metagRoot

F434604

General Info

Members	Datasets	Scaffolds	Average Seq Length
400	249	400	65

Family's Representative Sequence

Representative Sequence	3300028573\|Ga0265334_10072254\|Ga0265334_100722542
Length	75
Sequence	MPAKSPKDAGPGQGTPKGKRSAGKGSAKKCPICGKPATEASRPFCSERCRDVDLNRWLSNSYAIPGRPEADEDED

Samples

	Sample ID	Description	Type	Environment
1	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
4	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
8	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
9	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
12	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
13	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
14	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
15	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
16	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
17	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
18	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
19	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
20	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
21	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
22	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
23	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
24	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
25	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
26	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
27	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
28	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
29	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
30	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
31	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
32	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
33	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
34	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
35	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
36	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
37	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
38	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
39	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
40	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
41	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
42	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
43	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
44	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
45	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
46	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
47	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
48	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
49	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
50	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
51	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
52	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
53	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
54	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
55	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
56	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
57	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
58	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
59	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
60	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
61	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
62	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
63	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
64	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
65	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
66	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
67	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
68	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
69	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
70	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
71	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
72	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
107	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
108	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
109	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
110	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
111	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
112	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
113	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
114	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
115	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
116	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
117	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
118	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
119	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
120	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
121	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
122	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
123	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
124	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
125	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
126	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
127	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
128	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
129	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
130	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
131	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
132	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
133	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
134	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
135	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
136	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
137	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
138	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
139	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
140	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
141	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
142	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
143	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
144	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
145	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
146	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
147	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
148	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
149	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
150	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
151	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
152	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
153	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
154	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
155	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
156	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
157	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
158	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
159	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
160	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
161	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
162	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
163	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
164	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
165	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
166	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
167	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
168	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
169	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
170	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
171	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
172	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
173	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
174	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
175	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
176	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
177	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
178	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
179	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
180	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
181	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
182	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
183	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
184	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
185	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
186	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
187	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
188	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
189	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
190	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
191	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
192	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
193	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
194	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
195	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
196	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
197	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
198	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
199	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
200	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
201	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
202	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
203	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
204	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
205	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
206	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
207	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
208	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
209	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
210	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
211	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
220	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
228	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
231	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
238	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
241	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
242	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
243	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
244	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
245	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
246	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
247	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
248	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
249	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.75
Nodule	0
Rhizoplane	7.25
Rhizosphere	87.75
Stem	0
Stem Tuber	0
Unclassified	3.25

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJQas_1012648	3300000549	Bacteria	996
2	JGI25406J46586_10000076	3300003203	Bacteria	44212
3	Ga0055526_1019858	3300003771	Bacteria	2426
4	Ga0065165_1055882	3300005262	Bacteria	1100
5	Ga0070658_10061061	3300005327	Bacteria	3070
6	Ga0070658_11419098	3300005327	Bacteria	602
7	Ga0070683_100425552	3300005329	Bacteria	1267
8	Ga0070666_11448652	3300005335	Bacteria	513
9	Ga0070680_100100453	3300005336	Bacteria	2401
10	Ga0070680_101334652	3300005336	Bacteria	621
11	Ga0070660_100003722	3300005339	Bacteria	10534
12	Ga0070660_100040800	3300005339	Bacteria	3534
13	Ga0070660_100398634	3300005339	Bacteria	1138
14	Ga0070689_101446850	3300005340	Bacteria	622
15	Ga0070691_10020608	3300005341	Bacteria	3047
16	Ga0070661_100170867	3300005344	Bacteria	1651
17	Ga0070675_100847041	3300005354	Bacteria	837
18	Ga0070673_100716468	3300005364	Bacteria	920
19	Ga0070659_100186604	3300005366	Bacteria	1703
20	Ga0070659_100227864	3300005366	Bacteria	1539
21	Ga0070659_101536372	3300005366	Bacteria	594
22	Ga0070659_101860067	3300005366	Bacteria	540
23	Ga0070714_100032933	3300005435	Bacteria	4330
24	Ga0070714_100484509	3300005435	Bacteria	1178
25	Ga0070711_100842713	3300005439	Bacteria	780
26	Ga0070705_100377194	3300005440	Bacteria	1043
27	Ga0070708_100262542	3300005445	Bacteria	1623
28	Ga0070663_100171484	3300005455	Bacteria	1677
29	Ga0070663_100223975	3300005455	Bacteria	1478
30	Ga0070678_100089457	3300005456	Bacteria	2357
31	Ga0070678_100785028	3300005456	Bacteria	864
32	Ga0070681_10632955	3300005458	Bacteria	984
33	Ga0070681_11337245	3300005458	Bacteria	639
34	Ga0070706_100070365	3300005467	Bacteria	3235
35	Ga0070707_100044871	3300005468	Bacteria	4232
36	Ga0070699_101514946	3300005518	Bacteria	615
37	Ga0070679_100097585	3300005530	Bacteria	2926
38	Ga0070679_100198945	3300005530	Bacteria	1970
39	Ga0070679_101528636	3300005530	Bacteria	615
40	Ga0070684_100022883	3300005535	Bacteria	5218
41	Ga0070697_101120078	3300005536	Bacteria	701
42	Ga0070697_101226650	3300005536	Bacteria	668
43	Ga0068853_100011965	3300005539	Bacteria	7057
44	Ga0068853_100465398	3300005539	Bacteria	1190
45	Ga0070672_100363925	3300005543	Bacteria	1235
46	Ga0070672_100885803	3300005543	Bacteria	788
47	Ga0070693_100854093	3300005547	Bacteria	679
48	Ga0070693_101495276	3300005547	Bacteria	528
49	Ga0070704_100304228	3300005549	Bacteria	1330
50	Ga0068855_100018315	3300005563	Bacteria	8412
51	Ga0068855_100457298	3300005563	Bacteria	1392
52	Ga0070664_100183346	3300005564	Bacteria	1862
53	Ga0070664_101558484	3300005564	Bacteria	626
54	Ga0068857_100073785	3300005577	Bacteria	3040
55	Ga0068857_102552209	3300005577	Bacteria	502
56	Ga0068856_100020844	3300005614	Bacteria	6370
57	Ga0068856_101254581	3300005614	Bacteria	757
58	Ga0068852_101768348	3300005616	Bacteria	641
59	Ga0068852_102203121	3300005616	Bacteria	573
60	Ga0068866_11105517	3300005718	Bacteria	568
61	Ga0068851_10012508	3300005834	Bacteria	4002
62	Ga0068858_100877153	3300005842	Bacteria	877
63	Ga0068862_101917118	3300005844	Bacteria	603
64	Ga0081539_10000229	3300005985	Bacteria	131455
65	Ga0070717_10223211	3300006028	Bacteria	1657
66	Ga0070717_11001885	3300006028	Bacteria	761
67	Ga0070717_11135126	3300006028	Bacteria	711
68	Ga0075365_10296034	3300006038	Bacteria	1139
69	Ga0070716_101727318	3300006173	Bacteria	517
70	Ga0070712_100059625	3300006175	Bacteria	2689
71	Ga0070712_101226564	3300006175	Bacteria	653
72	Ga0097621_101195885	3300006237	Bacteria	716
73	Ga0068871_100557247	3300006358	Bacteria	1039
74	Ga0099794_10036115	3300007265	Bacteria	2334
75	Ga0099794_10133620	3300007265	Bacteria	1254
76	Ga0099794_10521248	3300007265	Bacteria	626
77	Ga0099795_10009931	3300007788	Bacteria	2781
78	Ga0099795_10356837	3300007788	Bacteria	655
79	Ga0099795_10582153	3300007788	Bacteria	531
80	Ga0105240_10191658	3300009093	Bacteria	2403
81	Ga0105240_10324418	3300009093	Bacteria	1754
82	Ga0105245_10749828	3300009098	Bacteria	1012
83	Ga0105242_12708341	3300009176	Bacteria	546
84	Ga0105237_10009459	3300009545	Bacteria	10438
85	Ga0105238_10042163	3300009551	Bacteria	4622
86	Ga0099796_10018575	3300010159	Bacteria	2091
87	Ga0099796_10099859	3300010159	Bacteria	1090
88	Ga0099796_10449268	3300010159	Bacteria	573
89	Ga0099796_10488364	3300010159	Bacteria	551
90	Ga0105239_10092082	3300010375	Bacteria	3346
91	Ga0105239_11688536	3300010375	Bacteria	733
92	Ga0157326_1034073	3300012513	Bacteria	687
93	Ga0157373_10472377	3300013100	Bacteria	904
94	Ga0157371_10107532	3300013102	Bacteria	1979
95	Ga0157371_10152267	3300013102	Bacteria	1650
96	Ga0157370_10033076	3300013104	Bacteria	5042
97	Ga0157370_10236548	3300013104	Bacteria	1690
98	Ga0157369_10020222	3300013105	Bacteria	7443
99	Ga0157374_11217297	3300013296	Bacteria	774
100	Ga0157378_10985296	3300013297	Bacteria	877
101	Ga0163162_11312476	3300013306	Bacteria	822
102	Ga0157375_10311595	3300013308	Bacteria	1738
103	Ga0163163_12305764	3300014325	Bacteria	597
104	Ga0163163_12392051	3300014325	Bacteria	587
105	Ga0157380_10718299	3300014326	Bacteria	1006
106	Ga0157380_13051145	3300014326	Bacteria	534
107	Ga0157379_10030495	3300014968	Bacteria	4801
108	Ga0157379_12189921	3300014968	Bacteria	549
109	Ga0182007_10113349	3300015262	Bacteria	904
110	Ga0209564_1000522	3300025295	Bacteria	62793
111	Ga0207656_10021601	3300025321	Bacteria	2573
112	Ga0207699_11132333	3300025906	Bacteria	579
113	Ga0207643_11097190	3300025908	Bacteria	513
114	Ga0207705_10070756	3300025909	Bacteria	2528
115	Ga0207705_10308085	3300025909	Bacteria	1215
116	Ga0207707_10356282	3300025912	Bacteria	1260
117	Ga0207707_10856894	3300025912	Bacteria	754
118	Ga0207695_10198435	3300025913	Bacteria	1922
119	Ga0207695_10444438	3300025913	Bacteria	1180
120	Ga0207671_10581576	3300025914	Bacteria	893
121	Ga0207671_11348361	3300025914	Bacteria	554
122	Ga0207693_10288080	3300025915	Bacteria	1287
123	Ga0207693_10674346	3300025915	Bacteria	802
124	Ga0207663_10418780	3300025916	Bacteria	1028
125	Ga0207660_10129939	3300025917	Bacteria	1916
126	Ga0207657_10045002	3300025919	Bacteria	3876
127	Ga0207657_10049943	3300025919	Bacteria	3642
128	Ga0207649_10122700	3300025920	Bacteria	1754
129	Ga0207652_10054934	3300025921	Bacteria	3424
130	Ga0207652_11073599	3300025921	Bacteria	705
131	Ga0207694_10028657	3300025924	Bacteria	4245
132	Ga0207659_10756175	3300025926	Bacteria	834
133	Ga0207687_10507889	3300025927	Bacteria	1007
134	Ga0207700_10348035	3300025928	Bacteria	1290
135	Ga0207700_11265115	3300025928	Bacteria	658
136	Ga0207700_12046890	3300025928	Bacteria	500
137	Ga0207664_10030282	3300025929	Bacteria	4133
138	Ga0207664_10664490	3300025929	Bacteria	937
139	Ga0207690_11147254	3300025932	Bacteria	648
140	Ga0207690_11268785	3300025932	Bacteria	615
141	Ga0207670_11101383	3300025936	Bacteria	670
142	Ga0207691_10451453	3300025940	Bacteria	1094
143	Ga0207661_10039770	3300025944	Bacteria	3693
144	Ga0207661_10518632	3300025944	Bacteria	1090
145	Ga0207679_11348479	3300025945	Bacteria	654
146	Ga0207679_11900931	3300025945	Bacteria	543
147	Ga0207667_10015667	3300025949	Bacteria	8600
148	Ga0207703_10542379	3300026035	Bacteria	1096
149	Ga0207639_10025158	3300026041	Bacteria	4315
150	Ga0207678_10301203	3300026067	Bacteria	1378
151	Ga0207702_11135451	3300026078	Bacteria	775
152	Ga0207674_10026810	3300026116	Bacteria	6112
153	Ga0207683_10145877	3300026121	Bacteria	2134
154	Ga0207683_10751384	3300026121	Bacteria	905
155	Ga0209179_1045363	3300027512	Bacteria	932
156	Ga0209588_1035809	3300027671	Bacteria	1596
157	Ga0209588_1113638	3300027671	Bacteria	869
158	Ga0268266_10835540	3300028379	Bacteria	890
159	Ga0268265_12314333	3300028380	Bacteria	544
160	Ga0265334_10072254	3300028573	Bacteria	1283
161	Ga0265339_10169434	3300031249	Bacteria	1094
162	Ga0265316_10743918	3300031344	Bacteria	689
163	Ga0307509_10479589	3300031507	Bacteria	932
164	Ga0307508_10082442	3300031616	Bacteria	2798
165	Ga0265314_10048393	3300031711	Bacteria	2985
166	Ga0265342_10112105	3300031712	Bacteria	1543
167	Ga0373948_0044939	3300034817	Bacteria	935
168	Ga0373926_0147374	3300035083	Bacteria	895
169	Ga0373934_0149124	3300035086	Bacteria	957
170	Ga0373940_0022317	3300035088	Bacteria	1626
171	Ga0373944_0073121	3300035089	Bacteria	1120
172	Ga0373944_0247143	3300035089	Bacteria	658
173	Ga0373932_0371740	3300035112	Bacteria	548
174	Ga0373941_0424261	3300035115	Bacteria	554
175	Ga0373953_0038438	3300035117	Bacteria	1893
176	Ga0373954_0025507	3300035118	Bacteria	2703
177	Ga0373954_0104498	3300035118	Bacteria	1367
178	Ga0373956_0239441	3300035119	Bacteria	862
179	Ga0373960_0121626	3300035121	Bacteria	867
180	Ga0373943_0055553	3300035170	Bacteria	1962
181	Ga0373946_0015510	3300035171	Bacteria	2891
182	Ga0373955_0108879	3300035172	Bacteria	1600
183	Ga0373955_0562907	3300035172	Bacteria	697
184	Ga0373924_0326336	3300035410	Bacteria	683
185	Ga0373924_0396187	3300035410	Bacteria	617
186	Ga0373931_0606438	3300035691	Bacteria	716
187	Ga0373935_0228295	3300035692	Bacteria	1295
188	Ga0373935_0797299	3300035692	Bacteria	697
189	Ga0373927_0006210	3300035695	Bacteria	8159
190	Ga0373927_0078912	3300035695	Bacteria	2132
191	Ga0373927_0311369	3300035695	Bacteria	1036
192	Ga0373933_0061940	3300035724	Bacteria	2258
193	Ga0373947_0081471	3300035725	Bacteria	2004
194	Ga0373947_0158940	3300035725	Bacteria	1460
195	Ga0373947_0672971	3300035725	Bacteria	706
196	Ga0373937_0111703	3300036401	Bacteria	2542
197	Ga0373937_0748770	3300036401	Bacteria	924
198	Ga0373925_0300619	3300037068	Bacteria	1296
199	Ga0373925_0305032	3300037068	Bacteria	1286
200	Ga0373925_1554940	3300037068	Bacteria	541
201	Ga0451853_0346696	3300041512	Bacteria	619
202	Ga0466963_0850441	3300044694	Bacteria	643
203	Ga0495592_0131187	3300046454	Bacteria	1752
204	Ga0495603_0034105	3300046455	Bacteria	3062
205	Ga0495603_0068660	3300046455	Bacteria	2085
206	Ga0495629_0000835	3300046459	Bacteria	24987
207	Ga0495641_0037903	3300046461	Bacteria	2255
208	Ga0495651_0033717	3300046462	Bacteria	3993
209	Ga0495651_0434771	3300046462	Bacteria	851
210	Ga0495653_0076069	3300046463	Bacteria	2497
211	Ga0495653_0276389	3300046463	Bacteria	1104
212	Ga0495653_0597528	3300046463	Bacteria	679
213	Ga0495653_0826276	3300046463	Bacteria	556
214	Ga0495580_0953240	3300046472	Bacteria	549
215	Ga0495582_0075868	3300046473	Bacteria	1862
216	Ga0495639_0002753	3300046475	Bacteria	7634
217	Ga0495639_0530533	3300046475	Bacteria	602
218	Ga0495662_0062481	3300046476	Bacteria	1799
219	Ga0495664_0035046	3300046477	Bacteria	2954
220	Ga0495594_0064459	3300046499	Bacteria	2031
221	Ga0495606_0071285	3300046507	Bacteria	2188
222	Ga0495608_0799351	3300046511	Bacteria	557
223	Ga0495610_0078871	3300046512	Bacteria	1517
224	Ga0495618_0017687	3300046514	Bacteria	4375
225	Ga0495618_0138982	3300046514	Bacteria	1554
226	Ga0495618_0572773	3300046514	Unclassified	674
227	Ga0495628_0067975	3300046516	Bacteria	2781
228	Ga0495628_0884523	3300046516	Bacteria	621
229	Ga0495630_0145479	3300046517	Bacteria	1802
230	Ga0495630_0177406	3300046517	Bacteria	1624
231	Ga0495648_0001338	3300046524	Bacteria	24368
232	Ga0495666_0562781	3300046526	Bacteria	508
233	Ga0495652_0133582	3300046529	Bacteria	1961
234	Ga0495652_0339692	3300046529	Bacteria	1079
235	Ga0495652_0342525	3300046529	Bacteria	1073
236	Ga0495665_0547344	3300046531	Bacteria	581
237	Ga0495640_0148873	3300046533	Bacteria	1505
238	Ga0495586_0081288	3300046535	Bacteria	1781
239	Ga0495597_0103051	3300046542	Bacteria	1202
240	Ga0495645_0066043	3300046543	Bacteria	2616
241	Ga0495622_0088130	3300046557	Bacteria	1426
242	Ga0495667_0123782	3300046559	Bacteria	1669
243	Ga0495668_0526516	3300046616	Bacteria	652
244	Ga0495634_0058818	3300046642	Bacteria	2561
245	Ga0495635_0013429	3300046663	Bacteria	5730
246	Ga0495635_0017694	3300046663	Bacteria	4978
247	Ga0495588_0014353	3300046674	Bacteria	3791
248	Ga0495588_0188653	3300046674	Bacteria	1089
249	Ga0495657_0201046	3300046675	Bacteria	1214
250	Ga0495657_0336120	3300046675	Bacteria	896
251	Ga0495599_0276736	3300046678	Bacteria	1017
252	Ga0495623_0042380	3300046679	Bacteria	2899
253	Ga0495646_0120134	3300046680	Bacteria	1488
254	Ga0495646_0163991	3300046680	Bacteria	1228
255	Ga0495647_0022684	3300046681	Bacteria	2269
256	Ga0495658_0025441	3300046683	Bacteria	3163
257	Ga0495613_0035169	3300046689	Bacteria	3719
258	Ga0495613_0817476	3300046689	Bacteria	607
259	Ga0495624_0042360	3300046690	Bacteria	2909
260	Ga0495624_0561831	3300046690	Bacteria	681
261	Ga0495600_0038931	3300046809	Bacteria	3096
262	Ga0495581_0008740	3300047315	Bacteria	5867
263	Ga0495581_0090430	3300047315	Bacteria	1776
264	Ga0495581_0388786	3300047315	Bacteria	814
265	Ga0495604_0058814	3300047317	Bacteria	2950
266	Ga0495674_0014752	3300047319	Bacteria	7310
267	Ga0495674_0565884	3300047319	Bacteria	903
268	Ga0495672_0179192	3300047320	Bacteria	1074
269	Ga0495676_0154267	3300047321	Bacteria	1631
270	Ga0495680_0202494	3300047322	Bacteria	1423
271	Ga0495675_0020845	3300047444	Bacteria	4171
272	Ga0495673_0044569	3300047469	Bacteria	1978
273	Ga0495684_0080412	3300047471	Bacteria	2474
274	Ga0495684_0088183	3300047471	Bacteria	2351
275	Ga0495593_0008936	3300047673	Bacteria	5816
276	Ga0495602_0887875	3300048088	Bacteria	594
277	Ga0495614_0310372	3300048089	Bacteria	730
278	Ga0496100_0166881	3300048903	Bacteria	1582
279	Ga0496101_0025580	3300048904	Bacteria	4097
280	Ga0496101_0433349	3300048904	Bacteria	1037
281	Ga0496102_0010925	3300048905	Bacteria	7821
282	Ga0496104_0007603	3300048907	Bacteria	9595
283	Ga0496104_0332935	3300048907	Bacteria	1431
284	Ga0496104_0829942	3300048907	Bacteria	830
285	Ga0496105_0168281	3300048908	Bacteria	1797
286	Ga0496105_1256419	3300048908	Bacteria	543
287	Ga0496106_0075237	3300048909	Bacteria	2586
288	Ga0496108_0032197	3300048911	Bacteria	4354
289	Ga0496108_0357637	3300048911	Bacteria	1274
290	Ga0496109_0031112	3300048912	Bacteria	4787
291	Ga0496109_1741893	3300048912	Bacteria	556
292	Ga0496110_0024772	3300048913	Bacteria	5119
293	Ga0496110_0262882	3300048913	Bacteria	1571
294	Ga0496110_0893702	3300048913	Bacteria	794
295	Ga0496111_0832899	3300048914	Bacteria	667
296	Ga0496112_0007292	3300048915	Bacteria	9802
297	Ga0496112_0008050	3300048915	Bacteria	9407
298	Ga0496112_0829763	3300048915	Bacteria	848
299	Ga0496113_0011196	3300048916	Bacteria	5970
300	Ga0496113_1074651	3300048916	Bacteria	632
301	Ga0496114_0104873	3300048917	Bacteria	2418
302	Ga0496114_0215503	3300048917	Bacteria	1685
303	Ga0496115_0090669	3300048918	Bacteria	2497
304	Ga0496115_0220529	3300048918	Bacteria	1565
305	Ga0496115_0986881	3300048918	Bacteria	644
306	Ga0496115_1200756	3300048918	Bacteria	570
307	Ga0496117_0096188	3300048920	Bacteria	1890
308	Ga0496121_0261532	3300048924	Bacteria	1194
309	Ga0496122_0102896	3300048925	Bacteria	1902
310	Ga0496123_0108697	3300048926	Bacteria	1591
311	Ga0496124_0686824	3300048927	Bacteria	651
312	Ga0496125_0763285	3300048928	Bacteria	505
313	Ga0496126_0670404	3300048929	Bacteria	809
314	Ga0496126_0688324	3300048929	Bacteria	796
315	Ga0496126_0934232	3300048929	Bacteria	655
316	Ga0496126_1280594	3300048929	Bacteria	535
317	Ga0501031_0000072	3300049568	Bacteria	53648
318	Ga0501031_0162364	3300049568	Bacteria	1460
319	Ga0501031_0668450	3300049568	Bacteria	667
320	Ga0501032_0000110	3300049569	Bacteria	70189
321	Ga0501032_0018963	3300049569	Bacteria	4813
322	Ga0501032_0402293	3300049569	Bacteria	879
323	Ga0501033_0002224	3300049570	Bacteria	16678
324	Ga0501033_0002581	3300049570	Bacteria	15267
325	Ga0501033_0017612	3300049570	Bacteria	5396
326	Ga0501033_0586412	3300049570	Bacteria	765
327	Ga0501033_0660649	3300049570	Bacteria	713
328	Ga0501034_0000181	3300049571	Bacteria	117767
329	Ga0501036_0003971	3300049572	Bacteria	11886
330	Ga0501036_0020542	3300049572	Bacteria	5547
331	Ga0501036_0227536	3300049572	Bacteria	1565
332	Ga0501037_0000059	3300049573	Bacteria	101459
333	Ga0501037_0001428	3300049573	Bacteria	17519
334	Ga0501037_0218880	3300049573	Bacteria	1340
335	Ga0501038_0000143	3300049574	Bacteria	61292
336	Ga0501038_0245908	3300049574	Bacteria	1418
337	Ga0501038_0815925	3300049574	Bacteria	692
338	Ga0501038_1015520	3300049574	Bacteria	608
339	Ga0501039_0000069	3300049575	Bacteria	78211
340	Ga0501039_0219892	3300049575	Bacteria	1493
341	Ga0501039_0309590	3300049575	Bacteria	1241
342	Ga0501041_0109976	3300049577	Bacteria	1710
343	Ga0501042_0015016	3300049578	Bacteria	5296
344	Ga0501043_0001060	3300049579	Bacteria	24164
345	Ga0501043_0001844	3300049579	Bacteria	18171
346	Ga0501043_0055601	3300049579	Bacteria	3109
347	Ga0501046_0000153	3300049580	Bacteria	71187
348	Ga0501047_0000149	3300049581	Bacteria	85138
349	Ga0501047_0148461	3300049581	Bacteria	2221
350	Ga0501047_0602191	3300049581	Bacteria	920
351	Ga0501048_0000328	3300049582	Bacteria	32753
352	Ga0501048_0378211	3300049582	Bacteria	1011
353	Ga0501067_0002244	3300049583	Bacteria	10667
354	Ga0501067_0277154	3300049583	Bacteria	934
355	Ga0501067_0392580	3300049583	Bacteria	774
356	Ga0501068_0000624	3300049584	Bacteria	18056
357	Ga0501068_0466953	3300049584	Bacteria	817
358	Ga0501068_0587276	3300049584	Bacteria	725
359	Ga0501069_0001174	3300049585	Bacteria	12702
360	Ga0501070_0090221	3300049586	Bacteria	2536
361	Ga0501070_0259267	3300049586	Bacteria	1421
362	Ga0501071_0027677	3300049587	Bacteria	3991
363	Ga0501071_0846036	3300049587	Bacteria	706
364	Ga0501072_0121797	3300049588	Bacteria	2078
365	Ga0501072_0209104	3300049588	Bacteria	1555
366	Ga0501073_0005332	3300049589	Bacteria	9641
367	Ga0501073_0426390	3300049589	Bacteria	917
368	Ga0501074_0000156	3300049590	Bacteria	35744
369	Ga0501076_1403086	3300049592	Bacteria	574
370	Ga0501079_0001561	3300049741	Bacteria	16251
371	Ga0501079_0189763	3300049741	Bacteria	1604
372	Ga0501080_0000277	3300049742	Bacteria	38616
373	Ga0501080_0707724	3300049742	Bacteria	888
374	Ga0501083_0000244	3300049744	Bacteria	34784
375	Ga0501083_0681023	3300049744	Bacteria	669
376	Ga0501035_0000383	3300049822	Bacteria	50837
377	Ga0501035_0005179	3300049822	Bacteria	12333
378	Ga0501035_0152799	3300049822	Bacteria	2002
379	Ga0501044_0000443	3300049823	Bacteria	50672
380	Ga0501044_0048351	3300049823	Bacteria	4394
381	Ga0501044_0170741	3300049823	Bacteria	2146
382	Ga0501044_0271722	3300049823	Bacteria	1630
383	Ga0501045_0163080	3300049824	Bacteria	1659
384	nmdc:mga00v17_920621_c1	3300050491	Bacteria	553
385	Ga0495601_0091029	3300053077	Bacteria	1963
386	Ga0495601_0241599	3300053077	Bacteria	1179
387	Ga0495601_0513075	3300053077	Bacteria	773
388	Ga0495612_0104781	3300053078	Bacteria	1207
389	Ga0495612_0192904	3300053078	Bacteria	897
390	Ga0495612_0231157	3300053078	Bacteria	820
391	Ga0495655_0252178	3300053083	Bacteria	594
392	Ga0495595_0331842	3300053084	Bacteria	766
393	Ga0495619_0033418	3300053085	Bacteria	3340
394	Ga0495619_0504885	3300053085	Bacteria	832
395	Ga0495619_1091026	3300053085	Bacteria	531
396	Ga0500618_055720	3300053125	Bacteria	891
397	Ga0500559_0573158	3300053136	Bacteria	513
398	Ga0501084_0000558	3300054114	Bacteria	28461
399	Ga0501082_0017939	3300060353	Bacteria	6096
400	Ga0501082_1203743	3300060353	Bacteria	662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047320	Ga0495672_0179192	Ga0495672_0179192_840_1028	58
2	3300005547	Ga0070693_101495276	Ga0070693_1014952762	59
3	3300006028	Ga0070717_10223211	Ga0070717_102232113	59
4	3300013306	Ga0163162_11312476	Ga0163162_113124762	59
5	3300031712	Ga0265342_10112105	Ga0265342_101121052	59
6	3300003771	Ga0055526_1019858	Ga0055526_10198582	60
7	3300005262	Ga0065165_1055882	Ga0065165_10558822	60
8	3300005455	Ga0070663_100171484	Ga0070663_1001714844	60
9	3300005456	Ga0070678_100785028	Ga0070678_1007850282	60
10	3300006173	Ga0070716_101727318	Ga0070716_1017273181	60
11	3300006237	Ga0097621_101195885	Ga0097621_1011958852	60
12	3300007788	Ga0099795_10009931	Ga0099795_100099312	60
13	3300009098	Ga0105245_10749828	Ga0105245_107498281	60
14	3300010159	Ga0099796_10018575	Ga0099796_100185752	60
15	3300013297	Ga0157378_10985296	Ga0157378_109852962	60
16	3300025295	Ga0209564_1000522	Ga0209564_100052254	60
17	3300025927	Ga0207687_10507889	Ga0207687_105078891	60
18	3300026121	Ga0207683_10751384	Ga0207683_107513842	60
19	3300027512	Ga0209179_1045363	Ga0209179_10453633	60
20	3300041512	Ga0451853_0346696	Ga0451853_0346696_317_499	60
21	3300046507	Ga0495606_0071285	Ga0495606_0071285_1274_1456	60
22	3300048915	Ga0496112_0007292	Ga0496112_0007292_7708_7890	60
23	3300048920	Ga0496117_0096188	Ga0496117_0096188_1681_1863	60
24	3300048924	Ga0496121_0261532	Ga0496121_0261532_688_870	60
25	3300048925	Ga0496122_0102896	Ga0496122_0102896_745_927	60
26	3300048926	Ga0496123_0108697	Ga0496123_0108697_337_519	60
27	3300048927	Ga0496124_0686824	Ga0496124_0686824_339_521	60
28	3300048928	Ga0496125_0763285	Ga0496125_0763285_94_276	60
29	3300048929	Ga0496126_0688324	Ga0496126_0688324_461_643	60
30	3300049568	Ga0501031_0162364	Ga0501031_0162364_992_1174	60
31	3300049569	Ga0501032_0018963	Ga0501032_0018963_1289_1471	60
32	3300049570	Ga0501033_0002224	Ga0501033_0002224_14179_14361	60
33	3300049572	Ga0501036_0020542	Ga0501036_0020542_433_615	60
34	3300049573	Ga0501037_0001428	Ga0501037_0001428_11918_12100	60
35	3300049574	Ga0501038_0245908	Ga0501038_0245908_181_363	60
36	3300049574	Ga0501038_0815925	Ga0501038_0815925_191_373	60
37	3300049575	Ga0501039_0309590	Ga0501039_0309590_982_1164	60
38	3300049577	Ga0501041_0109976	Ga0501041_0109976_1426_1608	60
39	3300049578	Ga0501042_0015016	Ga0501042_0015016_2540_2722	60
40	3300049579	Ga0501043_0001844	Ga0501043_0001844_4352_4534	60
41	3300049581	Ga0501047_0148461	Ga0501047_0148461_17_199	60
42	3300049583	Ga0501067_0392580	Ga0501067_0392580_544_726	60
43	3300049584	Ga0501068_0466953	Ga0501068_0466953_420_602	60
44	3300049822	Ga0501035_0005179	Ga0501035_0005179_11905_12087	60
45	3300049823	Ga0501044_0048351	Ga0501044_0048351_2020_2202	60
46	3300050491	nmdc:mga00v17_920621_c1	nmdc:mga00v17_920621_c1_87_269	60
47	3300053078	Ga0495612_0192904	Ga0495612_0192904_517_699	60
48	3300048918	Ga0496115_0986881	Ga0496115_0986881_37_222	61
49	3300005445	Ga0070708_100262542	Ga0070708_1002625423	62
50	3300005467	Ga0070706_100070365	Ga0070706_1000703655	62
51	3300005468	Ga0070707_100044871	Ga0070707_1000448715	62
52	3300005536	Ga0070697_101226650	Ga0070697_1012266502	62
53	3300007265	Ga0099794_10521248	Ga0099794_105212481	62
54	3300012513	Ga0157326_1034073	Ga0157326_10340731	62
55	3300013100	Ga0157373_10472377	Ga0157373_104723771	62
56	3300013102	Ga0157371_10107532	Ga0157371_101075324	62
57	3300013102	Ga0157371_10152267	Ga0157371_101522673	62
58	3300025906	Ga0207699_11132333	Ga0207699_111323332	62
59	3300025928	Ga0207700_10348035	Ga0207700_103480353	62
60	3300027671	Ga0209588_1113638	Ga0209588_11136382	62
61	3300028379	Ga0268266_10835540	Ga0268266_108355402	62
62	3300031507	Ga0307509_10479589	Ga0307509_104795891	62
63	3300035083	Ga0373926_0147374	Ga0373926_0147374_648_872	62
64	3300035086	Ga0373934_0149124	Ga0373934_0149124_95_319	62
65	3300035089	Ga0373944_0073121	Ga0373944_0073121_106_294	62
66	3300035118	Ga0373954_0104498	Ga0373954_0104498_1110_1334	62
67	3300035170	Ga0373943_0055553	Ga0373943_0055553_1651_1839	62
68	3300035171	Ga0373946_0015510	Ga0373946_0015510_1565_1789	62
69	3300035172	Ga0373955_0108879	Ga0373955_0108879_864_1088	62
70	3300035410	Ga0373924_0396187	Ga0373924_0396187_106_330	62
71	3300035692	Ga0373935_0228295	Ga0373935_0228295_639_863	62
72	3300035692	Ga0373935_0797299	Ga0373935_0797299_187_375	62
73	3300035695	Ga0373927_0078912	Ga0373927_0078912_1789_2013	62
74	3300035695	Ga0373927_0311369	Ga0373927_0311369_612_800	62
75	3300035725	Ga0373947_0158940	Ga0373947_0158940_639_863	62
76	3300035725	Ga0373947_0672971	Ga0373947_0672971_158_346	62
77	3300036401	Ga0373937_0111703	Ga0373937_0111703_563_787	62
78	3300037068	Ga0373925_0300619	Ga0373925_0300619_255_455	62
79	3300037068	Ga0373925_0305032	Ga0373925_0305032_387_611	62
80	3300037068	Ga0373925_1554940	Ga0373925_1554940_246_434	62
81	3300044694	Ga0466963_0850441	Ga0466963_0850441_196_384	62
82	3300046454	Ga0495592_0131187	Ga0495592_0131187_738_962	62
83	3300046455	Ga0495603_0034105	Ga0495603_0034105_416_604	62
84	3300046459	Ga0495629_0000835	Ga0495629_0000835_9645_9869	62
85	3300046461	Ga0495641_0037903	Ga0495641_0037903_1511_1735	62
86	3300046463	Ga0495653_0276389	Ga0495653_0276389_198_422	62
87	3300046472	Ga0495580_0953240	Ga0495580_0953240_155_343	62
88	3300046473	Ga0495582_0075868	Ga0495582_0075868_1395_1619	62
89	3300046475	Ga0495639_0002753	Ga0495639_0002753_1899_2123	62
90	3300046476	Ga0495662_0062481	Ga0495662_0062481_739_963	62
91	3300046499	Ga0495594_0064459	Ga0495594_0064459_1502_1726	62
92	3300046514	Ga0495618_0138982	Ga0495618_0138982_244_468	62
93	3300046516	Ga0495628_0067975	Ga0495628_0067975_2429_2653	62
94	3300046517	Ga0495630_0145479	Ga0495630_0145479_52_276	62
95	3300046529	Ga0495652_0133582	Ga0495652_0133582_1621_1845	62
96	3300046531	Ga0495665_0547344	Ga0495665_0547344_171_359	62
97	3300046557	Ga0495622_0088130	Ga0495622_0088130_537_761	62
98	3300046559	Ga0495667_0123782	Ga0495667_0123782_153_377	62
99	3300046642	Ga0495634_0058818	Ga0495634_0058818_1508_1732	62
100	3300046663	Ga0495635_0017694	Ga0495635_0017694_4244_4468	62
101	3300046674	Ga0495588_0188653	Ga0495588_0188653_193_381	62
102	3300046675	Ga0495657_0336120	Ga0495657_0336120_279_503	62
103	3300046681	Ga0495647_0022684	Ga0495647_0022684_1522_1746	62
104	3300046683	Ga0495658_0025441	Ga0495658_0025441_2029_2253	62
105	3300046689	Ga0495613_0035169	Ga0495613_0035169_639_863	62
106	3300046690	Ga0495624_0042360	Ga0495624_0042360_529_753	62
107	3300047319	Ga0495674_0014752	Ga0495674_0014752_5557_5781	62
108	3300047471	Ga0495684_0088183	Ga0495684_0088183_1488_1712	62
109	3300047673	Ga0495593_0008936	Ga0495593_0008936_2247_2471	62
110	3300048917	Ga0496114_0215503	Ga0496114_0215503_1472_1666	62
111	3300049568	Ga0501031_0000072	Ga0501031_0000072_18709_18897	62
112	3300049569	Ga0501032_0000110	Ga0501032_0000110_53003_53191	62
113	3300049570	Ga0501033_0002581	Ga0501033_0002581_3896_4084	62
114	3300049571	Ga0501034_0000181	Ga0501034_0000181_49209_49397	62
115	3300049572	Ga0501036_0003971	Ga0501036_0003971_5254_5442	62
116	3300049573	Ga0501037_0000059	Ga0501037_0000059_36869_37057	62
117	3300049574	Ga0501038_0000143	Ga0501038_0000143_17744_17932	62
118	3300049575	Ga0501039_0000069	Ga0501039_0000069_72524_72712	62
119	3300049579	Ga0501043_0001060	Ga0501043_0001060_12332_12520	62
120	3300049580	Ga0501046_0000153	Ga0501046_0000153_64035_64223	62
121	3300049581	Ga0501047_0000149	Ga0501047_0000149_16729_16917	62
122	3300049582	Ga0501048_0000328	Ga0501048_0000328_22976_23164	62
123	3300049583	Ga0501067_0002244	Ga0501067_0002244_7010_7198	62
124	3300049584	Ga0501068_0000624	Ga0501068_0000624_744_932	62
125	3300049585	Ga0501069_0001174	Ga0501069_0001174_4032_4220	62
126	3300049586	Ga0501070_0090221	Ga0501070_0090221_1535_1723	62
127	3300049587	Ga0501071_0027677	Ga0501071_0027677_99_287	62
128	3300049588	Ga0501072_0121797	Ga0501072_0121797_1510_1698	62
129	3300049589	Ga0501073_0005332	Ga0501073_0005332_9143_9331	62
130	3300049590	Ga0501074_0000156	Ga0501074_0000156_30823_31011	62
131	3300049592	Ga0501076_1403086	Ga0501076_1403086_360_548	62
132	3300049741	Ga0501079_0001561	Ga0501079_0001561_9233_9421	62
133	3300049742	Ga0501080_0000277	Ga0501080_0000277_4831_5019	62
134	3300049744	Ga0501083_0000244	Ga0501083_0000244_22337_22525	62
135	3300049822	Ga0501035_0000383	Ga0501035_0000383_26946_27134	62
136	3300049823	Ga0501044_0000443	Ga0501044_0000443_48928_49116	62
137	3300049824	Ga0501045_0163080	Ga0501045_0163080_786_974	62
138	3300053077	Ga0495601_0241599	Ga0495601_0241599_837_1061	62
139	3300053085	Ga0495619_0504885	Ga0495619_0504885_49_273	62
140	3300053125	Ga0500618_055720	Ga0500618_055720_484_672	62
141	3300054114	Ga0501084_0000558	Ga0501084_0000558_10787_10975	62
142	3300060353	Ga0501082_0017939	Ga0501082_0017939_3056_3244	62
143	3300003203	JGI25406J46586_10000076	JGI25406J46586_1000007612	63
144	3300005985	Ga0081539_10000229	Ga0081539_1000022929	63
145	3300006028	Ga0070717_11135126	Ga0070717_111351262	63
146	3300035089	Ga0373944_0247143	Ga0373944_0247143_270_497	63
147	3300046455	Ga0495603_0068660	Ga0495603_0068660_1234_1461	63
148	3300046477	Ga0495664_0035046	Ga0495664_0035046_1908_2135	63
149	3300046526	Ga0495666_0562781	Ga0495666_0562781_209_436	63
150	3300046533	Ga0495640_0148873	Ga0495640_0148873_723_950	63
151	3300046542	Ga0495597_0103051	Ga0495597_0103051_786_989	63
152	3300046674	Ga0495588_0014353	Ga0495588_0014353_3220_3447	63
153	3300047315	Ga0495581_0008740	Ga0495581_0008740_814_1041	63
154	3300047321	Ga0495676_0154267	Ga0495676_0154267_138_365	63
155	3300047469	Ga0495673_0044569	Ga0495673_0044569_1033_1248	63
156	3300048089	Ga0495614_0310372	Ga0495614_0310372_484_711	63
157	3300053078	Ga0495612_0231157	Ga0495612_0231157_337_558	63
158	3300000549	LJQas_1012648	LJQas_10126482	64
159	3300005327	Ga0070658_10061061	Ga0070658_100610615	64
160	3300005327	Ga0070658_11419098	Ga0070658_114190982	64
161	3300005329	Ga0070683_100425552	Ga0070683_1004255521	64
162	3300005335	Ga0070666_11448652	Ga0070666_114486522	64
163	3300005336	Ga0070680_100100453	Ga0070680_1001004532	64
164	3300005336	Ga0070680_101334652	Ga0070680_1013346522	64
165	3300005339	Ga0070660_100003722	Ga0070660_1000037229	64
166	3300005339	Ga0070660_100040800	Ga0070660_1000408003	64
167	3300005339	Ga0070660_100398634	Ga0070660_1003986342	64
168	3300005340	Ga0070689_101446850	Ga0070689_1014468502	64
169	3300005341	Ga0070691_10020608	Ga0070691_100206082	64
170	3300005344	Ga0070661_100170867	Ga0070661_1001708674	64
171	3300005354	Ga0070675_100847041	Ga0070675_1008470412	64
172	3300005364	Ga0070673_100716468	Ga0070673_1007164682	64
173	3300005366	Ga0070659_100186604	Ga0070659_1001866042	64
174	3300005366	Ga0070659_100227864	Ga0070659_1002278643	64
175	3300005366	Ga0070659_101536372	Ga0070659_1015363722	64
176	3300005366	Ga0070659_101860067	Ga0070659_1018600671	64
177	3300005435	Ga0070714_100032933	Ga0070714_1000329335	64
178	3300005435	Ga0070714_100484509	Ga0070714_1004845091	64
179	3300005439	Ga0070711_100842713	Ga0070711_1008427132	64
180	3300005440	Ga0070705_100377194	Ga0070705_1003771942	64
181	3300005455	Ga0070663_100223975	Ga0070663_1002239753	64
182	3300005456	Ga0070678_100089457	Ga0070678_1000894572	64
183	3300005458	Ga0070681_10632955	Ga0070681_106329552	64
184	3300005458	Ga0070681_11337245	Ga0070681_113372452	64
185	3300005518	Ga0070699_101514946	Ga0070699_1015149462	64
186	3300005530	Ga0070679_100097585	Ga0070679_1000975852	64
187	3300005530	Ga0070679_100198945	Ga0070679_1001989453	64
188	3300005530	Ga0070679_101528636	Ga0070679_1015286362	64
189	3300005535	Ga0070684_100022883	Ga0070684_1000228837	64
190	3300005536	Ga0070697_101120078	Ga0070697_1011200782	64
191	3300005539	Ga0068853_100011965	Ga0068853_1000119656	64
192	3300005539	Ga0068853_100465398	Ga0068853_1004653981	64
193	3300005543	Ga0070672_100363925	Ga0070672_1003639253	64
194	3300005543	Ga0070672_100885803	Ga0070672_1008858032	64
195	3300005547	Ga0070693_100854093	Ga0070693_1008540932	64
196	3300005549	Ga0070704_100304228	Ga0070704_1003042284	64
197	3300005563	Ga0068855_100018315	Ga0068855_1000183154	64
198	3300005563	Ga0068855_100457298	Ga0068855_1004572983	64
199	3300005564	Ga0070664_100183346	Ga0070664_1001833462	64
200	3300005564	Ga0070664_101558484	Ga0070664_1015584842	64
201	3300005577	Ga0068857_100073785	Ga0068857_1000737856	64
202	3300005577	Ga0068857_102552209	Ga0068857_1025522092	64
203	3300005614	Ga0068856_100020844	Ga0068856_1000208446	64
204	3300005614	Ga0068856_101254581	Ga0068856_1012545812	64
205	3300005616	Ga0068852_101768348	Ga0068852_1017683482	64
206	3300005616	Ga0068852_102203121	Ga0068852_1022031212	64
207	3300005718	Ga0068866_11105517	Ga0068866_111055171	64
208	3300005834	Ga0068851_10012508	Ga0068851_100125083	64
209	3300005842	Ga0068858_100877153	Ga0068858_1008771532	64
210	3300005844	Ga0068862_101917118	Ga0068862_1019171182	64
211	3300006028	Ga0070717_11001885	Ga0070717_110018853	64
212	3300006038	Ga0075365_10296034	Ga0075365_102960342	64
213	3300006175	Ga0070712_100059625	Ga0070712_1000596254	64
214	3300006175	Ga0070712_101226564	Ga0070712_1012265642	64
215	3300006358	Ga0068871_100557247	Ga0068871_1005572472	64
216	3300007265	Ga0099794_10036115	Ga0099794_100361152	64
217	3300007265	Ga0099794_10133620	Ga0099794_101336202	64
218	3300007788	Ga0099795_10356837	Ga0099795_103568371	64
219	3300007788	Ga0099795_10582153	Ga0099795_105821532	64
220	3300009093	Ga0105240_10191658	Ga0105240_101916582	64
221	3300009093	Ga0105240_10324418	Ga0105240_103244182	64
222	3300009176	Ga0105242_12708341	Ga0105242_127083411	64
223	3300009545	Ga0105237_10009459	Ga0105237_100094592	64
224	3300009551	Ga0105238_10042163	Ga0105238_100421634	64
225	3300010159	Ga0099796_10099859	Ga0099796_100998593	64
226	3300010159	Ga0099796_10449268	Ga0099796_104492682	64
227	3300010159	Ga0099796_10488364	Ga0099796_104883642	64
228	3300010375	Ga0105239_10092082	Ga0105239_100920822	64
229	3300010375	Ga0105239_11688536	Ga0105239_116885362	64
230	3300013104	Ga0157370_10033076	Ga0157370_100330763	64
231	3300013104	Ga0157370_10236548	Ga0157370_102365482	64
232	3300013105	Ga0157369_10020222	Ga0157369_100202226	64
233	3300013296	Ga0157374_11217297	Ga0157374_112172972	64
234	3300013308	Ga0157375_10311595	Ga0157375_103115952	64
235	3300014325	Ga0163163_12305764	Ga0163163_123057641	64
236	3300014325	Ga0163163_12392051	Ga0163163_123920512	64
237	3300014326	Ga0157380_10718299	Ga0157380_107182992	64
238	3300014326	Ga0157380_13051145	Ga0157380_130511452	64
239	3300014968	Ga0157379_10030495	Ga0157379_100304955	64
240	3300014968	Ga0157379_12189921	Ga0157379_121899212	64
241	3300015262	Ga0182007_10113349	Ga0182007_101133492	64
242	3300025321	Ga0207656_10021601	Ga0207656_100216014	64
243	3300025908	Ga0207643_11097190	Ga0207643_110971902	64
244	3300025909	Ga0207705_10070756	Ga0207705_100707562	64
245	3300025909	Ga0207705_10308085	Ga0207705_103080853	64
246	3300025912	Ga0207707_10356282	Ga0207707_103562822	64
247	3300025912	Ga0207707_10856894	Ga0207707_108568941	64
248	3300025913	Ga0207695_10198435	Ga0207695_101984352	64
249	3300025913	Ga0207695_10444438	Ga0207695_104444382	64
250	3300025914	Ga0207671_10581576	Ga0207671_105815763	64
251	3300025914	Ga0207671_11348361	Ga0207671_113483612	64
252	3300025915	Ga0207693_10288080	Ga0207693_102880802	64
253	3300025915	Ga0207693_10674346	Ga0207693_106743461	64
254	3300025916	Ga0207663_10418780	Ga0207663_104187802	64
255	3300025917	Ga0207660_10129939	Ga0207660_101299392	64
256	3300025919	Ga0207657_10045002	Ga0207657_100450022	64
257	3300025919	Ga0207657_10049943	Ga0207657_100499435	64
258	3300025920	Ga0207649_10122700	Ga0207649_101227003	64
259	3300025921	Ga0207652_10054934	Ga0207652_100549344	64
260	3300025921	Ga0207652_11073599	Ga0207652_110735992	64
261	3300025924	Ga0207694_10028657	Ga0207694_100286575	64
262	3300025926	Ga0207659_10756175	Ga0207659_107561751	64
263	3300025928	Ga0207700_11265115	Ga0207700_112651152	64
264	3300025928	Ga0207700_12046890	Ga0207700_120468901	64
265	3300025929	Ga0207664_10030282	Ga0207664_100302822	64
266	3300025929	Ga0207664_10664490	Ga0207664_106644902	64
267	3300025932	Ga0207690_11147254	Ga0207690_111472542	64
268	3300025932	Ga0207690_11268785	Ga0207690_112687852	64
269	3300025936	Ga0207670_11101383	Ga0207670_111013832	64
270	3300025940	Ga0207691_10451453	Ga0207691_104514532	64
271	3300025944	Ga0207661_10039770	Ga0207661_100397705	64
272	3300025944	Ga0207661_10518632	Ga0207661_105186322	64
273	3300025945	Ga0207679_11348479	Ga0207679_113484792	64
274	3300025945	Ga0207679_11900931	Ga0207679_119009312	64
275	3300025949	Ga0207667_10015667	Ga0207667_100156675	64
276	3300026035	Ga0207703_10542379	Ga0207703_105423792	64
277	3300026041	Ga0207639_10025158	Ga0207639_100251584	64
278	3300026067	Ga0207678_10301203	Ga0207678_103012032	64
279	3300026078	Ga0207702_11135451	Ga0207702_111354512	64
280	3300026116	Ga0207674_10026810	Ga0207674_100268103	64
281	3300026121	Ga0207683_10145877	Ga0207683_101458773	64
282	3300027671	Ga0209588_1035809	Ga0209588_10358092	64
283	3300028380	Ga0268265_12314333	Ga0268265_123143332	64
284	3300028573	Ga0265334_10072254	Ga0265334_100722542	64
285	3300031249	Ga0265339_10169434	Ga0265339_101694342	64
286	3300031344	Ga0265316_10743918	Ga0265316_107439182	64
287	3300031616	Ga0307508_10082442	Ga0307508_100824422	64
288	3300031711	Ga0265314_10048393	Ga0265314_100483934	64
289	3300034817	Ga0373948_0044939	Ga0373948_0044939_723_917	64
290	3300035088	Ga0373940_0022317	Ga0373940_0022317_23_217	64
291	3300035112	Ga0373932_0371740	Ga0373932_0371740_314_508	64
292	3300035115	Ga0373941_0424261	Ga0373941_0424261_41_235	64
293	3300035117	Ga0373953_0038438	Ga0373953_0038438_1504_1698	64
294	3300035118	Ga0373954_0025507	Ga0373954_0025507_259_453	64
295	3300035119	Ga0373956_0239441	Ga0373956_0239441_180_374	64
296	3300035121	Ga0373960_0121626	Ga0373960_0121626_80_274	64
297	3300035172	Ga0373955_0562907	Ga0373955_0562907_278_472	64
298	3300035410	Ga0373924_0326336	Ga0373924_0326336_300_494	64
299	3300035691	Ga0373931_0606438	Ga0373931_0606438_221_415	64
300	3300035695	Ga0373927_0006210	Ga0373927_0006210_140_343	64
301	3300035724	Ga0373933_0061940	Ga0373933_0061940_36_230	64
302	3300035725	Ga0373947_0081471	Ga0373947_0081471_414_617	64
303	3300036401	Ga0373937_0748770	Ga0373937_0748770_301_495	64
304	3300046462	Ga0495651_0033717	Ga0495651_0033717_2160_2354	64
305	3300046462	Ga0495651_0434771	Ga0495651_0434771_256_462	64
306	3300046463	Ga0495653_0076069	Ga0495653_0076069_906_1100	64
307	3300046463	Ga0495653_0597528	Ga0495653_0597528_96_290	64
308	3300046463	Ga0495653_0826276	Ga0495653_0826276_39_245	64
309	3300046475	Ga0495639_0530533	Ga0495639_0530533_153_356	64
310	3300046511	Ga0495608_0799351	Ga0495608_0799351_221_415	64
311	3300046512	Ga0495610_0078871	Ga0495610_0078871_56_250	64
312	3300046514	Ga0495618_0017687	Ga0495618_0017687_1799_1993	64
313	3300046514	Ga0495618_0572773	Ga0495618_0572773_100_294	64
314	3300046516	Ga0495628_0884523	Ga0495628_0884523_44_250	64
315	3300046517	Ga0495630_0177406	Ga0495630_0177406_16_210	64
316	3300046524	Ga0495648_0001338	Ga0495648_0001338_15740_15934	64
317	3300046529	Ga0495652_0339692	Ga0495652_0339692_13_207	64
318	3300046529	Ga0495652_0342525	Ga0495652_0342525_16_210	64
319	3300046535	Ga0495586_0081288	Ga0495586_0081288_1536_1730	64
320	3300046543	Ga0495645_0066043	Ga0495645_0066043_306_500	64
321	3300046616	Ga0495668_0526516	Ga0495668_0526516_372_572	64
322	3300046663	Ga0495635_0013429	Ga0495635_0013429_5258_5452	64
323	3300046675	Ga0495657_0201046	Ga0495657_0201046_44_238	64
324	3300046678	Ga0495599_0276736	Ga0495599_0276736_103_297	64
325	3300046679	Ga0495623_0042380	Ga0495623_0042380_1510_1704	64
326	3300046680	Ga0495646_0120134	Ga0495646_0120134_995_1189	64
327	3300046680	Ga0495646_0163991	Ga0495646_0163991_293_514	64
328	3300046689	Ga0495613_0817476	Ga0495613_0817476_342_545	64
329	3300046690	Ga0495624_0561831	Ga0495624_0561831_293_508	64
330	3300046809	Ga0495600_0038931	Ga0495600_0038931_2878_3072	64
331	3300047315	Ga0495581_0090430	Ga0495581_0090430_159_353	64
332	3300047315	Ga0495581_0388786	Ga0495581_0388786_335_550	64
333	3300047317	Ga0495604_0058814	Ga0495604_0058814_430_624	64
334	3300047319	Ga0495674_0565884	Ga0495674_0565884_430_624	64
335	3300047322	Ga0495680_0202494	Ga0495680_0202494_186_380	64
336	3300047444	Ga0495675_0020845	Ga0495675_0020845_1852_2046	64
337	3300047471	Ga0495684_0080412	Ga0495684_0080412_2024_2218	64
338	3300048088	Ga0495602_0887875	Ga0495602_0887875_107_313	64
339	3300048903	Ga0496100_0166881	Ga0496100_0166881_280_474	64
340	3300048904	Ga0496101_0025580	Ga0496101_0025580_2442_2636	64
341	3300048904	Ga0496101_0433349	Ga0496101_0433349_191_391	64
342	3300048905	Ga0496102_0010925	Ga0496102_0010925_5669_5863	64
343	3300048907	Ga0496104_0007603	Ga0496104_0007603_3647_3841	64
344	3300048907	Ga0496104_0332935	Ga0496104_0332935_520_714	64
345	3300048907	Ga0496104_0829942	Ga0496104_0829942_244_444	64
346	3300048908	Ga0496105_0168281	Ga0496105_0168281_1449_1643	64
347	3300048908	Ga0496105_1256419	Ga0496105_1256419_328_522	64
348	3300048909	Ga0496106_0075237	Ga0496106_0075237_274_468	64
349	3300048911	Ga0496108_0032197	Ga0496108_0032197_3898_4092	64
350	3300048911	Ga0496108_0357637	Ga0496108_0357637_680_874	64
351	3300048912	Ga0496109_0031112	Ga0496109_0031112_3748_3942	64
352	3300048912	Ga0496109_1741893	Ga0496109_1741893_303_497	64
353	3300048913	Ga0496110_0024772	Ga0496110_0024772_4846_5040	64
354	3300048913	Ga0496110_0262882	Ga0496110_0262882_711_905	64
355	3300048913	Ga0496110_0893702	Ga0496110_0893702_419_613	64
356	3300048914	Ga0496111_0832899	Ga0496111_0832899_83_277	64
357	3300048915	Ga0496112_0008050	Ga0496112_0008050_1541_1735	64
358	3300048915	Ga0496112_0829763	Ga0496112_0829763_632_826	64
359	3300048916	Ga0496113_0011196	Ga0496113_0011196_4156_4350	64
360	3300048916	Ga0496113_1074651	Ga0496113_1074651_218_418	64
361	3300048917	Ga0496114_0104873	Ga0496114_0104873_221_415	64
362	3300048918	Ga0496115_0090669	Ga0496115_0090669_435_629	64
363	3300048918	Ga0496115_0220529	Ga0496115_0220529_414_608	64
364	3300048918	Ga0496115_1200756	Ga0496115_1200756_160_354	64
365	3300048929	Ga0496126_0670404	Ga0496126_0670404_172_366	64
366	3300048929	Ga0496126_0934232	Ga0496126_0934232_186_392	64
367	3300048929	Ga0496126_1280594	Ga0496126_1280594_37_288	64
368	3300049568	Ga0501031_0668450	Ga0501031_0668450_287_484	64
369	3300049569	Ga0501032_0402293	Ga0501032_0402293_288_485	64
370	3300049570	Ga0501033_0017612	Ga0501033_0017612_592_789	64
371	3300049570	Ga0501033_0586412	Ga0501033_0586412_322_519	64
372	3300049570	Ga0501033_0660649	Ga0501033_0660649_10_207	64
373	3300049572	Ga0501036_0227536	Ga0501036_0227536_721_918	64
374	3300049573	Ga0501037_0218880	Ga0501037_0218880_123_320	64
375	3300049574	Ga0501038_1015520	Ga0501038_1015520_160_357	64
376	3300049575	Ga0501039_0219892	Ga0501039_0219892_246_443	64
377	3300049579	Ga0501043_0055601	Ga0501043_0055601_2492_2689	64
378	3300049581	Ga0501047_0602191	Ga0501047_0602191_160_357	64
379	3300049582	Ga0501048_0378211	Ga0501048_0378211_519_716	64
380	3300049583	Ga0501067_0277154	Ga0501067_0277154_324_521	64
381	3300049584	Ga0501068_0587276	Ga0501068_0587276_374_571	64
382	3300049586	Ga0501070_0259267	Ga0501070_0259267_835_1032	64
383	3300049587	Ga0501071_0846036	Ga0501071_0846036_356_553	64
384	3300049588	Ga0501072_0209104	Ga0501072_0209104_1315_1512	64
385	3300049589	Ga0501073_0426390	Ga0501073_0426390_186_383	64
386	3300049741	Ga0501079_0189763	Ga0501079_0189763_1271_1468	64
387	3300049742	Ga0501080_0707724	Ga0501080_0707724_125_322	64
388	3300049744	Ga0501083_0681023	Ga0501083_0681023_271_468	64
389	3300049822	Ga0501035_0152799	Ga0501035_0152799_1562_1759	64
390	3300049823	Ga0501044_0170741	Ga0501044_0170741_751_948	64
391	3300049823	Ga0501044_0271722	Ga0501044_0271722_869_1066	64
392	3300053077	Ga0495601_0091029	Ga0495601_0091029_1024_1218	64
393	3300053077	Ga0495601_0513075	Ga0495601_0513075_430_636	64
394	3300053078	Ga0495612_0104781	Ga0495612_0104781_954_1157	64
395	3300053083	Ga0495655_0252178	Ga0495655_0252178_236_430	64
396	3300053084	Ga0495595_0331842	Ga0495595_0331842_387_608	64
397	3300053085	Ga0495619_0033418	Ga0495619_0033418_3010_3204	64
398	3300053085	Ga0495619_1091026	Ga0495619_1091026_285_479	64
399	3300053136	Ga0500559_0573158	Ga0500559_0573158_184_426	64
400	3300060353	Ga0501082_1203743	Ga0501082_1203743_165_362	64

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03884

YacG

DNA gyrase inhibitor YacG

28

75

0.92 Feature Viewer

pLDDT	pTM	Quality
68.83	0.48	Low

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F434604

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03884

YacG

DNA gyrase inhibitor YacG

28

75

0.92

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map