006575 | 3300005840 | Bacteria | 5133 |
| 55 | Ga0068858_100023619 | 3300005842 | Bacteria | 5728 |
| 56 | Ga0068860_100029725 | 3300005843 | Bacteria | 5257 |
| 57 | Ga0068862_100077460 | 3300005844 | Bacteria | 2879 |
| 58 | Ga0068862_100254988 | 3300005844 | Bacteria | 1600 |
| 59 | Ga0081455_10000009 | 3300005937 | Bacteria | 249885 |
| 60 | Ga0081455_10008013 | 3300005937 | Bacteria | 11038 |
| 61 | Ga0081455_10080273 | 3300005937 | Bacteria | 2675 |
| 62 | Ga0081455_10110096 | 3300005937 | Bacteria | 2190 |
| 63 | Ga0081538_10007153 | 3300005981 | Bacteria | 9690 |
| 64 | Ga0081540_1007786 | 3300005983 | Bacteria | 7582 |
| 65 | Ga0081539_10000932 | 3300005985 | Bacteria | 54871 |
| 66 | Ga0081539_10110185 | 3300005985 | Bacteria | 1387 |
| 67 | Ga0070717_10011936 | 3300006028 | Bacteria | 6610 |
| 68 | Ga0075363_100015293 | 3300006048 | Bacteria | 3770 |
| 69 | Ga0075363_100045654 | 3300006048 | Bacteria | 2324 |
| 70 | Ga0075363_100049548 | 3300006048 | Bacteria | 2237 |
| 71 | Ga0075364_10013177 | 3300006051 | Bacteria | 5075 |
| 72 | Ga0075364_10055758 | 3300006051 | Bacteria | 2586 |
| 73 | Ga0075432_10003653 | 3300006058 | Bacteria | 5238 |
| 74 | Ga0070716_100051506 | 3300006173 | Bacteria | 2340 |
| 75 | Ga0070712_100009461 | 3300006175 | Bacteria | 6140 |
| 76 | Ga0075362_10013026 | 3300006177 | Bacteria | 3318 |
| 77 | Ga0075367_10074785 | 3300006178 | Bacteria | 2043 |
| 78 | Ga0075367_10099521 | 3300006178 | Bacteria | 1776 |
| 79 | Ga0075366_10007706 | 3300006195 | Bacteria | 5963 |
| 80 | Ga0075366_10185565 | 3300006195 | Bacteria | 1264 |
| 81 | Ga0097621_100058727 | 3300006237 | Bacteria | 3148 |
| 82 | Ga0075428_100003428 | 3300006844 | Bacteria | 17351 |
| 83 | Ga0075430_100000944 | 3300006846 | Bacteria | 22830 |
| 84 | Ga0075431_100001444 | 3300006847 | Bacteria | 21893 |
| 85 | Ga0075433_10003897 | 3300006852 | Bacteria | 11550 |
| 86 | Ga0075433_10046895 | 3300006852 | Bacteria | 3758 |
| 87 | Ga0075434_100001449 | 3300006871 | Bacteria | 19940 |
| 88 | Ga0075434_100015567 | 3300006871 | Bacteria | 7299 |
| 89 | Ga0075429_100003813 | 3300006880 | Bacteria | 12865 |
| 90 | Ga0068865_100046455 | 3300006881 | Bacteria | 2979 |
| 91 | Ga0075436_100016743 | 3300006914 | Bacteria | 5017 |
| 92 | Ga0097620_100006960 | 3300006931 | Bacteria | 11481 |
| 93 | Ga0097620_100247547 | 3300006931 | Bacteria | 1872 |
| 94 | Ga0075435_100029818 | 3300007076 | Bacteria | 4285 |
| 95 | Ga0111539_10004776 | 3300009094 | Bacteria | 17692 |
| 96 | Ga0111539_10023436 | 3300009094 | Bacteria | 7585 |
| 97 | Ga0111539_10412474 | 3300009094 | Bacteria | 1573 |
| 98 | Ga0111539_10689240 | 3300009094 | Bacteria | 1189 |
| 99 | Ga0105245_10051259 | 3300009098 | Bacteria | 3700 |
| 100 | Ga0105245_10165185 | 3300009098 | Bacteria | 2104 |
| 101 | Ga0105245_10403178 | 3300009098 | Bacteria | 1367 |
| 102 | Ga0105247_10065518 | 3300009101 | Bacteria | 2260 |
| 103 | Ga0114129_10005429 | 3300009147 | Bacteria | 18008 |
| 104 | Ga0114129_10009614 | 3300009147 | Bacteria | 13791 |
| 105 | Ga0114129_10631522 | 3300009147 | Bacteria | 1384 |
| 106 | Ga0105243_10040251 | 3300009148 | Bacteria | 3648 |
| 107 | Ga0105243_10102624 | 3300009148 | Bacteria | 2377 |
| 108 | Ga0105243_10115920 | 3300009148 | Bacteria | 2250 |
| 109 | Ga0105242_10038151 | 3300009176 | Bacteria | 3862 |
| 110 | Ga0105248_10019452 | 3300009177 | Bacteria | 7513 |
| 111 | Ga0105238_10019837 | 3300009551 | Bacteria | 6843 |
| 112 | Ga0099796_10006133 | 3300010159 | Bacteria | 3057 |
| 113 | Ga0105239_10114314 | 3300010375 | Bacteria | 2994 |
| 114 | Ga0105246_10036985 | 3300011119 | Bacteria | 3274 |
| 115 | Ga0105246_10214066 | 3300011119 | Bacteria | 1506 |
| 116 | Ga0157370_10065145 | 3300013104 | Bacteria | 3448 |
| 117 | Ga0157370_10089248 | 3300013104 | Bacteria | 2896 |
| 118 | Ga0157374_10011104 | 3300013296 | Bacteria | 7785 |
| 119 | Ga0157378_10106095 | 3300013297 | Bacteria | 2570 |
| 120 | Ga0157378_10117714 | 3300013297 | Bacteria | 2444 |
| 121 | Ga0157378_10280156 | 3300013297 | Bacteria | 1607 |
| 122 | Ga0163162_10060832 | 3300013306 | Bacteria | 3813 |
| 123 | Ga0157380_10130530 | 3300014326 | Bacteria | 2143 |
| 124 | Ga0157380_10405305 | 3300014326 | Bacteria | 1295 |
| 125 | Ga0182008_10079540 | 3300014497 | Bacteria | 1613 |
| 126 | Ga0157379_10344980 | 3300014968 | Bacteria | 1362 |
| 127 | Ga0157376_10040115 | 3300014969 | Bacteria | 3824 |
| 128 | Ga0182007_10040468 | 3300015262 | Bacteria | 1556 |
| 129 | Ga0163161_10032369 | 3300017792 | Bacteria | 3732 |
| 130 | Ga0163161_10121036 | 3300017792 | Bacteria | 1967 |
| 131 | Ga0213872_10082669 | 3300021361 | Bacteria | 1442 |
| 132 | Ga0213874_10012772 | 3300021377 | Bacteria | 2161 |
| 133 | Ga0213876_10023762 | 3300021384 | Bacteria | 3236 |
| 134 | Ga0213876_10102964 | 3300021384 | Bacteria | 1514 |
| 135 | Ga0213875_10000053 | 3300021388 | Bacteria | 141791 |
| 136 | Ga0209233_1013549 | 3300025261 | Bacteria | 2326 |
| 137 | Ga0207656_10080328 | 3300025321 | Bacteria | 1464 |
| 138 | Ga0207682_10003098 | 3300025893 | Bacteria | 7284 |
| 139 | Ga0207692_10056077 | 3300025898 | Bacteria | 2020 |
| 140 | Ga0207710_10044455 | 3300025900 | Bacteria | 1978 |
| 141 | Ga0207688_10002341 | 3300025901 | Bacteria | 10178 |
| 142 | Ga0207647_10005289 | 3300025904 | Bacteria | 9490 |
| 143 | Ga0207699_10037069 | 3300025906 | Bacteria | 2785 |
| 144 | Ga0207643_10000892 | 3300025908 | Bacteria | 17974 |
| 145 | Ga0207643_10035582 | 3300025908 | Bacteria | 2792 |
| 146 | Ga0207695_10320873 | 3300025913 | Bacteria | 1438 |
| 147 | Ga0207671_10054885 | 3300025914 | Bacteria | 2951 |
| 148 | Ga0207693_10015043 | 3300025915 | Bacteria | 6211 |
| 149 | Ga0207663_10072660 | 3300025916 | Bacteria | 2224 |
| 150 | Ga0207662_10019164 | 3300025918 | Bacteria | 3890 |
| 151 | Ga0207649_10228868 | 3300025920 | Bacteria | 1328 |
| 152 | Ga0207681_10071700 | 3300025923 | Bacteria | 2417 |
| 153 | Ga0207681_10094310 | 3300025923 | Bacteria | 2144 |
| 154 | Ga0207681_10155730 | 3300025923 | Bacteria | 1717 |
| 155 | Ga0207694_10016032 | 3300025924 | Bacteria | 5653 |
| 156 | Ga0207650_10049292 | 3300025925 | Bacteria | 3109 |
| 157 | Ga0207650_10190286 | 3300025925 | Bacteria | 1639 |
| 158 | Ga0207659_10159436 | 3300025926 | Bacteria | 1770 |
| 159 | Ga0207700_10092527 | 3300025928 | Bacteria | 2391 |
| 160 | Ga0207644_10037060 | 3300025931 | Bacteria | 3428 |
| 161 | Ga0207644_10195206 | 3300025931 | Bacteria | 1594 |
| 162 | Ga0207706_10001347 | 3300025933 | Bacteria | 24537 |
| 163 | Ga0207706_10154953 | 3300025933 | Bacteria | 2015 |
| 164 | Ga0207709_10100661 | 3300025935 | Bacteria | 1910 |
| 165 | Ga0207709_10119636 | 3300025935 | Bacteria | 1776 |
| 166 | Ga0207670_10004352 | 3300025936 | Bacteria | 7611 |
| 167 | Ga0207670_10077094 | 3300025936 | Bacteria | 2321 |
| 168 | Ga0207669_10006458 | 3300025937 | Bacteria | 5360 |
| 169 | Ga0207669_10135995 | 3300025937 | Bacteria | 1697 |
| 170 | Ga0207704_10080186 | 3300025938 | Bacteria | 2106 |
| 171 | Ga0207691_10009785 | 3300025940 | Bacteria | 9203 |
| 172 | Ga0207691_10066452 | 3300025940 | Bacteria | 3262 |
| 173 | Ga0207689_10012534 | 3300025942 | Bacteria | 7242 |
| 174 | Ga0207689_10050979 | 3300025942 | Bacteria | 3411 |
| 175 | Ga0207661_10063155 | 3300025944 | Bacteria | 2999 |
| 176 | Ga0207661_10079863 | 3300025944 | Bacteria | 2697 |
| 177 | Ga0207679_10309721 | 3300025945 | Bacteria | 1364 |
| 178 | Ga0207712_10018611 | 3300025961 | Bacteria | 4527 |
| 179 | Ga0207640_10036325 | 3300025981 | Bacteria | 3092 |
| 180 | Ga0207658_10168807 | 3300025986 | Bacteria | 1800 |
| 181 | Ga0207658_10334561 | 3300025986 | Bacteria | 1314 |
| 182 | Ga0207677_10005750 | 3300026023 | Bacteria | 6747 |
| 183 | Ga0207677_10054738 | 3300026023 | Bacteria | 2725 |
| 184 | Ga0207703_10011709 | 3300026035 | Bacteria | 6825 |
| 185 | Ga0207639_10080993 | 3300026041 | Bacteria | 2570 |
| 186 | Ga0207639_10131445 | 3300026041 | Bacteria | 2073 |
| 187 | Ga0207678_10006591 | 3300026067 | Bacteria | 10298 |
| 188 | Ga0207708_10002253 | 3300026075 | Bacteria | 14200 |
| 189 | Ga0207648_10002628 | 3300026089 | Bacteria | 19224 |
| 190 | Ga0207648_10008182 | 3300026089 | Bacteria | 10165 |
| 191 | Ga0207676_10004546 | 3300026095 | Bacteria | 9820 |
| 192 | Ga0207676_10046067 | 3300026095 | Bacteria | 3372 |
| 193 | Ga0207674_10117901 | 3300026116 | Bacteria | 2625 |
| 194 | Ga0207675_100008496 | 3300026118 | Bacteria | 9667 |
| 195 | Ga0207675_100385503 | 3300026118 | Bacteria | 1379 |
| 196 | Ga0207683_10014140 | 3300026121 | Bacteria | 6800 |
| 197 | Ga0207683_10032942 | 3300026121 | Bacteria | 4501 |
| 198 | Ga0207698_10055555 | 3300026142 | Bacteria | 3052 |
| 199 | Ga0207428_10001174 | 3300027907 | Bacteria | 28208 |
| 200 | Ga0268265_10140488 | 3300028380 | Bacteria | 2021 |
| 201 | Ga0268264_10016501 | 3300028381 | Bacteria | 6046 |
| 202 | Ga0265337_1009821 | 3300028556 | Bacteria | 3391 |
| 203 | Ga0265318_10016375 | 3300028577 | Bacteria | 3063 |
| 204 | Ga0265338_10319330 | 3300028800 | Bacteria | 1124 |
| 205 | Ga0265330_10046183 | 3300031235 | Bacteria | 1919 |
| 206 | Ga0265332_10015959 | 3300031238 | Bacteria | 3315 |
| 207 | Ga0265332_10052195 | 3300031238 | Bacteria | 1756 |
| 208 | Ga0265328_10052900 | 3300031239 | Bacteria | 1490 |
| 209 | Ga0265320_10010340 | 3300031240 | Bacteria | 5562 |
| 210 | Ga0265325_10037631 | 3300031241 | Bacteria | 2557 |
| 211 | Ga0265329_10003528 | 3300031242 | Bacteria | 6777 |
| 212 | Ga0265340_10020915 | 3300031247 | Bacteria | 3356 |
| 213 | Ga0265339_10020861 | 3300031249 | Bacteria | 3823 |
| 214 | Ga0265339_10051243 | 3300031249 | Bacteria | 2253 |
| 215 | Ga0265331_10026505 | 3300031250 | Bacteria | 2912 |
| 216 | Ga0265316_10042236 | 3300031344 | Bacteria | 3645 |
| 217 | Ga0265316_10194727 | 3300031344 | Bacteria | 1504 |
| 218 | Ga0265314_10044156 | 3300031711 | Bacteria | 3161 |
| 219 | Ga0265314_10072158 | 3300031711 | Bacteria | 2307 |
| 220 | Ga0265342_10007165 | 3300031712 | Bacteria | 8208 |
| 221 | Ga0265342_10020619 | 3300031712 | Bacteria | 4223 |
| 222 | Ga0307510_10128548 | 3300033180 | Bacteria | 2214 |
| 223 | Ga0373950_0006104 | 3300034818 | Bacteria | 1825 |
| 224 | Ga0373944_0043698 | 3300035089 | Bacteria | 1393 |
| 225 | Ga0373923_0021811 | 3300035111 | Bacteria | 2504 |
| 226 | Ga0373932_0037922 | 3300035112 | Bacteria | 1376 |
| 227 | Ga0373936_0000140 | 3300035113 | Bacteria | 25032 |
| 228 | Ga0373953_0000297 | 3300035117 | Bacteria | 13618 |
| 229 | Ga0373954_0003422 | 3300035118 | Bacteria | 6726 |
| 230 | Ga0373956_0059307 | 3300035119 | Bacteria | 1731 |
| 231 | Ga0373956_0155795 | 3300035119 | Bacteria | 1075 |
| 232 | Ga0373943_0019299 | 3300035170 | Bacteria | 3135 |
| 233 | Ga0373946_0003338 | 3300035171 | Bacteria | 5697 |
| 234 | Ga0373955_0000121 | 3300035172 | Bacteria | 31151 |
| 235 | Ga0373924_0004545 | 3300035410 | Bacteria | 4849 |
| 236 | Ga0373924_0066533 | 3300035410 | Bacteria | 1515 |
| 237 | Ga0373931_0003919 | 3300035691 | Bacteria | 6733 |
| 238 | Ga0373935_0000739 | 3300035692 | Bacteria | 17371 |
| 239 | Ga0373935_0025841 | 3300035692 | Bacteria | 3619 |
| 240 | Ga0373927_0070375 | 3300035695 | Bacteria | 2265 |
| 241 | Ga0373933_0147001 | 3300035724 | Bacteria | 1491 |
| 242 | Ga0373947_0003026 | 3300035725 | Bacteria | 10016 |
| 243 | Ga0373937_0001392 | 3300036401 | Bacteria | 20206 |
| 244 | Ga0373937_0040421 | 3300036401 | Bacteria | 4251 |
| 245 | Ga0373937_0130482 | 3300036401 | Bacteria | 2347 |
| 246 | Ga0373925_0000016 | 3300037068 | Bacteria | 176830 |
| 247 | Ga0373925_0166898 | 3300037068 | Bacteria | 1736 |
| 248 | Ga0373925_0235041 | 3300037068 | Bacteria | 1466 |
| 249 | Ga0436364_0288952 | 3300037853 | Bacteria | 32031 |
| 250 | Ga0436365_1268301 | 3300039437 | Bacteria | 4233 |
| 251 | Ga0436365_1280755 | 3300039437 | Bacteria | 7070 |
| 252 | Ga0436363_1035413 | 3300039450 | Bacteria | 2989 |
| 253 | Ga0436362_0576845 | 3300039453 | Bacteria | 1842 |
| 254 | Ga0439441_009028 | 3300042001 | Bacteria | 1642 |
| 255 | Ga0466959_0062410 | 3300045049 | Bacteria | 2708 |
| 256 | Ga0495592_0000044 | 3300046454 | Bacteria | 118749 |
| 257 | Ga0495603_0038922 | 3300046455 | Bacteria | 2850 |
| 258 | Ga0495603_0082992 | 3300046455 | Bacteria | 1877 |
| 259 | Ga0495629_0001495 | 3300046459 | Bacteria | 18379 |
| 260 | Ga0495641_0031797 | 3300046461 | Bacteria | 2518 |
| 261 | Ga0495651_0000384 | 3300046462 | Bacteria | 34361 |
| 262 | Ga0495653_0000022 | 3300046463 | Bacteria | 169653 |
| 263 | Ga0495639_0003763 | 3300046475 | Bacteria | 6525 |
| 264 | Ga0495662_0004440 | 3300046476 | Bacteria | 7042 |
| 265 | Ga0495664_0000013 | 3300046477 | Bacteria | 204282 |
| 266 | Ga0495585_0019393 | 3300046492 | Bacteria | 3921 |
| 267 | Ga0495594_0137821 | 3300046499 | Bacteria | 1383 |
| 268 | Ga0495594_0245068 | 3300046499 | Bacteria | 1021 |
| 269 | Ga0495608_0000004 | 3300046511 | Bacteria | 355027 |
| 270 | Ga0495608_0163389 | 3300046511 | Bacteria | 1415 |
| 271 | Ga0495618_0000032 | 3300046514 | Bacteria | 104874 |
| 272 | Ga0495628_0000014 | 3300046516 | Bacteria | 205818 |
| 273 | Ga0495628_0105780 | 3300046516 | Bacteria | 2168 |
| 274 | Ga0495630_0004635 | 3300046517 | Bacteria | 9643 |
| 275 | Ga0495631_0074482 | 3300046518 | Bacteria | 1466 |
| 276 | Ga0495644_0048161 | 3300046523 | Bacteria | 1601 |
| 277 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 278 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 279 | Ga0495587_0000004 | 3300046536 | Bacteria | 358433 |
| 280 | Ga0495587_0179594 | 3300046536 | Bacteria | 1200 |
| 281 | Ga0495598_0004132 | 3300046537 | Bacteria | 3125 |
| 282 | Ga0495598_0020105 | 3300046537 | Bacteria | 1759 |
| 283 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 284 | Ga0495667_0000009 | 3300046559 | Bacteria | 223329 |
| 285 | Ga0495668_0100913 | 3300046616 | Bacteria | 1579 |
| 286 | Ga0495634_0000033 | 3300046642 | Bacteria | 109811 |
| 287 | Ga0495611_0044260 | 3300046648 | Bacteria | 1991 |
| 288 | Ga0495635_0000003 | 3300046663 | Bacteria | 390055 |
| 289 | Ga0495635_0086760 | 3300046663 | Bacteria | 2142 |
| 290 | Ga0495588_0095200 | 3300046674 | Bacteria | 1561 |
| 291 | Ga0495657_0000138 | 3300046675 | Bacteria | 65458 |
| 292 | Ga0495657_0007808 | 3300046675 | Bacteria | 8216 |
| 293 | Ga0495599_0000030 | 3300046678 | Bacteria | 113715 |
| 294 | Ga0495623_0000059 | 3300046679 | Bacteria | 67952 |
| 295 | Ga0495646_0000031 | 3300046680 | Bacteria | 87445 |
| 296 | Ga0495647_0026470 | 3300046681 | Bacteria | 2125 |
| 297 | Ga0495647_0061745 | 3300046681 | Bacteria | 1480 |
| 298 | Ga0495658_0010422 | 3300046683 | Bacteria | 4651 |
| 299 | Ga0495613_0038547 | 3300046689 | Bacteria | 3542 |
| 300 | Ga0495670_0027075 | 3300046691 | Bacteria | 2838 |
| 301 | Ga0495589_0088602 | 3300046794 | Bacteria | 1503 |
| 302 | Ga0495600_0000003 | 3300046809 | Bacteria | 180457 |
| 303 | Ga0495600_0079908 | 3300046809 | Bacteria | 2135 |
| 304 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 305 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 306 | Ga0495672_0071736 | 3300047320 | Bacteria | 1959 |
| 307 | Ga0495680_0000676 | 3300047322 | Bacteria | 38110 |
| 308 | Ga0495680_0097153 | 3300047322 | Bacteria | 2199 |
| 309 | Ga0495675_0000048 | 3300047444 | Bacteria | 81486 |
| 310 | Ga0495684_0000019 | 3300047471 | Bacteria | 153938 |
| 311 | Ga0495684_0048138 | 3300047471 | Bacteria | 3260 |
| 312 | Ga0495593_0000511 | 3300047673 | Bacteria | 21936 |
| 313 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 314 | Ga0495602_0127542 | 3300048088 | Bacteria | 2035 |
| 315 | Ga0495615_0008654 | 3300048090 | Bacteria | 1976 |
| 316 | Ga0496100_0002484 | 3300048903 | Bacteria | 9373 |
| 317 | Ga0496101_0031700 | 3300048904 | Bacteria | 3717 |
| 318 | Ga0496102_0013610 | 3300048905 | Bacteria | 7050 |
| 319 | Ga0496103_0014305 | 3300048906 | Bacteria | 4712 |
| 320 | Ga0496104_0035510 | 3300048907 | Bacteria | 4654 |
| 321 | Ga0496105_0001765 | 3300048908 | Bacteria | 15466 |
| 322 | Ga0496106_0002523 | 3300048909 | Bacteria | 13638 |
| 323 | Ga0496107_0018211 | 3300048910 | Bacteria | 4943 |
| 324 | Ga0496108_0075842 | 3300048911 | Bacteria | 2841 |
| 325 | Ga0496110_0124981 | 3300048913 | Bacteria | 2320 |
| 326 | Ga0496111_0003593 | 3300048914 | Bacteria | 9614 |
| 327 | Ga0496112_0372687 | 3300048915 | Bacteria | 1369 |
| 328 | Ga0496113_0070925 | 3300048916 | Bacteria | 2649 |
| 329 | Ga0496114_0009703 | 3300048917 | Bacteria | 7646 |
| 330 | Ga0496115_0017376 | 3300048918 | Bacteria | 5498 |
| 331 | Ga0501031_0152642 | 3300049568 | Bacteria | 1509 |
| 332 | Ga0501034_0031387 | 3300049571 | Bacteria | 5396 |
| 333 | Ga0501037_0175401 | 3300049573 | Bacteria | 1522 |
| 334 | Ga0501039_0059212 | 3300049575 | Bacteria | 2967 |
| 335 | Ga0501041_0037133 | 3300049577 | Bacteria | 2951 |
| 336 | Ga0501043_0105838 | 3300049579 | Bacteria | 2210 |
| 337 | Ga0501047_0036138 | 3300049581 | Bacteria | 4773 |
| 338 | Ga0501047_0245613 | 3300049581 | Bacteria | 1639 |
| 339 | Ga0501070_0298588 | 3300049586 | Bacteria | 1312 |
| 340 | Ga0501071_0091986 | 3300049587 | Bacteria | 2229 |
| 341 | Ga0501072_0002307 | 3300049588 | Bacteria | 14289 |
| 342 | Ga0501072_0272808 | 3300049588 | Bacteria | 1346 |
| 343 | Ga0501073_0026086 | 3300049589 | Bacteria | 4187 |
| 344 | Ga0501074_0072820 | 3300049590 | Bacteria | 2468 |
| 345 | Ga0501074_0093766 | 3300049590 | Bacteria | 2150 |
| 346 | Ga0501076_0217936 | 3300049592 | Bacteria | 1560 |
| 347 | Ga0501079_0010282 | 3300049741 | Bacteria | 7108 |
| 348 | Ga0501081_0007241 | 3300049743 | Bacteria | 7210 |
| 349 | Ga0501083_0025154 | 3300049744 | Bacteria | 4122 |
| 350 | Ga0501044_0166124 | 3300049823 | Bacteria | 2181 |
| 351 | nmdc:mga03683_20796_c1 | 3300050489 | Bacteria | 2523 |
| 352 | nmdc:mga00v17_14126_c1 | 3300050491 | Bacteria | 4451 |
| 353 | nmdc:mga00v17_79615_c1 | 3300050491 | Bacteria | 2044 |
| 354 | nmdc:mga0yw44_121816_c1 | 3300050492 | Bacteria | 1680 |
| 355 | nmdc:mga0yw44_29198_c1 | 3300050492 | Bacteria | 3182 |
| 356 | nmdc:mga0k408_110262_c1 | 3300050493 | Bacteria | 1627 |
| 357 | nmdc:mga0k408_6600_c1 | 3300050493 | Bacteria | 6183 |
| 358 | nmdc:mga06z11_229058_c1 | 3300050494 | Bacteria | 1088 |
| 359 | nmdc:mga06z11_37888_c1 | 3300050494 | Bacteria | 2391 |
| 360 | nmdc:mga06z11_75461_c1 | 3300050494 | Bacteria | 1795 |
| 361 | nmdc:mga04h51_22707_c1 | 3300050495 | Bacteria | 1902 |
| 362 | nmdc:mga04h51_59567_c1 | 3300050495 | Bacteria | 1305 |
| 363 | nmdc:mga07m45_117838_c1 | 3300050496 | Bacteria | 1533 |
| 364 | nmdc:mga05p37_3054_c1 | 3300050507 | Bacteria | 19445 |
| 365 | nmdc:mga05p37_8361_c1 | 3300050507 | Bacteria | 12237 |
| 366 | nmdc:mga09592_6472_c1 | 3300050508 | Bacteria | 9539 |
| 367 | nmdc:mga0qj67_165983_c1 | 3300050509 | Bacteria | 1792 |
| 368 | nmdc:mga0qj67_808_c1 | 3300050509 | Bacteria | 21326 |
| 369 | nmdc:mga06r32_2114_c1 | 3300050510 | Bacteria | 17790 |
| 370 | nmdc:mga08y16_113831_c1 | 3300050511 | Bacteria | 2816 |
| 371 | nmdc:mga08y16_31039_c1 | 3300050511 | Bacteria | 5620 |
| 372 | nmdc:mga08y16_7095_c1 | 3300050511 | Bacteria | 11760 |
| 373 | nmdc:mga0n895_14097_c1 | 3300050512 | Bacteria | 7247 |
| 374 | nmdc:mga0n895_3287_c1 | 3300050512 | Bacteria | 12983 |
| 375 | nmdc:mga0rr50_393783_c1 | 3300050513 | Bacteria | 1169 |
| 376 | nmdc:mga0rr50_411688_c1 | 3300050513 | Bacteria | 1143 |
| 377 | nmdc:mga0rr50_93186_c1 | 3300050513 | Bacteria | 2350 |
| 378 | nmdc:mga08x19_58625_c1 | 3300050514 | Bacteria | 2491 |
| 379 | nmdc:mga0a205_104803_c1 | 3300050515 | Bacteria | 2727 |
| 380 | nmdc:mga0a205_125151_c1 | 3300050515 | Bacteria | 2470 |
| 381 | nmdc:mga0a205_1618_c1 | 3300050515 | Bacteria | 19373 |
| 382 | nmdc:mga0sz30_108927_c1 | 3300050516 | Bacteria | 1213 |
| 383 | nmdc:mga0sz30_148634_c1 | 3300050516 | Bacteria | 1036 |
| 384 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 385 | Ga0495601_0008111 | 3300053077 | Bacteria | 6192 |
| 386 | Ga0495601_0024924 | 3300053077 | Bacteria | 3685 |
| 387 | Ga0495612_0000012 | 3300053078 | Bacteria | 223883 |
| 388 | Ga0495595_0000012 | 3300053084 | Bacteria | 174322 |
| 389 | Ga0495595_0000702 | 3300053084 | Bacteria | 12728 |
| 390 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 391 | Ga0495619_0037474 | 3300053085 | Bacteria | 3160 |
| 392 | Ga0500641_0004563 | 3300053096 | Bacteria | 4895 |
| 393 | Ga0500641_0040193 | 3300053096 | Bacteria | 1887 |
| 394 | Ga0500642_0041124 | 3300053130 | Bacteria | 1998 |
| 395 | Ga0501082_0001121 | 3300060353 | Bacteria | 23660 |
| 396 | Ga0501082_0028687 | 3300060353 | Bacteria | 4794 |
| 397 | Ga0501082_0105269 | 3300060353 | Bacteria | 2440 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046518 | Ga0495631_0074482 | Ga0495631_0074482_12_845 | 277 |
| 2 | 3300039450 | Ga0436363_1035413 | Ga0436363_1035413_1378_2286 | 286 |
| 3 | 3300034818 | Ga0373950_0006104 | Ga0373950_0006104_86_955 | 287 |
| 4 | iso_pu_bacteria | 2597490356 | 2599105144 | 295 |
| 5 | iso_pu_bacteria | 2846952575 | 2846955179 | 295 |
| 6 | 3300005458 | Ga0070681_10036297 | Ga0070681_100362972 | 296 |
| 7 | 3300005530 | Ga0070679_100091736 | Ga0070679_1000917363 | 296 |
| 8 | 3300013104 | Ga0157370_10089248 | Ga0157370_100892483 | 296 |
| 9 | 3300025913 | Ga0207695_10320873 | Ga0207695_103208731 | 296 |
| 10 | iso_pu_bacteria | 2643221547 | 2643756602 | 301 |
| 11 | 3300005436 | Ga0070713_100238033 | Ga0070713_1002380332 | 303 |
| 12 | 3300021377 | Ga0213874_10012772 | Ga0213874_100127721 | 303 |
| 13 | 3300021384 | Ga0213876_10102964 | Ga0213876_101029641 | 303 |
| 14 | 3300036401 | Ga0373937_0130482 | Ga0373937_0130482_1120_2034 | 303 |
| 15 | 3300039437 | Ga0436365_1268301 | Ga0436365_1268301_784_1743 | 303 |
| 16 | 3300039453 | Ga0436362_0576845 | Ga0436362_0576845_338_1267 | 303 |
| 17 | 3300047471 | Ga0495684_0048138 | Ga0495684_0048138_465_1436 | 303 |
| 18 | 3300005330 | Ga0070690_100068791 | Ga0070690_1000687913 | 304 |
| 19 | 3300005457 | Ga0070662_100006202 | Ga0070662_1000062021 | 304 |
| 20 | 3300005459 | Ga0068867_100393628 | Ga0068867_1003936281 | 304 |
| 21 | 3300005539 | Ga0068853_100157808 | Ga0068853_1001578082 | 304 |
| 22 | 3300005981 | Ga0081538_10007153 | Ga0081538_100071533 | 304 |
| 23 | 3300006028 | Ga0070717_10011936 | Ga0070717_100119364 | 304 |
| 24 | 3300006173 | Ga0070716_100051506 | Ga0070716_1000515062 | 304 |
| 25 | 3300006195 | Ga0075366_10185565 | Ga0075366_101855652 | 304 |
| 26 | 3300006914 | Ga0075436_100016743 | Ga0075436_1000167435 | 304 |
| 27 | 3300009094 | Ga0111539_10023436 | Ga0111539_100234363 | 304 |
| 28 | 3300009094 | Ga0111539_10689240 | Ga0111539_106892402 | 304 |
| 29 | 3300009148 | Ga0105243_10102624 | Ga0105243_101026241 | 304 |
| 30 | 3300010159 | Ga0099796_10006133 | Ga0099796_100061332 | 304 |
| 31 | 3300011119 | Ga0105246_10214066 | Ga0105246_102140662 | 304 |
| 32 | 3300013297 | Ga0157378_10280156 | Ga0157378_102801562 | 304 |
| 33 | 3300014326 | Ga0157380_10405305 | Ga0157380_104053052 | 304 |
| 34 | 3300021361 | Ga0213872_10082669 | Ga0213872_100826692 | 304 |
| 35 | 3300021388 | Ga0213875_10000053 | Ga0213875_10000053115 | 304 |
| 36 | 3300025906 | Ga0207699_10037069 | Ga0207699_100370693 | 304 |
| 37 | 3300025925 | Ga0207650_10190286 | Ga0207650_101902863 | 304 |
| 38 | 3300025933 | Ga0207706_10154953 | Ga0207706_101549532 | 304 |
| 39 | 3300026041 | Ga0207639_10131445 | Ga0207639_101314452 | 304 |
| 40 | 3300033180 | Ga0307510_10128548 | Ga0307510_101285482 | 304 |
| 41 | 3300035089 | Ga0373944_0043698 | Ga0373944_0043698_21_935 | 304 |
| 42 | 3300035111 | Ga0373923_0021811 | Ga0373923_0021811_693_1607 | 304 |
| 43 | 3300035113 | Ga0373936_0000140 | Ga0373936_0000140_18860_19774 | 304 |
| 44 | 3300035117 | Ga0373953_0000297 | Ga0373953_0000297_8296_9210 | 304 |
| 45 | 3300035118 | Ga0373954_0003422 | Ga0373954_0003422_4418_5332 | 304 |
| 46 | 3300035119 | Ga0373956_0155795 | Ga0373956_0155795_13_927 | 304 |
| 47 | 3300035171 | Ga0373946_0003338 | Ga0373946_0003338_4061_4975 | 304 |
| 48 | 3300035172 | Ga0373955_0000121 | Ga0373955_0000121_22941_23855 | 304 |
| 49 | 3300035410 | Ga0373924_0004545 | Ga0373924_0004545_2202_3116 | 304 |
| 50 | 3300035692 | Ga0373935_0000739 | Ga0373935_0000739_13376_14290 | 304 |
| 51 | 3300035695 | Ga0373927_0070375 | Ga0373927_0070375_1278_2192 | 304 |
| 52 | 3300035725 | Ga0373947_0003026 | Ga0373947_0003026_8183_9097 | 304 |
| 53 | 3300036401 | Ga0373937_0001392 | Ga0373937_0001392_6841_7755 | 304 |
| 54 | 3300037068 | Ga0373925_0000016 | Ga0373925_0000016_90123_91037 | 304 |
| 55 | 3300037853 | Ga0436364_0288952 | Ga0436364_0288952_18431_19348 | 304 |
| 56 | 3300042001 | Ga0439441_009028 | Ga0439441_009028_310_1287 | 304 |
| 57 | 3300045049 | Ga0466959_0062410 | Ga0466959_0062410_1048_1965 | 304 |
| 58 | 3300046454 | Ga0495592_0000044 | Ga0495592_0000044_58608_59522 | 304 |
| 59 | 3300046459 | Ga0495629_0001495 | Ga0495629_0001495_4102_5016 | 304 |
| 60 | 3300046462 | Ga0495651_0000384 | Ga0495651_0000384_25085_25999 | 304 |
| 61 | 3300046463 | Ga0495653_0000022 | Ga0495653_0000022_40490_41404 | 304 |
| 62 | 3300046476 | Ga0495662_0004440 | Ga0495662_0004440_1879_2793 | 304 |
| 63 | 3300046477 | Ga0495664_0000013 | Ga0495664_0000013_149852_150766 | 304 |
| 64 | 3300046511 | Ga0495608_0000004 | Ga0495608_0000004_300582_301496 | 304 |
| 65 | 3300046514 | Ga0495618_0000032 | Ga0495618_0000032_26919_27833 | 304 |
| 66 | 3300046516 | Ga0495628_0000014 | Ga0495628_0000014_55060_55974 | 304 |
| 67 | 3300046517 | Ga0495630_0004635 | Ga0495630_0004635_335_1249 | 304 |
| 68 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_154966_155880 | 304 |
| 69 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_248970_249884 | 304 |
| 70 | 3300046536 | Ga0495587_0000004 | Ga0495587_0000004_304066_304980 | 304 |
| 71 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_53610_54524 | 304 |
| 72 | 3300046559 | Ga0495667_0000009 | Ga0495667_0000009_58659_59573 | 304 |
| 73 | 3300046642 | Ga0495634_0000033 | Ga0495634_0000033_30178_31092 | 304 |
| 74 | 3300046663 | Ga0495635_0000003 | Ga0495635_0000003_53467_54381 | 304 |
| 75 | 3300046675 | Ga0495657_0000138 | Ga0495657_0000138_5292_6206 | 304 |
| 76 | 3300046678 | Ga0495599_0000030 | Ga0495599_0000030_59239_60153 | 304 |
| 77 | 3300046679 | Ga0495623_0000059 | Ga0495623_0000059_53508_54422 | 304 |
| 78 | 3300046680 | Ga0495646_0000031 | Ga0495646_0000031_53526_54440 | 304 |
| 79 | 3300046689 | Ga0495613_0038547 | Ga0495613_0038547_938_1852 | 304 |
| 80 | 3300046809 | Ga0495600_0000003 | Ga0495600_0000003_167368_168282 | 304 |
| 81 | 3300047317 | Ga0495604_0000002 | Ga0495604_0000002_476484_477398 | 304 |
| 82 | 3300047319 | Ga0495674_0000004 | Ga0495674_0000004_475817_476731 | 304 |
| 83 | 3300047322 | Ga0495680_0000676 | Ga0495680_0000676_28535_29449 | 304 |
| 84 | 3300047444 | Ga0495675_0000048 | Ga0495675_0000048_27174_28088 | 304 |
| 85 | 3300047471 | Ga0495684_0000019 | Ga0495684_0000019_99514_100428 | 304 |
| 86 | 3300047673 | Ga0495593_0000511 | Ga0495593_0000511_2317_3231 | 304 |
| 87 | 3300048088 | Ga0495602_0000001 | Ga0495602_0000001_53509_54423 | 304 |
| 88 | 3300049577 | Ga0501041_0037133 | Ga0501041_0037133_1277_2215 | 304 |
| 89 | 3300049587 | Ga0501071_0091986 | Ga0501071_0091986_1207_2145 | 304 |
| 90 | 3300049588 | Ga0501072_0272808 | Ga0501072_0272808_130_1083 | 304 |
| 91 | 3300049590 | Ga0501074_0093766 | Ga0501074_0093766_14_952 | 304 |
| 92 | 3300049741 | Ga0501079_0010282 | Ga0501079_0010282_6062_7000 | 304 |
| 93 | 3300049743 | Ga0501081_0007241 | Ga0501081_0007241_1553_2491 | 304 |
| 94 | 3300050509 | nmdc:mga0qj67_165983_c1 | nmdc:mga0qj67_165983_c1_50_1027 | 304 |
| 95 | 3300050511 | nmdc:mga08y16_31039_c1 | nmdc:mga08y16_31039_c1_2786_3727 | 304 |
| 96 | 3300050514 | nmdc:mga08x19_58625_c1 | nmdc:mga08x19_58625_c1_1456_2373 | 304 |
| 97 | 3300053077 | Ga0495601_0000002 | Ga0495601_0000002_370115_371029 | 304 |
| 98 | 3300053078 | Ga0495612_0000012 | Ga0495612_0000012_169512_170426 | 304 |
| 99 | 3300053084 | Ga0495595_0000012 | Ga0495595_0000012_128099_129013 | 304 |
| 100 | 3300053085 | Ga0495619_0000003 | Ga0495619_0000003_58631_59545 | 304 |
| 101 | 3300060353 | Ga0501082_0028687 | Ga0501082_0028687_493_1431 | 304 |
| 102 | 3300001977 | JGI24746J21847_1000990 | JGI24746J21847_10009903 | 305 |
| 103 | 3300001990 | JGI24737J22298_10016345 | JGI24737J22298_100163452 | 305 |
| 104 | 3300002070 | JGI24750J21931_1001457 | JGI24750J21931_10014572 | 305 |
| 105 | 3300002075 | JGI24738J21930_10018916 | JGI24738J21930_100189161 | 305 |
| 106 | 3300002077 | JGI24744J21845_10000413 | JGI24744J21845_100004132 | 305 |
| 107 | 3300002244 | JGI24742J22300_10000805 | JGI24742J22300_100008054 | 305 |
| 108 | 3300002459 | JGI24751J29686_10020193 | JGI24751J29686_100201932 | 305 |
| 109 | 3300003203 | JGI25406J46586_10000621 | JGI25406J46586_100006214 | 305 |
| 110 | 3300003911 | JGI25405J52794_10007240 | JGI25405J52794_100072402 | 305 |
| 111 | 3300005329 | Ga0070683_100102104 | Ga0070683_1001021041 | 305 |
| 112 | 3300005334 | Ga0068869_100040563 | Ga0068869_1000405632 | 305 |
| 113 | 3300005335 | Ga0070666_10018911 | Ga0070666_100189112 | 305 |
| 114 | 3300005337 | Ga0070682_100025802 | Ga0070682_1000258022 | 305 |
| 115 | 3300005338 | Ga0068868_100039788 | Ga0068868_1000397883 | 305 |
| 116 | 3300005339 | Ga0070660_100027790 | Ga0070660_1000277902 | 305 |
| 117 | 3300005347 | Ga0070668_100097567 | Ga0070668_1000975672 | 305 |
| 118 | 3300005353 | Ga0070669_100051774 | Ga0070669_1000517741 | 305 |
| 119 | 3300005353 | Ga0070669_100096477 | Ga0070669_1000964772 | 305 |
| 120 | 3300005354 | Ga0070675_100037573 | Ga0070675_1000375734 | 305 |
| 121 | 3300005355 | Ga0070671_100018449 | Ga0070671_1000184495 | 305 |
| 122 | 3300005356 | Ga0070674_100095112 | Ga0070674_1000951122 | 305 |
| 123 | 3300005364 | Ga0070673_100030123 | Ga0070673_1000301233 | 305 |
| 124 | 3300005367 | Ga0070667_100144323 | Ga0070667_1001443232 | 305 |
| 125 | 3300005367 | Ga0070667_100282563 | Ga0070667_1002825631 | 305 |
| 126 | 3300005437 | Ga0070710_10047429 | Ga0070710_100474292 | 305 |
| 127 | 3300005440 | Ga0070705_100034600 | Ga0070705_1000346002 | 305 |
| 128 | 3300005456 | Ga0070678_100030353 | Ga0070678_1000303533 | 305 |
| 129 | 3300005456 | Ga0070678_100163596 | Ga0070678_1001635962 | 305 |
| 130 | 3300005459 | Ga0068867_100025735 | Ga0068867_1000257353 | 305 |
| 131 | 3300005471 | Ga0070698_100106717 | Ga0070698_1001067173 | 305 |
| 132 | 3300005518 | Ga0070699_100001443 | Ga0070699_1000014439 | 305 |
| 133 | 3300005536 | Ga0070697_100141268 | Ga0070697_1001412682 | 305 |
| 134 | 3300005543 | Ga0070672_100040448 | Ga0070672_1000404483 | 305 |
| 135 | 3300005543 | Ga0070672_100177736 | Ga0070672_1001777362 | 305 |
| 136 | 3300005548 | Ga0070665_100195512 | Ga0070665_1001955121 | 305 |
| 137 | 3300005549 | Ga0070704_100180804 | Ga0070704_1001808043 | 305 |
| 138 | 3300005564 | Ga0070664_100095944 | Ga0070664_1000959442 | 305 |
| 139 | 3300005577 | Ga0068857_100134794 | Ga0068857_1001347942 | 305 |
| 140 | 3300005614 | Ga0068856_100050165 | Ga0068856_1000501654 | 305 |
| 141 | 3300005615 | Ga0070702_100011224 | Ga0070702_1000112242 | 305 |
| 142 | 3300005615 | Ga0070702_100177455 | Ga0070702_1001774551 | 305 |
| 143 | 3300005617 | Ga0068859_100006960 | Ga0068859_1000069605 | 305 |
| 144 | 3300005617 | Ga0068859_100247567 | Ga0068859_1002475672 | 305 |
| 145 | 3300005618 | Ga0068864_100035728 | Ga0068864_1000357283 | 305 |
| 146 | 3300005618 | Ga0068864_100062494 | Ga0068864_1000624942 | 305 |
| 147 | 3300005718 | Ga0068866_10020641 | Ga0068866_100206412 | 305 |
| 148 | 3300005840 | Ga0068870_10006575 | Ga0068870_100065752 | 305 |
| 149 | 3300005842 | Ga0068858_100023619 | Ga0068858_1000236195 | 305 |
| 150 | 3300005843 | Ga0068860_100029725 | Ga0068860_1000297252 | 305 |
| 151 | 3300005844 | Ga0068862_100077460 | Ga0068862_1000774602 | 305 |
| 152 | 3300005844 | Ga0068862_100254988 | Ga0068862_1002549882 | 305 |
| 153 | 3300005937 | Ga0081455_10000009 | Ga0081455_10000009107 | 305 |
| 154 | 3300005937 | Ga0081455_10008013 | Ga0081455_100080133 | 305 |
| 155 | 3300005937 | Ga0081455_10080273 | Ga0081455_100802732 | 305 |
| 156 | 3300005937 | Ga0081455_10110096 | Ga0081455_101100962 | 305 |
| 157 | 3300005983 | Ga0081540_1007786 | Ga0081540_10077863 | 305 |
| 158 | 3300005985 | Ga0081539_10000932 | Ga0081539_1000093213 | 305 |
| 159 | 3300005985 | Ga0081539_10110185 | Ga0081539_101101852 | 305 |
| 160 | 3300006048 | Ga0075363_100015293 | Ga0075363_1000152934 | 305 |
| 161 | 3300006048 | Ga0075363_100045654 | Ga0075363_1000456542 | 305 |
| 162 | 3300006048 | Ga0075363_100049548 | Ga0075363_1000495482 | 305 |
| 163 | 3300006051 | Ga0075364_10013177 | Ga0075364_100131775 | 305 |
| 164 | 3300006051 | Ga0075364_10055758 | Ga0075364_100557582 | 305 |
| 165 | 3300006058 | Ga0075432_10003653 | Ga0075432_100036535 | 305 |
| 166 | 3300006175 | Ga0070712_100009461 | Ga0070712_1000094612 | 305 |
| 167 | 3300006177 | Ga0075362_10013026 | Ga0075362_100130262 | 305 |
| 168 | 3300006178 | Ga0075367_10074785 | Ga0075367_100747852 | 305 |
| 169 | 3300006178 | Ga0075367_10099521 | Ga0075367_100995212 | 305 |
| 170 | 3300006195 | Ga0075366_10007706 | Ga0075366_100077063 | 305 |
| 171 | 3300006237 | Ga0097621_100058727 | Ga0097621_1000587272 | 305 |
| 172 | 3300006844 | Ga0075428_100003428 | Ga0075428_1000034288 | 305 |
| 173 | 3300006846 | Ga0075430_100000944 | Ga0075430_1000009448 | 305 |
| 174 | 3300006847 | Ga0075431_100001444 | Ga0075431_10000144413 | 305 |
| 175 | 3300006852 | Ga0075433_10003897 | Ga0075433_100038975 | 305 |
| 176 | 3300006852 | Ga0075433_10046895 | Ga0075433_100468953 | 305 |
| 177 | 3300006871 | Ga0075434_100001449 | Ga0075434_10000144911 | 305 |
| 178 | 3300006871 | Ga0075434_100015567 | Ga0075434_1000155674 | 305 |
| 179 | 3300006880 | Ga0075429_100003813 | Ga0075429_1000038135 | 305 |
| 180 | 3300006881 | Ga0068865_100046455 | Ga0068865_1000464551 | 305 |
| 181 | 3300006931 | Ga0097620_100006960 | Ga0097620_1000069605 | 305 |
| 182 | 3300006931 | Ga0097620_100247547 | Ga0097620_1002475472 | 305 |
| 183 | 3300007076 | Ga0075435_100029818 | Ga0075435_1000298183 | 305 |
| 184 | 3300009094 | Ga0111539_10004776 | Ga0111539_1000477612 | 305 |
| 185 | 3300009094 | Ga0111539_10412474 | Ga0111539_104124741 | 305 |
| 186 | 3300009098 | Ga0105245_10051259 | Ga0105245_100512595 | 305 |
| 187 | 3300009098 | Ga0105245_10165185 | Ga0105245_101651853 | 305 |
| 188 | 3300009098 | Ga0105245_10403178 | Ga0105245_104031782 | 305 |
| 189 | 3300009101 | Ga0105247_10065518 | Ga0105247_100655182 | 305 |
| 190 | 3300009147 | Ga0114129_10005429 | Ga0114129_1000542912 | 305 |
| 191 | 3300009147 | Ga0114129_10009614 | Ga0114129_100096149 | 305 |
| 192 | 3300009147 | Ga0114129_10631522 | Ga0114129_106315221 | 305 |
| 193 | 3300009148 | Ga0105243_10040251 | Ga0105243_100402513 | 305 |
| 194 | 3300009148 | Ga0105243_10115920 | Ga0105243_101159202 | 305 |
| 195 | 3300009176 | Ga0105242_10038151 | Ga0105242_100381512 | 305 |
| 196 | 3300009177 | Ga0105248_10019452 | Ga0105248_100194522 | 305 |
| 197 | 3300009551 | Ga0105238_10019837 | Ga0105238_100198376 | 305 |
| 198 | 3300010375 | Ga0105239_10114314 | Ga0105239_101143142 | 305 |
| 199 | 3300011119 | Ga0105246_10036985 | Ga0105246_100369854 | 305 |
| 200 | 3300013104 | Ga0157370_10065145 | Ga0157370_100651452 | 305 |
| 201 | 3300013296 | Ga0157374_10011104 | Ga0157374_100111046 | 305 |
| 202 | 3300013297 | Ga0157378_10106095 | Ga0157378_101060951 | 305 |
| 203 | 3300013297 | Ga0157378_10117714 | Ga0157378_101177142 | 305 |
| 204 | 3300013306 | Ga0163162_10060832 | Ga0163162_100608323 | 305 |
| 205 | 3300014326 | Ga0157380_10130530 | Ga0157380_101305302 | 305 |
| 206 | 3300014497 | Ga0182008_10079540 | Ga0182008_100795402 | 305 |
| 207 | 3300014968 | Ga0157379_10344980 | Ga0157379_103449802 | 305 |
| 208 | 3300014969 | Ga0157376_10040115 | Ga0157376_100401154 | 305 |
| 209 | 3300015262 | Ga0182007_10040468 | Ga0182007_100404682 | 305 |
| 210 | 3300017792 | Ga0163161_10032369 | Ga0163161_100323692 | 305 |
| 211 | 3300017792 | Ga0163161_10121036 | Ga0163161_101210362 | 305 |
| 212 | 3300021384 | Ga0213876_10023762 | Ga0213876_100237625 | 305 |
| 213 | 3300025261 | Ga0209233_1013549 | Ga0209233_10135491 | 305 |
| 214 | 3300025321 | Ga0207656_10080328 | Ga0207656_100803282 | 305 |
| 215 | 3300025893 | Ga0207682_10003098 | Ga0207682_100030985 | 305 |
| 216 | 3300025898 | Ga0207692_10056077 | Ga0207692_100560773 | 305 |
| 217 | 3300025900 | Ga0207710_10044455 | Ga0207710_100444552 | 305 |
| 218 | 3300025901 | Ga0207688_10002341 | Ga0207688_100023412 | 305 |
| 219 | 3300025904 | Ga0207647_10005289 | Ga0207647_100052896 | 305 |
| 220 | 3300025908 | Ga0207643_10000892 | Ga0207643_100008923 | 305 |
| 221 | 3300025908 | Ga0207643_10035582 | Ga0207643_100355822 | 305 |
| 222 | 3300025914 | Ga0207671_10054885 | Ga0207671_100548853 | 305 |
| 223 | 3300025915 | Ga0207693_10015043 | Ga0207693_100150436 | 305 |
| 224 | 3300025916 | Ga0207663_10072660 | Ga0207663_100726602 | 305 |
| 225 | 3300025918 | Ga0207662_10019164 | Ga0207662_100191643 | 305 |
| 226 | 3300025920 | Ga0207649_10228868 | Ga0207649_102288682 | 305 |
| 227 | 3300025923 | Ga0207681_10071700 | Ga0207681_100717003 | 305 |
| 228 | 3300025923 | Ga0207681_10094310 | Ga0207681_100943102 | 305 |
| 229 | 3300025923 | Ga0207681_10155730 | Ga0207681_101557302 | 305 |
| 230 | 3300025924 | Ga0207694_10016032 | Ga0207694_100160321 | 305 |
| 231 | 3300025925 | Ga0207650_10049292 | Ga0207650_100492922 | 305 |
| 232 | 3300025926 | Ga0207659_10159436 | Ga0207659_101594362 | 305 |
| 233 | 3300025928 | Ga0207700_10092527 | Ga0207700_100925271 | 305 |
| 234 | 3300025931 | Ga0207644_10037060 | Ga0207644_100370602 | 305 |
| 235 | 3300025931 | Ga0207644_10195206 | Ga0207644_101952062 | 305 |
| 236 | 3300025933 | Ga0207706_10001347 | Ga0207706_100013474 | 305 |
| 237 | 3300025935 | Ga0207709_10100661 | Ga0207709_101006612 | 305 |
| 238 | 3300025935 | Ga0207709_10119636 | Ga0207709_101196362 | 305 |
| 239 | 3300025936 | Ga0207670_10004352 | Ga0207670_100043524 | 305 |
| 240 | 3300025936 | Ga0207670_10077094 | Ga0207670_100770942 | 305 |
| 241 | 3300025937 | Ga0207669_10006458 | Ga0207669_100064585 | 305 |
| 242 | 3300025937 | Ga0207669_10135995 | Ga0207669_101359952 | 305 |
| 243 | 3300025938 | Ga0207704_10080186 | Ga0207704_100801862 | 305 |
| 244 | 3300025940 | Ga0207691_10009785 | Ga0207691_100097858 | 305 |
| 245 | 3300025940 | Ga0207691_10066452 | Ga0207691_100664523 | 305 |
| 246 | 3300025942 | Ga0207689_10012534 | Ga0207689_100125343 | 305 |
| 247 | 3300025942 | Ga0207689_10050979 | Ga0207689_100509792 | 305 |
| 248 | 3300025944 | Ga0207661_10063155 | Ga0207661_100631551 | 305 |
| 249 | 3300025944 | Ga0207661_10079863 | Ga0207661_100798631 | 305 |
| 250 | 3300025945 | Ga0207679_10309721 | Ga0207679_103097212 | 305 |
| 251 | 3300025961 | Ga0207712_10018611 | Ga0207712_100186115 | 305 |
| 252 | 3300025981 | Ga0207640_10036325 | Ga0207640_100363252 | 305 |
| 253 | 3300025986 | Ga0207658_10168807 | Ga0207658_101688072 | 305 |
| 254 | 3300025986 | Ga0207658_10334561 | Ga0207658_103345612 | 305 |
| 255 | 3300026023 | Ga0207677_10005750 | Ga0207677_100057502 | 305 |
| 256 | 3300026023 | Ga0207677_10054738 | Ga0207677_100547383 | 305 |
| 257 | 3300026035 | Ga0207703_10011709 | Ga0207703_100117092 | 305 |
| 258 | 3300026041 | Ga0207639_10080993 | Ga0207639_100809932 | 305 |
| 259 | 3300026067 | Ga0207678_10006591 | Ga0207678_1000659110 | 305 |
| 260 | 3300026075 | Ga0207708_10002253 | Ga0207708_100022536 | 305 |
| 261 | 3300026089 | Ga0207648_10002628 | Ga0207648_1000262810 | 305 |
| 262 | 3300026089 | Ga0207648_10008182 | Ga0207648_1000818211 | 305 |
| 263 | 3300026095 | Ga0207676_10004546 | Ga0207676_100045469 | 305 |
| 264 | 3300026095 | Ga0207676_10046067 | Ga0207676_100460673 | 305 |
| 265 | 3300026116 | Ga0207674_10117901 | Ga0207674_101179012 | 305 |
| 266 | 3300026118 | Ga0207675_100008496 | Ga0207675_1000084969 | 305 |
| 267 | 3300026118 | Ga0207675_100385503 | Ga0207675_1003855031 | 305 |
| 268 | 3300026121 | Ga0207683_10014140 | Ga0207683_100141405 | 305 |
| 269 | 3300026121 | Ga0207683_10032942 | Ga0207683_100329422 | 305 |
| 270 | 3300026142 | Ga0207698_10055555 | Ga0207698_100555552 | 305 |
| 271 | 3300027907 | Ga0207428_10001174 | Ga0207428_1000117418 | 305 |
| 272 | 3300028380 | Ga0268265_10140488 | Ga0268265_101404882 | 305 |
| 273 | 3300028381 | Ga0268264_10016501 | Ga0268264_100165012 | 305 |
| 274 | 3300028556 | Ga0265337_1009821 | Ga0265337_10098213 | 305 |
| 275 | 3300028577 | Ga0265318_10016375 | Ga0265318_100163753 | 305 |
| 276 | 3300028800 | Ga0265338_10319330 | Ga0265338_103193301 | 305 |
| 277 | 3300031235 | Ga0265330_10046183 | Ga0265330_100461832 | 305 |
| 278 | 3300031238 | Ga0265332_10015959 | Ga0265332_100159593 | 305 |
| 279 | 3300031238 | Ga0265332_10052195 | Ga0265332_100521952 | 305 |
| 280 | 3300031239 | Ga0265328_10052900 | Ga0265328_100529002 | 305 |
| 281 | 3300031240 | Ga0265320_10010340 | Ga0265320_100103403 | 305 |
| 282 | 3300031241 | Ga0265325_10037631 | Ga0265325_100376313 | 305 |
| 283 | 3300031242 | Ga0265329_10003528 | Ga0265329_100035287 | 305 |
| 284 | 3300031247 | Ga0265340_10020915 | Ga0265340_100209153 | 305 |
| 285 | 3300031249 | Ga0265339_10020861 | Ga0265339_100208612 | 305 |
| 286 | 3300031249 | Ga0265339_10051243 | Ga0265339_100512431 | 305 |
| 287 | 3300031250 | Ga0265331_10026505 | Ga0265331_100265052 | 305 |
| 288 | 3300031344 | Ga0265316_10042236 | Ga0265316_100422362 | 305 |
| 289 | 3300031344 | Ga0265316_10194727 | Ga0265316_101947271 | 305 |
| 290 | 3300031711 | Ga0265314_10044156 | Ga0265314_100441563 | 305 |
| 291 | 3300031711 | Ga0265314_10072158 | Ga0265314_100721582 | 305 |
| 292 | 3300031712 | Ga0265342_10007165 | Ga0265342_100071658 | 305 |
| 293 | 3300031712 | Ga0265342_10020619 | Ga0265342_100206192 | 305 |
| 294 | 3300035112 | Ga0373932_0037922 | Ga0373932_0037922_400_1317 | 305 |
| 295 | 3300035119 | Ga0373956_0059307 | Ga0373956_0059307_363_1286 | 305 |
| 296 | 3300035170 | Ga0373943_0019299 | Ga0373943_0019299_1329_2249 | 305 |
| 297 | 3300035410 | Ga0373924_0066533 | Ga0373924_0066533_85_1008 | 305 |
| 298 | 3300035691 | Ga0373931_0003919 | Ga0373931_0003919_3321_4238 | 305 |
| 299 | 3300035692 | Ga0373935_0025841 | Ga0373935_0025841_584_1507 | 305 |
| 300 | 3300035724 | Ga0373933_0147001 | Ga0373933_0147001_260_1210 | 305 |
| 301 | 3300036401 | Ga0373937_0040421 | Ga0373937_0040421_2432_3355 | 305 |
| 302 | 3300037068 | Ga0373925_0166898 | Ga0373925_0166898_787_1707 | 305 |
| 303 | 3300037068 | Ga0373925_0235041 | Ga0373925_0235041_136_1053 | 305 |
| 304 | 3300039437 | Ga0436365_1280755 | Ga0436365_1280755_3735_4679 | 305 |
| 305 | 3300046455 | Ga0495603_0038922 | Ga0495603_0038922_1198_2121 | 305 |
| 306 | 3300046455 | Ga0495603_0082992 | Ga0495603_0082992_881_1798 | 305 |
| 307 | 3300046461 | Ga0495641_0031797 | Ga0495641_0031797_447_1370 | 305 |
| 308 | 3300046475 | Ga0495639_0003763 | Ga0495639_0003763_363_1286 | 305 |
| 309 | 3300046492 | Ga0495585_0019393 | Ga0495585_0019393_949_1872 | 305 |
| 310 | 3300046499 | Ga0495594_0137821 | Ga0495594_0137821_26_949 | 305 |
| 311 | 3300046499 | Ga0495594_0245068 | Ga0495594_0245068_36_953 | 305 |
| 312 | 3300046511 | Ga0495608_0163389 | Ga0495608_0163389_160_1083 | 305 |
| 313 | 3300046516 | Ga0495628_0105780 | Ga0495628_0105780_405_1322 | 305 |
| 314 | 3300046523 | Ga0495644_0048161 | Ga0495644_0048161_662_1585 | 305 |
| 315 | 3300046536 | Ga0495587_0179594 | Ga0495587_0179594_234_1157 | 305 |
| 316 | 3300046537 | Ga0495598_0004132 | Ga0495598_0004132_1501_2424 | 305 |
| 317 | 3300046537 | Ga0495598_0020105 | Ga0495598_0020105_266_1222 | 305 |
| 318 | 3300046616 | Ga0495668_0100913 | Ga0495668_0100913_562_1479 | 305 |
| 319 | 3300046648 | Ga0495611_0044260 | Ga0495611_0044260_1022_1945 | 305 |
| 320 | 3300046663 | Ga0495635_0086760 | Ga0495635_0086760_18_941 | 305 |
| 321 | 3300046674 | Ga0495588_0095200 | Ga0495588_0095200_558_1481 | 305 |
| 322 | 3300046675 | Ga0495657_0007808 | Ga0495657_0007808_274_1197 | 305 |
| 323 | 3300046681 | Ga0495647_0026470 | Ga0495647_0026470_973_1896 | 305 |
| 324 | 3300046681 | Ga0495647_0061745 | Ga0495647_0061745_318_1235 | 305 |
| 325 | 3300046683 | Ga0495658_0010422 | Ga0495658_0010422_3046_3963 | 305 |
| 326 | 3300046691 | Ga0495670_0027075 | Ga0495670_0027075_839_1762 | 305 |
| 327 | 3300046794 | Ga0495589_0088602 | Ga0495589_0088602_130_1047 | 305 |
| 328 | 3300046809 | Ga0495600_0079908 | Ga0495600_0079908_1147_2070 | 305 |
| 329 | 3300047320 | Ga0495672_0071736 | Ga0495672_0071736_875_1819 | 305 |
| 330 | 3300047322 | Ga0495680_0097153 | Ga0495680_0097153_245_1168 | 305 |
| 331 | 3300048088 | Ga0495602_0127542 | Ga0495602_0127542_334_1257 | 305 |
| 332 | 3300048090 | Ga0495615_0008654 | Ga0495615_0008654_839_1783 | 305 |
| 333 | 3300048903 | Ga0496100_0002484 | Ga0496100_0002484_4939_5856 | 305 |
| 334 | 3300048904 | Ga0496101_0031700 | Ga0496101_0031700_2466_3383 | 305 |
| 335 | 3300048905 | Ga0496102_0013610 | Ga0496102_0013610_4174_5091 | 305 |
| 336 | 3300048906 | Ga0496103_0014305 | Ga0496103_0014305_1978_2895 | 305 |
| 337 | 3300048907 | Ga0496104_0035510 | Ga0496104_0035510_326_1243 | 305 |
| 338 | 3300048908 | Ga0496105_0001765 | Ga0496105_0001765_12248_13165 | 305 |
| 339 | 3300048909 | Ga0496106_0002523 | Ga0496106_0002523_11006_11923 | 305 |
| 340 | 3300048910 | Ga0496107_0018211 | Ga0496107_0018211_2223_3140 | 305 |
| 341 | 3300048911 | Ga0496108_0075842 | Ga0496108_0075842_1051_1968 | 305 |
| 342 | 3300048913 | Ga0496110_0124981 | Ga0496110_0124981_596_1513 | 305 |
| 343 | 3300048914 | Ga0496111_0003593 | Ga0496111_0003593_1872_2789 | 305 |
| 344 | 3300048915 | Ga0496112_0372687 | Ga0496112_0372687_36_980 | 305 |
| 345 | 3300048916 | Ga0496113_0070925 | Ga0496113_0070925_1570_2487 | 305 |
| 346 | 3300048917 | Ga0496114_0009703 | Ga0496114_0009703_6656_7573 | 305 |
| 347 | 3300048918 | Ga0496115_0017376 | Ga0496115_0017376_1960_2877 | 305 |
| 348 | 3300049568 | Ga0501031_0152642 | Ga0501031_0152642_146_1069 | 305 |
| 349 | 3300049571 | Ga0501034_0031387 | Ga0501034_0031387_168_1088 | 305 |
| 350 | 3300049573 | Ga0501037_0175401 | Ga0501037_0175401_364_1287 | 305 |
| 351 | 3300049575 | Ga0501039_0059212 | Ga0501039_0059212_902_1825 | 305 |
| 352 | 3300049579 | Ga0501043_0105838 | Ga0501043_0105838_345_1265 | 305 |
| 353 | 3300049581 | Ga0501047_0036138 | Ga0501047_0036138_1306_2229 | 305 |
| 354 | 3300049581 | Ga0501047_0245613 | Ga0501047_0245613_161_1084 | 305 |
| 355 | 3300049586 | Ga0501070_0298588 | Ga0501070_0298588_325_1248 | 305 |
| 356 | 3300049588 | Ga0501072_0002307 | Ga0501072_0002307_9687_10628 | 305 |
| 357 | 3300049589 | Ga0501073_0026086 | Ga0501073_0026086_1427_2350 | 305 |
| 358 | 3300049590 | Ga0501074_0072820 | Ga0501074_0072820_1169_2092 | 305 |
| 359 | 3300049592 | Ga0501076_0217936 | Ga0501076_0217936_295_1212 | 305 |
| 360 | 3300049744 | Ga0501083_0025154 | Ga0501083_0025154_2158_3081 | 305 |
| 361 | 3300049823 | Ga0501044_0166124 | Ga0501044_0166124_772_1695 | 305 |
| 362 | 3300050489 | nmdc:mga03683_20796_c1 | nmdc:mga03683_20796_c1_1103_2125 | 305 |
| 363 | 3300050491 | nmdc:mga00v17_14126_c1 | nmdc:mga00v17_14126_c1_826_1848 | 305 |
| 364 | 3300050491 | nmdc:mga00v17_79615_c1 | nmdc:mga00v17_79615_c1_96_1019 | 305 |
| 365 | 3300050492 | nmdc:mga0yw44_121816_c1 | nmdc:mga0yw44_121816_c1_49_966 | 305 |
| 366 | 3300050492 | nmdc:mga0yw44_29198_c1 | nmdc:mga0yw44_29198_c1_1101_2018 | 305 |
| 367 | 3300050493 | nmdc:mga0k408_110262_c1 | nmdc:mga0k408_110262_c1_284_1207 | 305 |
| 368 | 3300050493 | nmdc:mga0k408_6600_c1 | nmdc:mga0k408_6600_c1_1158_2180 | 305 |
| 369 | 3300050494 | nmdc:mga06z11_229058_c1 | nmdc:mga06z11_229058_c1_84_1001 | 305 |
| 370 | 3300050494 | nmdc:mga06z11_37888_c1 | nmdc:mga06z11_37888_c1_859_1782 | 305 |
| 371 | 3300050494 | nmdc:mga06z11_75461_c1 | nmdc:mga06z11_75461_c1_658_1623 | 305 |
| 372 | 3300050495 | nmdc:mga04h51_22707_c1 | nmdc:mga04h51_22707_c1_401_1324 | 305 |
| 373 | 3300050495 | nmdc:mga04h51_59567_c1 | nmdc:mga04h51_59567_c1_86_1003 | 305 |
| 374 | 3300050496 | nmdc:mga07m45_117838_c1 | nmdc:mga07m45_117838_c1_349_1272 | 305 |
| 375 | 3300050507 | nmdc:mga05p37_3054_c1 | nmdc:mga05p37_3054_c1_10218_11138 | 305 |
| 376 | 3300050507 | nmdc:mga05p37_8361_c1 | nmdc:mga05p37_8361_c1_3629_4549 | 305 |
| 377 | 3300050508 | nmdc:mga09592_6472_c1 | nmdc:mga09592_6472_c1_733_1653 | 305 |
| 378 | 3300050509 | nmdc:mga0qj67_808_c1 | nmdc:mga0qj67_808_c1_6574_7494 | 305 |
| 379 | 3300050510 | nmdc:mga06r32_2114_c1 | nmdc:mga06r32_2114_c1_10206_11126 | 305 |
| 380 | 3300050511 | nmdc:mga08y16_113831_c1 | nmdc:mga08y16_113831_c1_1378_2295 | 305 |
| 381 | 3300050511 | nmdc:mga08y16_7095_c1 | nmdc:mga08y16_7095_c1_10108_11028 | 305 |
| 382 | 3300050512 | nmdc:mga0n895_14097_c1 | nmdc:mga0n895_14097_c1_5528_6448 | 305 |
| 383 | 3300050512 | nmdc:mga0n895_3287_c1 | nmdc:mga0n895_3287_c1_1533_2453 | 305 |
| 384 | 3300050513 | nmdc:mga0rr50_393783_c1 | nmdc:mga0rr50_393783_c1_192_1109 | 305 |
| 385 | 3300050513 | nmdc:mga0rr50_411688_c1 | nmdc:mga0rr50_411688_c1_33_950 | 305 |
| 386 | 3300050513 | nmdc:mga0rr50_93186_c1 | nmdc:mga0rr50_93186_c1_185_1105 | 305 |
| 387 | 3300050515 | nmdc:mga0a205_104803_c1 | nmdc:mga0a205_104803_c1_1350_2270 | 305 |
| 388 | 3300050515 | nmdc:mga0a205_125151_c1 | nmdc:mga0a205_125151_c1_1364_2329 | 305 |
| 389 | 3300050515 | nmdc:mga0a205_1618_c1 | nmdc:mga0a205_1618_c1_10108_11028 | 305 |
| 390 | 3300050516 | nmdc:mga0sz30_108927_c1 | nmdc:mga0sz30_108927_c1_274_1191 | 305 |
| 391 | 3300050516 | nmdc:mga0sz30_148634_c1 | nmdc:mga0sz30_148634_c1_60_983 | 305 |
| 392 | 3300053077 | Ga0495601_0008111 | Ga0495601_0008111_1233_2156 | 305 |
| 393 | 3300053077 | Ga0495601_0024924 | Ga0495601_0024924_268_1185 | 305 |
| 394 | 3300053084 | Ga0495595_0000702 | Ga0495595_0000702_382_1305 | 305 |
| 395 | 3300053085 | Ga0495619_0037474 | Ga0495619_0037474_1543_2466 | 305 |
| 396 | 3300053096 | Ga0500641_0004563 | Ga0500641_0004563_1373_2380 | 305 |
| 397 | 3300053096 | Ga0500641_0040193 | Ga0500641_0040193_78_1070 | 305 |
| 398 | 3300053130 | Ga0500642_0041124 | Ga0500642_0041124_48_1055 | 305 |
| 399 | 3300060353 | Ga0501082_0001121 | Ga0501082_0001121_20419_21429 | 305 |
| 400 | 3300060353 | Ga0501082_0105269 | Ga0501082_0105269_747_1670 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tfq-assembly1.cif.gz_A | crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis | 0.9357 | 57 | 289 |
| 6d0p-assembly4.cif.gz_D | 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii | 0.9308 | 68 | 291 |
| 5jct-assembly1.cif.gz_A | crystal structure of human pirin in complex with a chemical probe pyrrolidine 24 | 0.9194 | 60 | 287 |
| 4hlt-assembly1.cif.gz_A | crystal structure of ferric e32v pirin | 0.918 | 60 | 287 |
| 2p17-assembly1.cif.gz_A | crystal structure of gk1651 from geobacillus kaustophilus | 0.8778 | 60 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5M827_137_273_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9224 | 158 | 285 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.92 | 68 | 152 | 2.60.120.10 |
| af_C0P2Q1_61_325_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.92 | 60 | 286 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.911 | 60 | 155 | 2.60.120.10 |
| af_Q9D711_137_245_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9102 | 158 | 258 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N7XTZ3-F1-model_v4 | Pirin N-terminal domain-containing protein | 0.9876 | 69 | 162 |
|
| AF-A0A259BH78-F1-model_v4 | Pirin C-terminal domain-containing protein | 0.9825 | 137 | 304 |
|
| AF-A0A2P5LPF2-F1-model_v4 | Pirin family protein | 0.9824 | 84 | 304 |
|
| AF-A0A0H1R615-F1-model_v4 | Pirin | 0.9788 | 93 | 303 |
|
| AF-A0A6P0DSX5-F1-model_v4 | Pirin family protein | 0.9783 | 169 | 288 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar