F434670

General Info

Members Datasets Scaffolds Average Seq Length
400 292 397 308

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0048138|Ga0495684_0048138_465_1436
Length 323
Sequence MSSQSTGTPAQAEPSSGVELVLLPRAHDLGGFEVRRALPAKERQMIGPFIFFDQMGPGEFLAGRGLDVRPHPHIGLSTVTYLFDGEIMHRDSLGSHQSIVPGDVNWMTAGRGIAHSERTDQTLRANRNRLFGIQSWVALPKMAEETAPGFVHHPAASLPLVEDAGVRLRLIAGTGWGLTAPVTIASSLFYADALLAPDAVLQMPDGHEERAAYVVAGEVDVAGDRFEPGRMLIFRPKDHPVLRSGPQGARVLLLGGAVMDGPRYLFWNFVSSSRERIEQAKADWKAGRFAKVPDDDVEFIPLPEERAPAQADGQQVSKGSPTS

Samples

Sample ID Description Type Environment
1 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
291 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.25
Nodule 0
Rhizoplane 3.75
Rhizosphere 86
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000990 3300001977 Bacteria 4463
2 JGI24737J22298_10016345 3300001990 Bacteria 2396
3 JGI24750J21931_1001457 3300002070 Bacteria 2947
4 JGI24738J21930_10018916 3300002075 Bacteria 1439
5 JGI24744J21845_10000413 3300002077 Bacteria 7434
6 JGI24742J22300_10000805 3300002244 Bacteria 4775
7 JGI24751J29686_10020193 3300002459 Bacteria 1379
8 JGI25406J46586_10000621 3300003203 Bacteria 16616
9 JGI25405J52794_10007240 3300003911 Bacteria 2044
10 Ga0070683_100102104 3300005329 Bacteria 2701
11 Ga0070690_100068791 3300005330 Bacteria 2297
12 Ga0068869_100040563 3300005334 Bacteria 3329
13 Ga0070666_10018911 3300005335 Bacteria 4439
14 Ga0070682_100025802 3300005337 Bacteria 3510
15 Ga0068868_100039788 3300005338 Bacteria 3655
16 Ga0070660_100027790 3300005339 Bacteria 4226
17 Ga0070668_100097567 3300005347 Bacteria 2324
18 Ga0070669_100051774 3300005353 Bacteria 3002
19 Ga0070669_100096477 3300005353 Bacteria 2224
20 Ga0070675_100037573 3300005354 Bacteria 3945
21 Ga0070671_100018449 3300005355 Bacteria 5667
22 Ga0070674_100095112 3300005356 Bacteria 2159
23 Ga0070673_100030123 3300005364 Bacteria 4055
24 Ga0070667_100144323 3300005367 Bacteria 2087
25 Ga0070667_100282563 3300005367 Bacteria 1490
26 Ga0070713_100238033 3300005436 Bacteria 1657
27 Ga0070710_10047429 3300005437 Bacteria 2396
28 Ga0070705_100034600 3300005440 Bacteria 2825
29 Ga0070678_100030353 3300005456 Bacteria 3715
30 Ga0070678_100163596 3300005456 Bacteria 1805
31 Ga0070662_100006202 3300005457 Bacteria 7699
32 Ga0070681_10036297 3300005458 Bacteria 4949
33 Ga0068867_100025735 3300005459 Bacteria 4223
34 Ga0068867_100393628 3300005459 Bacteria 1167
35 Ga0070698_100106717 3300005471 Bacteria 2769
36 Ga0070699_100001443 3300005518 Bacteria 21833
37 Ga0070679_100091736 3300005530 Bacteria 3025
38 Ga0070697_100141268 3300005536 Bacteria 2025
39 Ga0068853_100157808 3300005539 Bacteria 2045
40 Ga0070672_100040448 3300005543 Bacteria 3577
41 Ga0070672_100177736 3300005543 Bacteria 1772
42 Ga0070665_100195512 3300005548 Bacteria 2023
43 Ga0070704_100180804 3300005549 Bacteria 1686
44 Ga0070664_100095944 3300005564 Bacteria 2573
45 Ga0068857_100134794 3300005577 Bacteria 2229
46 Ga0068856_100050165 3300005614 Bacteria 4114
47 Ga0070702_100011224 3300005615 Bacteria 4449
48 Ga0070702_100177455 3300005615 Bacteria 1391
49 Ga0068859_100006960 3300005617 Bacteria 11481
50 Ga0068859_100247567 3300005617 Bacteria 1872
51 Ga0068864_100035728 3300005618 Bacteria 4232
52 Ga0068864_100062494 3300005618 Bacteria 3226
53 Ga0068866_10020641 3300005718 Bacteria 3021
54 Ga0068870_10006575 3300005840 Bacteria 5133
55 Ga0068858_100023619 3300005842 Bacteria 5728
56 Ga0068860_100029725 3300005843 Bacteria 5257
57 Ga0068862_100077460 3300005844 Bacteria 2879
58 Ga0068862_100254988 3300005844 Bacteria 1600
59 Ga0081455_10000009 3300005937 Bacteria 249885
60 Ga0081455_10008013 3300005937 Bacteria 11038
61 Ga0081455_10080273 3300005937 Bacteria 2675
62 Ga0081455_10110096 3300005937 Bacteria 2190
63 Ga0081538_10007153 3300005981 Bacteria 9690
64 Ga0081540_1007786 3300005983 Bacteria 7582
65 Ga0081539_10000932 3300005985 Bacteria 54871
66 Ga0081539_10110185 3300005985 Bacteria 1387
67 Ga0070717_10011936 3300006028 Bacteria 6610
68 Ga0075363_100015293 3300006048 Bacteria 3770
69 Ga0075363_100045654 3300006048 Bacteria 2324
70 Ga0075363_100049548 3300006048 Bacteria 2237
71 Ga0075364_10013177 3300006051 Bacteria 5075
72 Ga0075364_10055758 3300006051 Bacteria 2586
73 Ga0075432_10003653 3300006058 Bacteria 5238
74 Ga0070716_100051506 3300006173 Bacteria 2340
75 Ga0070712_100009461 3300006175 Bacteria 6140
76 Ga0075362_10013026 3300006177 Bacteria 3318
77 Ga0075367_10074785 3300006178 Bacteria 2043
78 Ga0075367_10099521 3300006178 Bacteria 1776
79 Ga0075366_10007706 3300006195 Bacteria 5963
80 Ga0075366_10185565 3300006195 Bacteria 1264
81 Ga0097621_100058727 3300006237 Bacteria 3148
82 Ga0075428_100003428 3300006844 Bacteria 17351
83 Ga0075430_100000944 3300006846 Bacteria 22830
84 Ga0075431_100001444 3300006847 Bacteria 21893
85 Ga0075433_10003897 3300006852 Bacteria 11550
86 Ga0075433_10046895 3300006852 Bacteria 3758
87 Ga0075434_100001449 3300006871 Bacteria 19940
88 Ga0075434_100015567 3300006871 Bacteria 7299
89 Ga0075429_100003813 3300006880 Bacteria 12865
90 Ga0068865_100046455 3300006881 Bacteria 2979
91 Ga0075436_100016743 3300006914 Bacteria 5017
92 Ga0097620_100006960 3300006931 Bacteria 11481
93 Ga0097620_100247547 3300006931 Bacteria 1872
94 Ga0075435_100029818 3300007076 Bacteria 4285
95 Ga0111539_10004776 3300009094 Bacteria 17692
96 Ga0111539_10023436 3300009094 Bacteria 7585
97 Ga0111539_10412474 3300009094 Bacteria 1573
98 Ga0111539_10689240 3300009094 Bacteria 1189
99 Ga0105245_10051259 3300009098 Bacteria 3700
100 Ga0105245_10165185 3300009098 Bacteria 2104
101 Ga0105245_10403178 3300009098 Bacteria 1367
102 Ga0105247_10065518 3300009101 Bacteria 2260
103 Ga0114129_10005429 3300009147 Bacteria 18008
104 Ga0114129_10009614 3300009147 Bacteria 13791
105 Ga0114129_10631522 3300009147 Bacteria 1384
106 Ga0105243_10040251 3300009148 Bacteria 3648
107 Ga0105243_10102624 3300009148 Bacteria 2377
108 Ga0105243_10115920 3300009148 Bacteria 2250
109 Ga0105242_10038151 3300009176 Bacteria 3862
110 Ga0105248_10019452 3300009177 Bacteria 7513
111 Ga0105238_10019837 3300009551 Bacteria 6843
112 Ga0099796_10006133 3300010159 Bacteria 3057
113 Ga0105239_10114314 3300010375 Bacteria 2994
114 Ga0105246_10036985 3300011119 Bacteria 3274
115 Ga0105246_10214066 3300011119 Bacteria 1506
116 Ga0157370_10065145 3300013104 Bacteria 3448
117 Ga0157370_10089248 3300013104 Bacteria 2896
118 Ga0157374_10011104 3300013296 Bacteria 7785
119 Ga0157378_10106095 3300013297 Bacteria 2570
120 Ga0157378_10117714 3300013297 Bacteria 2444
121 Ga0157378_10280156 3300013297 Bacteria 1607
122 Ga0163162_10060832 3300013306 Bacteria 3813
123 Ga0157380_10130530 3300014326 Bacteria 2143
124 Ga0157380_10405305 3300014326 Bacteria 1295
125 Ga0182008_10079540 3300014497 Bacteria 1613
126 Ga0157379_10344980 3300014968 Bacteria 1362
127 Ga0157376_10040115 3300014969 Bacteria 3824
128 Ga0182007_10040468 3300015262 Bacteria 1556
129 Ga0163161_10032369 3300017792 Bacteria 3732
130 Ga0163161_10121036 3300017792 Bacteria 1967
131 Ga0213872_10082669 3300021361 Bacteria 1442
132 Ga0213874_10012772 3300021377 Bacteria 2161
133 Ga0213876_10023762 3300021384 Bacteria 3236
134 Ga0213876_10102964 3300021384 Bacteria 1514
135 Ga0213875_10000053 3300021388 Bacteria 141791
136 Ga0209233_1013549 3300025261 Bacteria 2326
137 Ga0207656_10080328 3300025321 Bacteria 1464
138 Ga0207682_10003098 3300025893 Bacteria 7284
139 Ga0207692_10056077 3300025898 Bacteria 2020
140 Ga0207710_10044455 3300025900 Bacteria 1978
141 Ga0207688_10002341 3300025901 Bacteria 10178
142 Ga0207647_10005289 3300025904 Bacteria 9490
143 Ga0207699_10037069 3300025906 Bacteria 2785
144 Ga0207643_10000892 3300025908 Bacteria 17974
145 Ga0207643_10035582 3300025908 Bacteria 2792
146 Ga0207695_10320873 3300025913 Bacteria 1438
147 Ga0207671_10054885 3300025914 Bacteria 2951
148 Ga0207693_10015043 3300025915 Bacteria 6211
149 Ga0207663_10072660 3300025916 Bacteria 2224
150 Ga0207662_10019164 3300025918 Bacteria 3890
151 Ga0207649_10228868 3300025920 Bacteria 1328
152 Ga0207681_10071700 3300025923 Bacteria 2417
153 Ga0207681_10094310 3300025923 Bacteria 2144
154 Ga0207681_10155730 3300025923 Bacteria 1717
155 Ga0207694_10016032 3300025924 Bacteria 5653
156 Ga0207650_10049292 3300025925 Bacteria 3109
157 Ga0207650_10190286 3300025925 Bacteria 1639
158 Ga0207659_10159436 3300025926 Bacteria 1770
159 Ga0207700_10092527 3300025928 Bacteria 2391
160 Ga0207644_10037060 3300025931 Bacteria 3428
161 Ga0207644_10195206 3300025931 Bacteria 1594
162 Ga0207706_10001347 3300025933 Bacteria 24537
163 Ga0207706_10154953 3300025933 Bacteria 2015
164 Ga0207709_10100661 3300025935 Bacteria 1910
165 Ga0207709_10119636 3300025935 Bacteria 1776
166 Ga0207670_10004352 3300025936 Bacteria 7611
167 Ga0207670_10077094 3300025936 Bacteria 2321
168 Ga0207669_10006458 3300025937 Bacteria 5360
169 Ga0207669_10135995 3300025937 Bacteria 1697
170 Ga0207704_10080186 3300025938 Bacteria 2106
171 Ga0207691_10009785 3300025940 Bacteria 9203
172 Ga0207691_10066452 3300025940 Bacteria 3262
173 Ga0207689_10012534 3300025942 Bacteria 7242
174 Ga0207689_10050979 3300025942 Bacteria 3411
175 Ga0207661_10063155 3300025944 Bacteria 2999
176 Ga0207661_10079863 3300025944 Bacteria 2697
177 Ga0207679_10309721 3300025945 Bacteria 1364
178 Ga0207712_10018611 3300025961 Bacteria 4527
179 Ga0207640_10036325 3300025981 Bacteria 3092
180 Ga0207658_10168807 3300025986 Bacteria 1800
181 Ga0207658_10334561 3300025986 Bacteria 1314
182 Ga0207677_10005750 3300026023 Bacteria 6747
183 Ga0207677_10054738 3300026023 Bacteria 2725
184 Ga0207703_10011709 3300026035 Bacteria 6825
185 Ga0207639_10080993 3300026041 Bacteria 2570
186 Ga0207639_10131445 3300026041 Bacteria 2073
187 Ga0207678_10006591 3300026067 Bacteria 10298
188 Ga0207708_10002253 3300026075 Bacteria 14200
189 Ga0207648_10002628 3300026089 Bacteria 19224
190 Ga0207648_10008182 3300026089 Bacteria 10165
191 Ga0207676_10004546 3300026095 Bacteria 9820
192 Ga0207676_10046067 3300026095 Bacteria 3372
193 Ga0207674_10117901 3300026116 Bacteria 2625
194 Ga0207675_100008496 3300026118 Bacteria 9667
195 Ga0207675_100385503 3300026118 Bacteria 1379
196 Ga0207683_10014140 3300026121 Bacteria 6800
197 Ga0207683_10032942 3300026121 Bacteria 4501
198 Ga0207698_10055555 3300026142 Bacteria 3052
199 Ga0207428_10001174 3300027907 Bacteria 28208
200 Ga0268265_10140488 3300028380 Bacteria 2021
201 Ga0268264_10016501 3300028381 Bacteria 6046
202 Ga0265337_1009821 3300028556 Bacteria 3391
203 Ga0265318_10016375 3300028577 Bacteria 3063
204 Ga0265338_10319330 3300028800 Bacteria 1124
205 Ga0265330_10046183 3300031235 Bacteria 1919
206 Ga0265332_10015959 3300031238 Bacteria 3315
207 Ga0265332_10052195 3300031238 Bacteria 1756
208 Ga0265328_10052900 3300031239 Bacteria 1490
209 Ga0265320_10010340 3300031240 Bacteria 5562
210 Ga0265325_10037631 3300031241 Bacteria 2557
211 Ga0265329_10003528 3300031242 Bacteria 6777
212 Ga0265340_10020915 3300031247 Bacteria 3356
213 Ga0265339_10020861 3300031249 Bacteria 3823
214 Ga0265339_10051243 3300031249 Bacteria 2253
215 Ga0265331_10026505 3300031250 Bacteria 2912
216 Ga0265316_10042236 3300031344 Bacteria 3645
217 Ga0265316_10194727 3300031344 Bacteria 1504
218 Ga0265314_10044156 3300031711 Bacteria 3161
219 Ga0265314_10072158 3300031711 Bacteria 2307
220 Ga0265342_10007165 3300031712 Bacteria 8208
221 Ga0265342_10020619 3300031712 Bacteria 4223
222 Ga0307510_10128548 3300033180 Bacteria 2214
223 Ga0373950_0006104 3300034818 Bacteria 1825
224 Ga0373944_0043698 3300035089 Bacteria 1393
225 Ga0373923_0021811 3300035111 Bacteria 2504
226 Ga0373932_0037922 3300035112 Bacteria 1376
227 Ga0373936_0000140 3300035113 Bacteria 25032
228 Ga0373953_0000297 3300035117 Bacteria 13618
229 Ga0373954_0003422 3300035118 Bacteria 6726
230 Ga0373956_0059307 3300035119 Bacteria 1731
231 Ga0373956_0155795 3300035119 Bacteria 1075
232 Ga0373943_0019299 3300035170 Bacteria 3135
233 Ga0373946_0003338 3300035171 Bacteria 5697
234 Ga0373955_0000121 3300035172 Bacteria 31151
235 Ga0373924_0004545 3300035410 Bacteria 4849
236 Ga0373924_0066533 3300035410 Bacteria 1515
237 Ga0373931_0003919 3300035691 Bacteria 6733
238 Ga0373935_0000739 3300035692 Bacteria 17371
239 Ga0373935_0025841 3300035692 Bacteria 3619
240 Ga0373927_0070375 3300035695 Bacteria 2265
241 Ga0373933_0147001 3300035724 Bacteria 1491
242 Ga0373947_0003026 3300035725 Bacteria 10016
243 Ga0373937_0001392 3300036401 Bacteria 20206
244 Ga0373937_0040421 3300036401 Bacteria 4251
245 Ga0373937_0130482 3300036401 Bacteria 2347
246 Ga0373925_0000016 3300037068 Bacteria 176830
247 Ga0373925_0166898 3300037068 Bacteria 1736
248 Ga0373925_0235041 3300037068 Bacteria 1466
249 Ga0436364_0288952 3300037853 Bacteria 32031
250 Ga0436365_1268301 3300039437 Bacteria 4233
251 Ga0436365_1280755 3300039437 Bacteria 7070
252 Ga0436363_1035413 3300039450 Bacteria 2989
253 Ga0436362_0576845 3300039453 Bacteria 1842
254 Ga0439441_009028 3300042001 Bacteria 1642
255 Ga0466959_0062410 3300045049 Bacteria 2708
256 Ga0495592_0000044 3300046454 Bacteria 118749
257 Ga0495603_0038922 3300046455 Bacteria 2850
258 Ga0495603_0082992 3300046455 Bacteria 1877
259 Ga0495629_0001495 3300046459 Bacteria 18379
260 Ga0495641_0031797 3300046461 Bacteria 2518
261 Ga0495651_0000384 3300046462 Bacteria 34361
262 Ga0495653_0000022 3300046463 Bacteria 169653
263 Ga0495639_0003763 3300046475 Bacteria 6525
264 Ga0495662_0004440 3300046476 Bacteria 7042
265 Ga0495664_0000013 3300046477 Bacteria 204282
266 Ga0495585_0019393 3300046492 Bacteria 3921
267 Ga0495594_0137821 3300046499 Bacteria 1383
268 Ga0495594_0245068 3300046499 Bacteria 1021
269 Ga0495608_0000004 3300046511 Bacteria 355027
270 Ga0495608_0163389 3300046511 Bacteria 1415
271 Ga0495618_0000032 3300046514 Bacteria 104874
272 Ga0495628_0000014 3300046516 Bacteria 205818
273 Ga0495628_0105780 3300046516 Bacteria 2168
274 Ga0495630_0004635 3300046517 Bacteria 9643
275 Ga0495631_0074482 3300046518 Bacteria 1466
276 Ga0495644_0048161 3300046523 Bacteria 1601
277 Ga0495652_0000002 3300046529 Bacteria 946606
278 Ga0495640_0000001 3300046533 Bacteria 853827
279 Ga0495587_0000004 3300046536 Bacteria 358433
280 Ga0495587_0179594 3300046536 Bacteria 1200
281 Ga0495598_0004132 3300046537 Bacteria 3125
282 Ga0495598_0020105 3300046537 Bacteria 1759
283 Ga0495645_0000001 3300046543 Bacteria 657910
284 Ga0495667_0000009 3300046559 Bacteria 223329
285 Ga0495668_0100913 3300046616 Bacteria 1579
286 Ga0495634_0000033 3300046642 Bacteria 109811
287 Ga0495611_0044260 3300046648 Bacteria 1991
288 Ga0495635_0000003 3300046663 Bacteria 390055
289 Ga0495635_0086760 3300046663 Bacteria 2142
290 Ga0495588_0095200 3300046674 Bacteria 1561
291 Ga0495657_0000138 3300046675 Bacteria 65458
292 Ga0495657_0007808 3300046675 Bacteria 8216
293 Ga0495599_0000030 3300046678 Bacteria 113715
294 Ga0495623_0000059 3300046679 Bacteria 67952
295 Ga0495646_0000031 3300046680 Bacteria 87445
296 Ga0495647_0026470 3300046681 Bacteria 2125
297 Ga0495647_0061745 3300046681 Bacteria 1480
298 Ga0495658_0010422 3300046683 Bacteria 4651
299 Ga0495613_0038547 3300046689 Bacteria 3542
300 Ga0495670_0027075 3300046691 Bacteria 2838
301 Ga0495589_0088602 3300046794 Bacteria 1503
302 Ga0495600_0000003 3300046809 Bacteria 180457
303 Ga0495600_0079908 3300046809 Bacteria 2135
304 Ga0495604_0000002 3300047317 Bacteria 530904
305 Ga0495674_0000004 3300047319 Bacteria 531855
306 Ga0495672_0071736 3300047320 Bacteria 1959
307 Ga0495680_0000676 3300047322 Bacteria 38110
308 Ga0495680_0097153 3300047322 Bacteria 2199
309 Ga0495675_0000048 3300047444 Bacteria 81486
310 Ga0495684_0000019 3300047471 Bacteria 153938
311 Ga0495684_0048138 3300047471 Bacteria 3260
312 Ga0495593_0000511 3300047673 Bacteria 21936
313 Ga0495602_0000001 3300048088 Bacteria 510904
314 Ga0495602_0127542 3300048088 Bacteria 2035
315 Ga0495615_0008654 3300048090 Bacteria 1976
316 Ga0496100_0002484 3300048903 Bacteria 9373
317 Ga0496101_0031700 3300048904 Bacteria 3717
318 Ga0496102_0013610 3300048905 Bacteria 7050
319 Ga0496103_0014305 3300048906 Bacteria 4712
320 Ga0496104_0035510 3300048907 Bacteria 4654
321 Ga0496105_0001765 3300048908 Bacteria 15466
322 Ga0496106_0002523 3300048909 Bacteria 13638
323 Ga0496107_0018211 3300048910 Bacteria 4943
324 Ga0496108_0075842 3300048911 Bacteria 2841
325 Ga0496110_0124981 3300048913 Bacteria 2320
326 Ga0496111_0003593 3300048914 Bacteria 9614
327 Ga0496112_0372687 3300048915 Bacteria 1369
328 Ga0496113_0070925 3300048916 Bacteria 2649
329 Ga0496114_0009703 3300048917 Bacteria 7646
330 Ga0496115_0017376 3300048918 Bacteria 5498
331 Ga0501031_0152642 3300049568 Bacteria 1509
332 Ga0501034_0031387 3300049571 Bacteria 5396
333 Ga0501037_0175401 3300049573 Bacteria 1522
334 Ga0501039_0059212 3300049575 Bacteria 2967
335 Ga0501041_0037133 3300049577 Bacteria 2951
336 Ga0501043_0105838 3300049579 Bacteria 2210
337 Ga0501047_0036138 3300049581 Bacteria 4773
338 Ga0501047_0245613 3300049581 Bacteria 1639
339 Ga0501070_0298588 3300049586 Bacteria 1312
340 Ga0501071_0091986 3300049587 Bacteria 2229
341 Ga0501072_0002307 3300049588 Bacteria 14289
342 Ga0501072_0272808 3300049588 Bacteria 1346
343 Ga0501073_0026086 3300049589 Bacteria 4187
344 Ga0501074_0072820 3300049590 Bacteria 2468
345 Ga0501074_0093766 3300049590 Bacteria 2150
346 Ga0501076_0217936 3300049592 Bacteria 1560
347 Ga0501079_0010282 3300049741 Bacteria 7108
348 Ga0501081_0007241 3300049743 Bacteria 7210
349 Ga0501083_0025154 3300049744 Bacteria 4122
350 Ga0501044_0166124 3300049823 Bacteria 2181
351 nmdc:mga03683_20796_c1 3300050489 Bacteria 2523
352 nmdc:mga00v17_14126_c1 3300050491 Bacteria 4451
353 nmdc:mga00v17_79615_c1 3300050491 Bacteria 2044
354 nmdc:mga0yw44_121816_c1 3300050492 Bacteria 1680
355 nmdc:mga0yw44_29198_c1 3300050492 Bacteria 3182
356 nmdc:mga0k408_110262_c1 3300050493 Bacteria 1627
357 nmdc:mga0k408_6600_c1 3300050493 Bacteria 6183
358 nmdc:mga06z11_229058_c1 3300050494 Bacteria 1088
359 nmdc:mga06z11_37888_c1 3300050494 Bacteria 2391
360 nmdc:mga06z11_75461_c1 3300050494 Bacteria 1795
361 nmdc:mga04h51_22707_c1 3300050495 Bacteria 1902
362 nmdc:mga04h51_59567_c1 3300050495 Bacteria 1305
363 nmdc:mga07m45_117838_c1 3300050496 Bacteria 1533
364 nmdc:mga05p37_3054_c1 3300050507 Bacteria 19445
365 nmdc:mga05p37_8361_c1 3300050507 Bacteria 12237
366 nmdc:mga09592_6472_c1 3300050508 Bacteria 9539
367 nmdc:mga0qj67_165983_c1 3300050509 Bacteria 1792
368 nmdc:mga0qj67_808_c1 3300050509 Bacteria 21326
369 nmdc:mga06r32_2114_c1 3300050510 Bacteria 17790
370 nmdc:mga08y16_113831_c1 3300050511 Bacteria 2816
371 nmdc:mga08y16_31039_c1 3300050511 Bacteria 5620
372 nmdc:mga08y16_7095_c1 3300050511 Bacteria 11760
373 nmdc:mga0n895_14097_c1 3300050512 Bacteria 7247
374 nmdc:mga0n895_3287_c1 3300050512 Bacteria 12983
375 nmdc:mga0rr50_393783_c1 3300050513 Bacteria 1169
376 nmdc:mga0rr50_411688_c1 3300050513 Bacteria 1143
377 nmdc:mga0rr50_93186_c1 3300050513 Bacteria 2350
378 nmdc:mga08x19_58625_c1 3300050514 Bacteria 2491
379 nmdc:mga0a205_104803_c1 3300050515 Bacteria 2727
380 nmdc:mga0a205_125151_c1 3300050515 Bacteria 2470
381 nmdc:mga0a205_1618_c1 3300050515 Bacteria 19373
382 nmdc:mga0sz30_108927_c1 3300050516 Bacteria 1213
383 nmdc:mga0sz30_148634_c1 3300050516 Bacteria 1036
384 Ga0495601_0000002 3300053077 Bacteria 528704
385 Ga0495601_0008111 3300053077 Bacteria 6192
386 Ga0495601_0024924 3300053077 Bacteria 3685
387 Ga0495612_0000012 3300053078 Bacteria 223883
388 Ga0495595_0000012 3300053084 Bacteria 174322
389 Ga0495595_0000702 3300053084 Bacteria 12728
390 Ga0495619_0000003 3300053085 Bacteria 515784
391 Ga0495619_0037474 3300053085 Bacteria 3160
392 Ga0500641_0004563 3300053096 Bacteria 4895
393 Ga0500641_0040193 3300053096 Bacteria 1887
394 Ga0500642_0041124 3300053130 Bacteria 1998
395 Ga0501082_0001121 3300060353 Bacteria 23660
396 Ga0501082_0028687 3300060353 Bacteria 4794
397 Ga0501082_0105269 3300060353 Bacteria 2440

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0074482 Ga0495631_0074482_12_845 277
2 3300039450 Ga0436363_1035413 Ga0436363_1035413_1378_2286 286
3 3300034818 Ga0373950_0006104 Ga0373950_0006104_86_955 287
4 iso_pu_bacteria 2597490356 2599105144 295
5 iso_pu_bacteria 2846952575 2846955179 295
6 3300005458 Ga0070681_10036297 Ga0070681_100362972 296
7 3300005530 Ga0070679_100091736 Ga0070679_1000917363 296
8 3300013104 Ga0157370_10089248 Ga0157370_100892483 296
9 3300025913 Ga0207695_10320873 Ga0207695_103208731 296
10 iso_pu_bacteria 2643221547 2643756602 301
11 3300005436 Ga0070713_100238033 Ga0070713_1002380332 303
12 3300021377 Ga0213874_10012772 Ga0213874_100127721 303
13 3300021384 Ga0213876_10102964 Ga0213876_101029641 303
14 3300036401 Ga0373937_0130482 Ga0373937_0130482_1120_2034 303
15 3300039437 Ga0436365_1268301 Ga0436365_1268301_784_1743 303
16 3300039453 Ga0436362_0576845 Ga0436362_0576845_338_1267 303
17 3300047471 Ga0495684_0048138 Ga0495684_0048138_465_1436 303
18 3300005330 Ga0070690_100068791 Ga0070690_1000687913 304
19 3300005457 Ga0070662_100006202 Ga0070662_1000062021 304
20 3300005459 Ga0068867_100393628 Ga0068867_1003936281 304
21 3300005539 Ga0068853_100157808 Ga0068853_1001578082 304
22 3300005981 Ga0081538_10007153 Ga0081538_100071533 304
23 3300006028 Ga0070717_10011936 Ga0070717_100119364 304
24 3300006173 Ga0070716_100051506 Ga0070716_1000515062 304
25 3300006195 Ga0075366_10185565 Ga0075366_101855652 304
26 3300006914 Ga0075436_100016743 Ga0075436_1000167435 304
27 3300009094 Ga0111539_10023436 Ga0111539_100234363 304
28 3300009094 Ga0111539_10689240 Ga0111539_106892402 304
29 3300009148 Ga0105243_10102624 Ga0105243_101026241 304
30 3300010159 Ga0099796_10006133 Ga0099796_100061332 304
31 3300011119 Ga0105246_10214066 Ga0105246_102140662 304
32 3300013297 Ga0157378_10280156 Ga0157378_102801562 304
33 3300014326 Ga0157380_10405305 Ga0157380_104053052 304
34 3300021361 Ga0213872_10082669 Ga0213872_100826692 304
35 3300021388 Ga0213875_10000053 Ga0213875_10000053115 304
36 3300025906 Ga0207699_10037069 Ga0207699_100370693 304
37 3300025925 Ga0207650_10190286 Ga0207650_101902863 304
38 3300025933 Ga0207706_10154953 Ga0207706_101549532 304
39 3300026041 Ga0207639_10131445 Ga0207639_101314452 304
40 3300033180 Ga0307510_10128548 Ga0307510_101285482 304
41 3300035089 Ga0373944_0043698 Ga0373944_0043698_21_935 304
42 3300035111 Ga0373923_0021811 Ga0373923_0021811_693_1607 304
43 3300035113 Ga0373936_0000140 Ga0373936_0000140_18860_19774 304
44 3300035117 Ga0373953_0000297 Ga0373953_0000297_8296_9210 304
45 3300035118 Ga0373954_0003422 Ga0373954_0003422_4418_5332 304
46 3300035119 Ga0373956_0155795 Ga0373956_0155795_13_927 304
47 3300035171 Ga0373946_0003338 Ga0373946_0003338_4061_4975 304
48 3300035172 Ga0373955_0000121 Ga0373955_0000121_22941_23855 304
49 3300035410 Ga0373924_0004545 Ga0373924_0004545_2202_3116 304
50 3300035692 Ga0373935_0000739 Ga0373935_0000739_13376_14290 304
51 3300035695 Ga0373927_0070375 Ga0373927_0070375_1278_2192 304
52 3300035725 Ga0373947_0003026 Ga0373947_0003026_8183_9097 304
53 3300036401 Ga0373937_0001392 Ga0373937_0001392_6841_7755 304
54 3300037068 Ga0373925_0000016 Ga0373925_0000016_90123_91037 304
55 3300037853 Ga0436364_0288952 Ga0436364_0288952_18431_19348 304
56 3300042001 Ga0439441_009028 Ga0439441_009028_310_1287 304
57 3300045049 Ga0466959_0062410 Ga0466959_0062410_1048_1965 304
58 3300046454 Ga0495592_0000044 Ga0495592_0000044_58608_59522 304
59 3300046459 Ga0495629_0001495 Ga0495629_0001495_4102_5016 304
60 3300046462 Ga0495651_0000384 Ga0495651_0000384_25085_25999 304
61 3300046463 Ga0495653_0000022 Ga0495653_0000022_40490_41404 304
62 3300046476 Ga0495662_0004440 Ga0495662_0004440_1879_2793 304
63 3300046477 Ga0495664_0000013 Ga0495664_0000013_149852_150766 304
64 3300046511 Ga0495608_0000004 Ga0495608_0000004_300582_301496 304
65 3300046514 Ga0495618_0000032 Ga0495618_0000032_26919_27833 304
66 3300046516 Ga0495628_0000014 Ga0495628_0000014_55060_55974 304
67 3300046517 Ga0495630_0004635 Ga0495630_0004635_335_1249 304
68 3300046529 Ga0495652_0000002 Ga0495652_0000002_154966_155880 304
69 3300046533 Ga0495640_0000001 Ga0495640_0000001_248970_249884 304
70 3300046536 Ga0495587_0000004 Ga0495587_0000004_304066_304980 304
71 3300046543 Ga0495645_0000001 Ga0495645_0000001_53610_54524 304
72 3300046559 Ga0495667_0000009 Ga0495667_0000009_58659_59573 304
73 3300046642 Ga0495634_0000033 Ga0495634_0000033_30178_31092 304
74 3300046663 Ga0495635_0000003 Ga0495635_0000003_53467_54381 304
75 3300046675 Ga0495657_0000138 Ga0495657_0000138_5292_6206 304
76 3300046678 Ga0495599_0000030 Ga0495599_0000030_59239_60153 304
77 3300046679 Ga0495623_0000059 Ga0495623_0000059_53508_54422 304
78 3300046680 Ga0495646_0000031 Ga0495646_0000031_53526_54440 304
79 3300046689 Ga0495613_0038547 Ga0495613_0038547_938_1852 304
80 3300046809 Ga0495600_0000003 Ga0495600_0000003_167368_168282 304
81 3300047317 Ga0495604_0000002 Ga0495604_0000002_476484_477398 304
82 3300047319 Ga0495674_0000004 Ga0495674_0000004_475817_476731 304
83 3300047322 Ga0495680_0000676 Ga0495680_0000676_28535_29449 304
84 3300047444 Ga0495675_0000048 Ga0495675_0000048_27174_28088 304
85 3300047471 Ga0495684_0000019 Ga0495684_0000019_99514_100428 304
86 3300047673 Ga0495593_0000511 Ga0495593_0000511_2317_3231 304
87 3300048088 Ga0495602_0000001 Ga0495602_0000001_53509_54423 304
88 3300049577 Ga0501041_0037133 Ga0501041_0037133_1277_2215 304
89 3300049587 Ga0501071_0091986 Ga0501071_0091986_1207_2145 304
90 3300049588 Ga0501072_0272808 Ga0501072_0272808_130_1083 304
91 3300049590 Ga0501074_0093766 Ga0501074_0093766_14_952 304
92 3300049741 Ga0501079_0010282 Ga0501079_0010282_6062_7000 304
93 3300049743 Ga0501081_0007241 Ga0501081_0007241_1553_2491 304
94 3300050509 nmdc:mga0qj67_165983_c1 nmdc:mga0qj67_165983_c1_50_1027 304
95 3300050511 nmdc:mga08y16_31039_c1 nmdc:mga08y16_31039_c1_2786_3727 304
96 3300050514 nmdc:mga08x19_58625_c1 nmdc:mga08x19_58625_c1_1456_2373 304
97 3300053077 Ga0495601_0000002 Ga0495601_0000002_370115_371029 304
98 3300053078 Ga0495612_0000012 Ga0495612_0000012_169512_170426 304
99 3300053084 Ga0495595_0000012 Ga0495595_0000012_128099_129013 304
100 3300053085 Ga0495619_0000003 Ga0495619_0000003_58631_59545 304
101 3300060353 Ga0501082_0028687 Ga0501082_0028687_493_1431 304
102 3300001977 JGI24746J21847_1000990 JGI24746J21847_10009903 305
103 3300001990 JGI24737J22298_10016345 JGI24737J22298_100163452 305
104 3300002070 JGI24750J21931_1001457 JGI24750J21931_10014572 305
105 3300002075 JGI24738J21930_10018916 JGI24738J21930_100189161 305
106 3300002077 JGI24744J21845_10000413 JGI24744J21845_100004132 305
107 3300002244 JGI24742J22300_10000805 JGI24742J22300_100008054 305
108 3300002459 JGI24751J29686_10020193 JGI24751J29686_100201932 305
109 3300003203 JGI25406J46586_10000621 JGI25406J46586_100006214 305
110 3300003911 JGI25405J52794_10007240 JGI25405J52794_100072402 305
111 3300005329 Ga0070683_100102104 Ga0070683_1001021041 305
112 3300005334 Ga0068869_100040563 Ga0068869_1000405632 305
113 3300005335 Ga0070666_10018911 Ga0070666_100189112 305
114 3300005337 Ga0070682_100025802 Ga0070682_1000258022 305
115 3300005338 Ga0068868_100039788 Ga0068868_1000397883 305
116 3300005339 Ga0070660_100027790 Ga0070660_1000277902 305
117 3300005347 Ga0070668_100097567 Ga0070668_1000975672 305
118 3300005353 Ga0070669_100051774 Ga0070669_1000517741 305
119 3300005353 Ga0070669_100096477 Ga0070669_1000964772 305
120 3300005354 Ga0070675_100037573 Ga0070675_1000375734 305
121 3300005355 Ga0070671_100018449 Ga0070671_1000184495 305
122 3300005356 Ga0070674_100095112 Ga0070674_1000951122 305
123 3300005364 Ga0070673_100030123 Ga0070673_1000301233 305
124 3300005367 Ga0070667_100144323 Ga0070667_1001443232 305
125 3300005367 Ga0070667_100282563 Ga0070667_1002825631 305
126 3300005437 Ga0070710_10047429 Ga0070710_100474292 305
127 3300005440 Ga0070705_100034600 Ga0070705_1000346002 305
128 3300005456 Ga0070678_100030353 Ga0070678_1000303533 305
129 3300005456 Ga0070678_100163596 Ga0070678_1001635962 305
130 3300005459 Ga0068867_100025735 Ga0068867_1000257353 305
131 3300005471 Ga0070698_100106717 Ga0070698_1001067173 305
132 3300005518 Ga0070699_100001443 Ga0070699_1000014439 305
133 3300005536 Ga0070697_100141268 Ga0070697_1001412682 305
134 3300005543 Ga0070672_100040448 Ga0070672_1000404483 305
135 3300005543 Ga0070672_100177736 Ga0070672_1001777362 305
136 3300005548 Ga0070665_100195512 Ga0070665_1001955121 305
137 3300005549 Ga0070704_100180804 Ga0070704_1001808043 305
138 3300005564 Ga0070664_100095944 Ga0070664_1000959442 305
139 3300005577 Ga0068857_100134794 Ga0068857_1001347942 305
140 3300005614 Ga0068856_100050165 Ga0068856_1000501654 305
141 3300005615 Ga0070702_100011224 Ga0070702_1000112242 305
142 3300005615 Ga0070702_100177455 Ga0070702_1001774551 305
143 3300005617 Ga0068859_100006960 Ga0068859_1000069605 305
144 3300005617 Ga0068859_100247567 Ga0068859_1002475672 305
145 3300005618 Ga0068864_100035728 Ga0068864_1000357283 305
146 3300005618 Ga0068864_100062494 Ga0068864_1000624942 305
147 3300005718 Ga0068866_10020641 Ga0068866_100206412 305
148 3300005840 Ga0068870_10006575 Ga0068870_100065752 305
149 3300005842 Ga0068858_100023619 Ga0068858_1000236195 305
150 3300005843 Ga0068860_100029725 Ga0068860_1000297252 305
151 3300005844 Ga0068862_100077460 Ga0068862_1000774602 305
152 3300005844 Ga0068862_100254988 Ga0068862_1002549882 305
153 3300005937 Ga0081455_10000009 Ga0081455_10000009107 305
154 3300005937 Ga0081455_10008013 Ga0081455_100080133 305
155 3300005937 Ga0081455_10080273 Ga0081455_100802732 305
156 3300005937 Ga0081455_10110096 Ga0081455_101100962 305
157 3300005983 Ga0081540_1007786 Ga0081540_10077863 305
158 3300005985 Ga0081539_10000932 Ga0081539_1000093213 305
159 3300005985 Ga0081539_10110185 Ga0081539_101101852 305
160 3300006048 Ga0075363_100015293 Ga0075363_1000152934 305
161 3300006048 Ga0075363_100045654 Ga0075363_1000456542 305
162 3300006048 Ga0075363_100049548 Ga0075363_1000495482 305
163 3300006051 Ga0075364_10013177 Ga0075364_100131775 305
164 3300006051 Ga0075364_10055758 Ga0075364_100557582 305
165 3300006058 Ga0075432_10003653 Ga0075432_100036535 305
166 3300006175 Ga0070712_100009461 Ga0070712_1000094612 305
167 3300006177 Ga0075362_10013026 Ga0075362_100130262 305
168 3300006178 Ga0075367_10074785 Ga0075367_100747852 305
169 3300006178 Ga0075367_10099521 Ga0075367_100995212 305
170 3300006195 Ga0075366_10007706 Ga0075366_100077063 305
171 3300006237 Ga0097621_100058727 Ga0097621_1000587272 305
172 3300006844 Ga0075428_100003428 Ga0075428_1000034288 305
173 3300006846 Ga0075430_100000944 Ga0075430_1000009448 305
174 3300006847 Ga0075431_100001444 Ga0075431_10000144413 305
175 3300006852 Ga0075433_10003897 Ga0075433_100038975 305
176 3300006852 Ga0075433_10046895 Ga0075433_100468953 305
177 3300006871 Ga0075434_100001449 Ga0075434_10000144911 305
178 3300006871 Ga0075434_100015567 Ga0075434_1000155674 305
179 3300006880 Ga0075429_100003813 Ga0075429_1000038135 305
180 3300006881 Ga0068865_100046455 Ga0068865_1000464551 305
181 3300006931 Ga0097620_100006960 Ga0097620_1000069605 305
182 3300006931 Ga0097620_100247547 Ga0097620_1002475472 305
183 3300007076 Ga0075435_100029818 Ga0075435_1000298183 305
184 3300009094 Ga0111539_10004776 Ga0111539_1000477612 305
185 3300009094 Ga0111539_10412474 Ga0111539_104124741 305
186 3300009098 Ga0105245_10051259 Ga0105245_100512595 305
187 3300009098 Ga0105245_10165185 Ga0105245_101651853 305
188 3300009098 Ga0105245_10403178 Ga0105245_104031782 305
189 3300009101 Ga0105247_10065518 Ga0105247_100655182 305
190 3300009147 Ga0114129_10005429 Ga0114129_1000542912 305
191 3300009147 Ga0114129_10009614 Ga0114129_100096149 305
192 3300009147 Ga0114129_10631522 Ga0114129_106315221 305
193 3300009148 Ga0105243_10040251 Ga0105243_100402513 305
194 3300009148 Ga0105243_10115920 Ga0105243_101159202 305
195 3300009176 Ga0105242_10038151 Ga0105242_100381512 305
196 3300009177 Ga0105248_10019452 Ga0105248_100194522 305
197 3300009551 Ga0105238_10019837 Ga0105238_100198376 305
198 3300010375 Ga0105239_10114314 Ga0105239_101143142 305
199 3300011119 Ga0105246_10036985 Ga0105246_100369854 305
200 3300013104 Ga0157370_10065145 Ga0157370_100651452 305
201 3300013296 Ga0157374_10011104 Ga0157374_100111046 305
202 3300013297 Ga0157378_10106095 Ga0157378_101060951 305
203 3300013297 Ga0157378_10117714 Ga0157378_101177142 305
204 3300013306 Ga0163162_10060832 Ga0163162_100608323 305
205 3300014326 Ga0157380_10130530 Ga0157380_101305302 305
206 3300014497 Ga0182008_10079540 Ga0182008_100795402 305
207 3300014968 Ga0157379_10344980 Ga0157379_103449802 305
208 3300014969 Ga0157376_10040115 Ga0157376_100401154 305
209 3300015262 Ga0182007_10040468 Ga0182007_100404682 305
210 3300017792 Ga0163161_10032369 Ga0163161_100323692 305
211 3300017792 Ga0163161_10121036 Ga0163161_101210362 305
212 3300021384 Ga0213876_10023762 Ga0213876_100237625 305
213 3300025261 Ga0209233_1013549 Ga0209233_10135491 305
214 3300025321 Ga0207656_10080328 Ga0207656_100803282 305
215 3300025893 Ga0207682_10003098 Ga0207682_100030985 305
216 3300025898 Ga0207692_10056077 Ga0207692_100560773 305
217 3300025900 Ga0207710_10044455 Ga0207710_100444552 305
218 3300025901 Ga0207688_10002341 Ga0207688_100023412 305
219 3300025904 Ga0207647_10005289 Ga0207647_100052896 305
220 3300025908 Ga0207643_10000892 Ga0207643_100008923 305
221 3300025908 Ga0207643_10035582 Ga0207643_100355822 305
222 3300025914 Ga0207671_10054885 Ga0207671_100548853 305
223 3300025915 Ga0207693_10015043 Ga0207693_100150436 305
224 3300025916 Ga0207663_10072660 Ga0207663_100726602 305
225 3300025918 Ga0207662_10019164 Ga0207662_100191643 305
226 3300025920 Ga0207649_10228868 Ga0207649_102288682 305
227 3300025923 Ga0207681_10071700 Ga0207681_100717003 305
228 3300025923 Ga0207681_10094310 Ga0207681_100943102 305
229 3300025923 Ga0207681_10155730 Ga0207681_101557302 305
230 3300025924 Ga0207694_10016032 Ga0207694_100160321 305
231 3300025925 Ga0207650_10049292 Ga0207650_100492922 305
232 3300025926 Ga0207659_10159436 Ga0207659_101594362 305
233 3300025928 Ga0207700_10092527 Ga0207700_100925271 305
234 3300025931 Ga0207644_10037060 Ga0207644_100370602 305
235 3300025931 Ga0207644_10195206 Ga0207644_101952062 305
236 3300025933 Ga0207706_10001347 Ga0207706_100013474 305
237 3300025935 Ga0207709_10100661 Ga0207709_101006612 305
238 3300025935 Ga0207709_10119636 Ga0207709_101196362 305
239 3300025936 Ga0207670_10004352 Ga0207670_100043524 305
240 3300025936 Ga0207670_10077094 Ga0207670_100770942 305
241 3300025937 Ga0207669_10006458 Ga0207669_100064585 305
242 3300025937 Ga0207669_10135995 Ga0207669_101359952 305
243 3300025938 Ga0207704_10080186 Ga0207704_100801862 305
244 3300025940 Ga0207691_10009785 Ga0207691_100097858 305
245 3300025940 Ga0207691_10066452 Ga0207691_100664523 305
246 3300025942 Ga0207689_10012534 Ga0207689_100125343 305
247 3300025942 Ga0207689_10050979 Ga0207689_100509792 305
248 3300025944 Ga0207661_10063155 Ga0207661_100631551 305
249 3300025944 Ga0207661_10079863 Ga0207661_100798631 305
250 3300025945 Ga0207679_10309721 Ga0207679_103097212 305
251 3300025961 Ga0207712_10018611 Ga0207712_100186115 305
252 3300025981 Ga0207640_10036325 Ga0207640_100363252 305
253 3300025986 Ga0207658_10168807 Ga0207658_101688072 305
254 3300025986 Ga0207658_10334561 Ga0207658_103345612 305
255 3300026023 Ga0207677_10005750 Ga0207677_100057502 305
256 3300026023 Ga0207677_10054738 Ga0207677_100547383 305
257 3300026035 Ga0207703_10011709 Ga0207703_100117092 305
258 3300026041 Ga0207639_10080993 Ga0207639_100809932 305
259 3300026067 Ga0207678_10006591 Ga0207678_1000659110 305
260 3300026075 Ga0207708_10002253 Ga0207708_100022536 305
261 3300026089 Ga0207648_10002628 Ga0207648_1000262810 305
262 3300026089 Ga0207648_10008182 Ga0207648_1000818211 305
263 3300026095 Ga0207676_10004546 Ga0207676_100045469 305
264 3300026095 Ga0207676_10046067 Ga0207676_100460673 305
265 3300026116 Ga0207674_10117901 Ga0207674_101179012 305
266 3300026118 Ga0207675_100008496 Ga0207675_1000084969 305
267 3300026118 Ga0207675_100385503 Ga0207675_1003855031 305
268 3300026121 Ga0207683_10014140 Ga0207683_100141405 305
269 3300026121 Ga0207683_10032942 Ga0207683_100329422 305
270 3300026142 Ga0207698_10055555 Ga0207698_100555552 305
271 3300027907 Ga0207428_10001174 Ga0207428_1000117418 305
272 3300028380 Ga0268265_10140488 Ga0268265_101404882 305
273 3300028381 Ga0268264_10016501 Ga0268264_100165012 305
274 3300028556 Ga0265337_1009821 Ga0265337_10098213 305
275 3300028577 Ga0265318_10016375 Ga0265318_100163753 305
276 3300028800 Ga0265338_10319330 Ga0265338_103193301 305
277 3300031235 Ga0265330_10046183 Ga0265330_100461832 305
278 3300031238 Ga0265332_10015959 Ga0265332_100159593 305
279 3300031238 Ga0265332_10052195 Ga0265332_100521952 305
280 3300031239 Ga0265328_10052900 Ga0265328_100529002 305
281 3300031240 Ga0265320_10010340 Ga0265320_100103403 305
282 3300031241 Ga0265325_10037631 Ga0265325_100376313 305
283 3300031242 Ga0265329_10003528 Ga0265329_100035287 305
284 3300031247 Ga0265340_10020915 Ga0265340_100209153 305
285 3300031249 Ga0265339_10020861 Ga0265339_100208612 305
286 3300031249 Ga0265339_10051243 Ga0265339_100512431 305
287 3300031250 Ga0265331_10026505 Ga0265331_100265052 305
288 3300031344 Ga0265316_10042236 Ga0265316_100422362 305
289 3300031344 Ga0265316_10194727 Ga0265316_101947271 305
290 3300031711 Ga0265314_10044156 Ga0265314_100441563 305
291 3300031711 Ga0265314_10072158 Ga0265314_100721582 305
292 3300031712 Ga0265342_10007165 Ga0265342_100071658 305
293 3300031712 Ga0265342_10020619 Ga0265342_100206192 305
294 3300035112 Ga0373932_0037922 Ga0373932_0037922_400_1317 305
295 3300035119 Ga0373956_0059307 Ga0373956_0059307_363_1286 305
296 3300035170 Ga0373943_0019299 Ga0373943_0019299_1329_2249 305
297 3300035410 Ga0373924_0066533 Ga0373924_0066533_85_1008 305
298 3300035691 Ga0373931_0003919 Ga0373931_0003919_3321_4238 305
299 3300035692 Ga0373935_0025841 Ga0373935_0025841_584_1507 305
300 3300035724 Ga0373933_0147001 Ga0373933_0147001_260_1210 305
301 3300036401 Ga0373937_0040421 Ga0373937_0040421_2432_3355 305
302 3300037068 Ga0373925_0166898 Ga0373925_0166898_787_1707 305
303 3300037068 Ga0373925_0235041 Ga0373925_0235041_136_1053 305
304 3300039437 Ga0436365_1280755 Ga0436365_1280755_3735_4679 305
305 3300046455 Ga0495603_0038922 Ga0495603_0038922_1198_2121 305
306 3300046455 Ga0495603_0082992 Ga0495603_0082992_881_1798 305
307 3300046461 Ga0495641_0031797 Ga0495641_0031797_447_1370 305
308 3300046475 Ga0495639_0003763 Ga0495639_0003763_363_1286 305
309 3300046492 Ga0495585_0019393 Ga0495585_0019393_949_1872 305
310 3300046499 Ga0495594_0137821 Ga0495594_0137821_26_949 305
311 3300046499 Ga0495594_0245068 Ga0495594_0245068_36_953 305
312 3300046511 Ga0495608_0163389 Ga0495608_0163389_160_1083 305
313 3300046516 Ga0495628_0105780 Ga0495628_0105780_405_1322 305
314 3300046523 Ga0495644_0048161 Ga0495644_0048161_662_1585 305
315 3300046536 Ga0495587_0179594 Ga0495587_0179594_234_1157 305
316 3300046537 Ga0495598_0004132 Ga0495598_0004132_1501_2424 305
317 3300046537 Ga0495598_0020105 Ga0495598_0020105_266_1222 305
318 3300046616 Ga0495668_0100913 Ga0495668_0100913_562_1479 305
319 3300046648 Ga0495611_0044260 Ga0495611_0044260_1022_1945 305
320 3300046663 Ga0495635_0086760 Ga0495635_0086760_18_941 305
321 3300046674 Ga0495588_0095200 Ga0495588_0095200_558_1481 305
322 3300046675 Ga0495657_0007808 Ga0495657_0007808_274_1197 305
323 3300046681 Ga0495647_0026470 Ga0495647_0026470_973_1896 305
324 3300046681 Ga0495647_0061745 Ga0495647_0061745_318_1235 305
325 3300046683 Ga0495658_0010422 Ga0495658_0010422_3046_3963 305
326 3300046691 Ga0495670_0027075 Ga0495670_0027075_839_1762 305
327 3300046794 Ga0495589_0088602 Ga0495589_0088602_130_1047 305
328 3300046809 Ga0495600_0079908 Ga0495600_0079908_1147_2070 305
329 3300047320 Ga0495672_0071736 Ga0495672_0071736_875_1819 305
330 3300047322 Ga0495680_0097153 Ga0495680_0097153_245_1168 305
331 3300048088 Ga0495602_0127542 Ga0495602_0127542_334_1257 305
332 3300048090 Ga0495615_0008654 Ga0495615_0008654_839_1783 305
333 3300048903 Ga0496100_0002484 Ga0496100_0002484_4939_5856 305
334 3300048904 Ga0496101_0031700 Ga0496101_0031700_2466_3383 305
335 3300048905 Ga0496102_0013610 Ga0496102_0013610_4174_5091 305
336 3300048906 Ga0496103_0014305 Ga0496103_0014305_1978_2895 305
337 3300048907 Ga0496104_0035510 Ga0496104_0035510_326_1243 305
338 3300048908 Ga0496105_0001765 Ga0496105_0001765_12248_13165 305
339 3300048909 Ga0496106_0002523 Ga0496106_0002523_11006_11923 305
340 3300048910 Ga0496107_0018211 Ga0496107_0018211_2223_3140 305
341 3300048911 Ga0496108_0075842 Ga0496108_0075842_1051_1968 305
342 3300048913 Ga0496110_0124981 Ga0496110_0124981_596_1513 305
343 3300048914 Ga0496111_0003593 Ga0496111_0003593_1872_2789 305
344 3300048915 Ga0496112_0372687 Ga0496112_0372687_36_980 305
345 3300048916 Ga0496113_0070925 Ga0496113_0070925_1570_2487 305
346 3300048917 Ga0496114_0009703 Ga0496114_0009703_6656_7573 305
347 3300048918 Ga0496115_0017376 Ga0496115_0017376_1960_2877 305
348 3300049568 Ga0501031_0152642 Ga0501031_0152642_146_1069 305
349 3300049571 Ga0501034_0031387 Ga0501034_0031387_168_1088 305
350 3300049573 Ga0501037_0175401 Ga0501037_0175401_364_1287 305
351 3300049575 Ga0501039_0059212 Ga0501039_0059212_902_1825 305
352 3300049579 Ga0501043_0105838 Ga0501043_0105838_345_1265 305
353 3300049581 Ga0501047_0036138 Ga0501047_0036138_1306_2229 305
354 3300049581 Ga0501047_0245613 Ga0501047_0245613_161_1084 305
355 3300049586 Ga0501070_0298588 Ga0501070_0298588_325_1248 305
356 3300049588 Ga0501072_0002307 Ga0501072_0002307_9687_10628 305
357 3300049589 Ga0501073_0026086 Ga0501073_0026086_1427_2350 305
358 3300049590 Ga0501074_0072820 Ga0501074_0072820_1169_2092 305
359 3300049592 Ga0501076_0217936 Ga0501076_0217936_295_1212 305
360 3300049744 Ga0501083_0025154 Ga0501083_0025154_2158_3081 305
361 3300049823 Ga0501044_0166124 Ga0501044_0166124_772_1695 305
362 3300050489 nmdc:mga03683_20796_c1 nmdc:mga03683_20796_c1_1103_2125 305
363 3300050491 nmdc:mga00v17_14126_c1 nmdc:mga00v17_14126_c1_826_1848 305
364 3300050491 nmdc:mga00v17_79615_c1 nmdc:mga00v17_79615_c1_96_1019 305
365 3300050492 nmdc:mga0yw44_121816_c1 nmdc:mga0yw44_121816_c1_49_966 305
366 3300050492 nmdc:mga0yw44_29198_c1 nmdc:mga0yw44_29198_c1_1101_2018 305
367 3300050493 nmdc:mga0k408_110262_c1 nmdc:mga0k408_110262_c1_284_1207 305
368 3300050493 nmdc:mga0k408_6600_c1 nmdc:mga0k408_6600_c1_1158_2180 305
369 3300050494 nmdc:mga06z11_229058_c1 nmdc:mga06z11_229058_c1_84_1001 305
370 3300050494 nmdc:mga06z11_37888_c1 nmdc:mga06z11_37888_c1_859_1782 305
371 3300050494 nmdc:mga06z11_75461_c1 nmdc:mga06z11_75461_c1_658_1623 305
372 3300050495 nmdc:mga04h51_22707_c1 nmdc:mga04h51_22707_c1_401_1324 305
373 3300050495 nmdc:mga04h51_59567_c1 nmdc:mga04h51_59567_c1_86_1003 305
374 3300050496 nmdc:mga07m45_117838_c1 nmdc:mga07m45_117838_c1_349_1272 305
375 3300050507 nmdc:mga05p37_3054_c1 nmdc:mga05p37_3054_c1_10218_11138 305
376 3300050507 nmdc:mga05p37_8361_c1 nmdc:mga05p37_8361_c1_3629_4549 305
377 3300050508 nmdc:mga09592_6472_c1 nmdc:mga09592_6472_c1_733_1653 305
378 3300050509 nmdc:mga0qj67_808_c1 nmdc:mga0qj67_808_c1_6574_7494 305
379 3300050510 nmdc:mga06r32_2114_c1 nmdc:mga06r32_2114_c1_10206_11126 305
380 3300050511 nmdc:mga08y16_113831_c1 nmdc:mga08y16_113831_c1_1378_2295 305
381 3300050511 nmdc:mga08y16_7095_c1 nmdc:mga08y16_7095_c1_10108_11028 305
382 3300050512 nmdc:mga0n895_14097_c1 nmdc:mga0n895_14097_c1_5528_6448 305
383 3300050512 nmdc:mga0n895_3287_c1 nmdc:mga0n895_3287_c1_1533_2453 305
384 3300050513 nmdc:mga0rr50_393783_c1 nmdc:mga0rr50_393783_c1_192_1109 305
385 3300050513 nmdc:mga0rr50_411688_c1 nmdc:mga0rr50_411688_c1_33_950 305
386 3300050513 nmdc:mga0rr50_93186_c1 nmdc:mga0rr50_93186_c1_185_1105 305
387 3300050515 nmdc:mga0a205_104803_c1 nmdc:mga0a205_104803_c1_1350_2270 305
388 3300050515 nmdc:mga0a205_125151_c1 nmdc:mga0a205_125151_c1_1364_2329 305
389 3300050515 nmdc:mga0a205_1618_c1 nmdc:mga0a205_1618_c1_10108_11028 305
390 3300050516 nmdc:mga0sz30_108927_c1 nmdc:mga0sz30_108927_c1_274_1191 305
391 3300050516 nmdc:mga0sz30_148634_c1 nmdc:mga0sz30_148634_c1_60_983 305
392 3300053077 Ga0495601_0008111 Ga0495601_0008111_1233_2156 305
393 3300053077 Ga0495601_0024924 Ga0495601_0024924_268_1185 305
394 3300053084 Ga0495595_0000702 Ga0495595_0000702_382_1305 305
395 3300053085 Ga0495619_0037474 Ga0495619_0037474_1543_2466 305
396 3300053096 Ga0500641_0004563 Ga0500641_0004563_1373_2380 305
397 3300053096 Ga0500641_0040193 Ga0500641_0040193_78_1070 305
398 3300053130 Ga0500642_0041124 Ga0500642_0041124_48_1055 305
399 3300060353 Ga0501082_0001121 Ga0501082_0001121_20419_21429 305
400 3300060353 Ga0501082_0105269 Ga0501082_0105269_747_1670 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05726

Pirin_C

Pirin C-terminal cupin domain

190

290

0.98

PF02678

Pirin

Pirin

31

137

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9357 57 289
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.9308 68 291
5jct-assembly1.cif.gz_A crystal structure of human pirin in complex with a chemical probe pyrrolidine 24 0.9194 60 287
4hlt-assembly1.cif.gz_A crystal structure of ferric e32v pirin 0.918 60 287
2p17-assembly1.cif.gz_A crystal structure of gk1651 from geobacillus kaustophilus 0.8778 60 262
ID Description Score Start End Superfamily
af_Q5M827_137_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9224 158 285 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.92 68 152 2.60.120.10
af_C0P2Q1_61_325_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.92 60 286 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.911 60 155 2.60.120.10
af_Q9D711_137_245_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9102 158 258 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2N7XTZ3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9876 69 162
AF-A0A259BH78-F1-model_v4 Pirin C-terminal domain-containing protein 0.9825 137 304
AF-A0A2P5LPF2-F1-model_v4 Pirin family protein 0.9824 84 304
AF-A0A0H1R615-F1-model_v4 Pirin 0.9788 93 303
AF-A0A6P0DSX5-F1-model_v4 Pirin family protein 0.9783 169 288

Feature Viewer

pLDDT pTM Quality
79.49 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map