F434585

General Info

Members Datasets Scaffolds Average Seq Length
400 154 800 483

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10000993|Ga0207657_1000099316
Length 527
Sequence MGRALGRRALNDADRVGAPGDRPPDAEMASLARGGRLNAFGFVLRLAGMVPFLFIGGRIYGAAALGRFAYAVLAVEFAAQIAALGLRRGLAQLLANGKKPQSCIVADAMLVAAIASAVGTAILVLFPKAMYPTTDVHGLDRLLAITVLAISWTDIALAALAYRDDVASTVRARSIVQPWTITIVALGWSFISLDDGLIIAYVLSMVAALFAALIPLVRSFGLPHDWKPDLGTSLATAWRNVPLAAADAVEWASRRIDLAVLGAFMPASFVGIYYAAQQVATLPAKLKTSFEPVLGPAIVRRIAAGDLASVAKQVRQVTYWIIAAQLGIALALGIPGRVVMGLVGSDFTGGTAMLGFLLAAEVIAATAFVSEAALIYLARTKNMILSLVMLALEAGLAAGLILIMRGDGFPQSYQATGPAIGLCIALAFASVSKSWLLRRKVHAPVSGWRWDLAWATAAGVAVGGATHFLLPEALQLILGVPGIMLAFFAVLWTKGFGPEDRELFRLRKHEVSNLRAAETAQGRDEIV

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
153 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 7.5
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10000993 3300025919 Bacteria 30099
2 JGI24741J21665_1004020 3300001915 Bacteria 3353
3 JGI24740J21852_10008511 3300001979 Bacteria 4084
4 JGI24739J22299_10002798 3300001989 Bacteria 6699
5 JGI24739J22299_10014227 3300001989 Bacteria 2895
6 JGI24737J22298_10000280 3300001990 Bacteria 16885
7 JGI24737J22298_10000312 3300001990 Bacteria 16238
8 JGI24737J22298_10011715 3300001990 Bacteria 2869
9 JGI24735J21928_10009476 3300002067 Bacteria 3126
10 Ga0070658_10000003 3300005327 Bacteria 465963
11 Ga0070658_10002573 3300005327 Bacteria 15118
12 Ga0070658_10005948 3300005327 Bacteria 9900
13 Ga0070658_10015912 3300005327 Bacteria 6015
14 Ga0070658_10033606 3300005327 Bacteria 4127
15 Ga0070658_10039107 3300005327 Bacteria 3826
16 Ga0070658_10154536 3300005327 Bacteria 1923
17 Ga0070683_100024820 3300005329 Bacteria 5375
18 Ga0070683_100025503 3300005329 Bacteria 5310
19 Ga0070690_100051237 3300005330 Bacteria 2635
20 Ga0070670_100010204 3300005331 Bacteria 8015
21 Ga0070670_100033592 3300005331 Bacteria 4418
22 Ga0070670_100084573 3300005331 Bacteria 2726
23 Ga0070666_10001711 3300005335 Bacteria 13383
24 Ga0070666_10002819 3300005335 Bacteria 10500
25 Ga0070666_10011103 3300005335 Bacteria 5646
26 Ga0070680_100001660 3300005336 Bacteria 16265
27 Ga0070680_100009095 3300005336 Bacteria 7617
28 Ga0070680_100043371 3300005336 Bacteria 3654
29 Ga0070680_100072601 3300005336 Bacteria 2828
30 Ga0070682_100016384 3300005337 Bacteria 4308
31 Ga0068868_100069470 3300005338 Bacteria 2807
32 Ga0068868_100110087 3300005338 Bacteria 2237
33 Ga0070660_100000348 3300005339 Bacteria 30900
34 Ga0070660_100000884 3300005339 Bacteria 20031
35 Ga0070660_100001472 3300005339 Bacteria 16114
36 Ga0070660_100001821 3300005339 Bacteria 14639
37 Ga0070660_100019604 3300005339 Bacteria 4959
38 Ga0070660_100029299 3300005339 Bacteria 4124
39 Ga0070660_100083373 3300005339 Bacteria 2511
40 Ga0070661_100000354 3300005344 Bacteria 36155
41 Ga0070661_100013921 3300005344 Bacteria 5653
42 Ga0070661_100014227 3300005344 Bacteria 5605
43 Ga0070661_100086305 3300005344 Bacteria 2320
44 Ga0070661_100096894 3300005344 Bacteria 2189
45 Ga0070661_100125035 3300005344 Bacteria 1929
46 Ga0070692_10031806 3300005345 Bacteria 2648
47 Ga0070669_100064276 3300005353 Bacteria 2702
48 Ga0070671_100001012 3300005355 Bacteria 20660
49 Ga0070671_100002229 3300005355 Bacteria 14965
50 Ga0070671_100010664 3300005355 Bacteria 7376
51 Ga0070671_100018493 3300005355 Bacteria 5661
52 Ga0070674_100058807 3300005356 Bacteria 2674
53 Ga0070673_100000158 3300005364 Bacteria 32576
54 Ga0070659_100001147 3300005366 Bacteria 19333
55 Ga0070659_100003189 3300005366 Bacteria 11677
56 Ga0070659_100016594 3300005366 Bacteria 5530
57 Ga0070659_100056755 3300005366 Bacteria 3088
58 Ga0070659_100076085 3300005366 Bacteria 2677
59 Ga0070659_100088433 3300005366 Bacteria 2481
60 Ga0070667_100022418 3300005367 Bacteria 5237
61 Ga0070667_100079332 3300005367 Bacteria 2806
62 Ga0070667_100099744 3300005367 Bacteria 2507
63 Ga0070709_10004365 3300005434 Bacteria 7623
64 Ga0070714_100033738 3300005435 Bacteria 4282
65 Ga0070713_100014122 3300005436 Bacteria 5917
66 Ga0070694_100000834 3300005444 Bacteria 17307
67 Ga0070663_100001738 3300005455 Bacteria 12103
68 Ga0070663_100002671 3300005455 Bacteria 10103
69 Ga0070663_100010167 3300005455 Bacteria 5856
70 Ga0070663_100021791 3300005455 Bacteria 4268
71 Ga0070663_100024086 3300005455 Bacteria 4091
72 Ga0070663_100025240 3300005455 Bacteria 4011
73 Ga0070678_100009612 3300005456 Bacteria 5871
74 Ga0070662_100000017 3300005457 Bacteria 105478
75 Ga0070662_100002050 3300005457 Bacteria 12347
76 Ga0070662_100025630 3300005457 Bacteria 4074
77 Ga0070662_100025960 3300005457 Bacteria 4051
78 Ga0070662_100035841 3300005457 Bacteria 3506
79 Ga0068867_100020821 3300005459 Bacteria 4676
80 Ga0070684_100037826 3300005535 Bacteria 4142
81 Ga0070684_100098982 3300005535 Bacteria 2602
82 Ga0070684_100163365 3300005535 Bacteria 2021
83 Ga0068853_100000938 3300005539 Bacteria 20422
84 Ga0068853_100092372 3300005539 Bacteria 2662
85 Ga0068853_100096182 3300005539 Bacteria 2612
86 Ga0070672_100015112 3300005543 Bacteria 5487
87 Ga0070672_100019295 3300005543 Bacteria 4946
88 Ga0070695_100092339 3300005545 Bacteria 2023
89 Ga0070665_100000590 3300005548 Bacteria 50563
90 Ga0070665_100002680 3300005548 Bacteria 19346
91 Ga0068855_100000194 3300005563 Bacteria 78505
92 Ga0068855_100002571 3300005563 Bacteria 22364
93 Ga0068855_100156859 3300005563 Bacteria 2585
94 Ga0068855_100175533 3300005563 Bacteria 2425
95 Ga0070664_100000128 3300005564 Bacteria 50589
96 Ga0070664_100012070 3300005564 Bacteria 7020
97 Ga0070664_100061422 3300005564 Bacteria 3202
98 Ga0070664_100070811 3300005564 Bacteria 2987
99 Ga0070664_100182602 3300005564 Bacteria 1865
100 Ga0068857_100076202 3300005577 Bacteria 2991
101 Ga0068854_100002336 3300005578 Bacteria 11699
102 Ga0068854_100026824 3300005578 Bacteria 3963
103 Ga0068856_100002384 3300005614 Bacteria 19340
104 Ga0068856_100019567 3300005614 Bacteria 6572
105 Ga0068856_100026065 3300005614 Bacteria 5701
106 Ga0068856_100029281 3300005614 Bacteria 5379
107 Ga0068852_100007475 3300005616 Bacteria 7974
108 Ga0068852_100019416 3300005616 Bacteria 5379
109 Ga0068852_100025201 3300005616 Bacteria 4816
110 Ga0068852_100034689 3300005616 Bacteria 4201
111 Ga0068852_100104819 3300005616 Bacteria 2560
112 Ga0068852_100151340 3300005616 Bacteria 2158
113 Ga0068859_100022657 3300005617 Bacteria 6297
114 Ga0068859_100025365 3300005617 Bacteria 5948
115 Ga0068864_100001223 3300005618 Bacteria 21337
116 Ga0068864_100003096 3300005618 Bacteria 13743
117 Ga0068864_100010295 3300005618 Bacteria 7722
118 Ga0068864_100011234 3300005618 Bacteria 7399
119 Ga0068851_10018850 3300005834 Bacteria 3329
120 Ga0068863_100015094 3300005841 Bacteria 7420
121 Ga0068863_100040861 3300005841 Bacteria 4409
122 Ga0068858_100000537 3300005842 Bacteria 39482
123 Ga0068858_100030058 3300005842 Bacteria 5045
124 Ga0068860_100000674 3300005843 Bacteria 39467
125 Ga0068860_100082941 3300005843 Bacteria 3048
126 Ga0068860_100186715 3300005843 Bacteria 2005
127 Ga0081539_10006734 3300005985 Bacteria 10812
128 Ga0070717_10002447 3300006028 Bacteria 13108
129 Ga0097621_100001132 3300006237 Bacteria 18531
130 Ga0097621_100068992 3300006237 Bacteria 2918
131 Ga0068871_100015863 3300006358 Bacteria 5655
132 Ga0097620_100022659 3300006931 Bacteria 6297
133 Ga0097620_100025365 3300006931 Bacteria 5948
134 Ga0105240_10035654 3300009093 Bacteria 6409
135 Ga0105245_10175055 3300009098 Bacteria 2046
136 Ga0105243_10171835 3300009148 Bacteria 1878
137 Ga0105242_10052105 3300009176 Bacteria 3338
138 Ga0105248_10000206 3300009177 Bacteria 67932
139 Ga0105248_10000626 3300009177 Bacteria 40130
140 Ga0105248_10017710 3300009177 Bacteria 7858
141 Ga0105249_10001854 3300009553 Bacteria 18363
142 Ga0105239_10076055 3300010375 Bacteria 3692
143 Ga0157373_10024555 3300013100 Bacteria 4365
144 Ga0157371_10000892 3300013102 Bacteria 33627
145 Ga0157371_10027682 3300013102 Bacteria 4110
146 Ga0157371_10029323 3300013102 Bacteria 3981
147 Ga0157371_10029621 3300013102 Bacteria 3956
148 Ga0157370_10002704 3300013104 Bacteria 21244
149 Ga0157370_10163915 3300013104 Bacteria 2068
150 Ga0157370_10198931 3300013104 Bacteria 1859
151 Ga0157369_10029067 3300013105 Bacteria 6111
152 Ga0157369_10043167 3300013105 Bacteria 4915
153 Ga0157369_10120256 3300013105 Bacteria 2787
154 Ga0157369_10122677 3300013105 Bacteria 2756
155 Ga0157369_10233605 3300013105 Bacteria 1922
156 Ga0157374_10001881 3300013296 Bacteria 17636
157 Ga0157374_10011179 3300013296 Bacteria 7759
158 Ga0163162_10000299 3300013306 Bacteria 45521
159 Ga0163162_10010106 3300013306 Bacteria 9175
160 Ga0163162_10044779 3300013306 Bacteria 4433
161 Ga0157372_10077035 3300013307 Bacteria 3765
162 Ga0157372_10100363 3300013307 Bacteria 3303
163 Ga0157375_10002179 3300013308 Bacteria 16935
164 Ga0157375_10026542 3300013308 Bacteria 5400
165 Ga0163163_10000454 3300014325 Bacteria 37347
166 Ga0163163_10001414 3300014325 Bacteria 20293
167 Ga0163163_10030575 3300014325 Bacteria 5190
168 Ga0182008_10063929 3300014497 Bacteria 1812
169 Ga0157377_10022018 3300014745 Bacteria 3361
170 Ga0157376_10130225 3300014969 Bacteria 2244
171 Ga0206356_11157753 3300020070 Bacteria 2431
172 Ga0207656_10017843 3300025321 Bacteria 2786
173 Ga0207642_10023995 3300025899 Bacteria 2446
174 Ga0207680_10017949 3300025903 Bacteria 3748
175 Ga0207647_10000767 3300025904 Bacteria 25053
176 Ga0207647_10019458 3300025904 Bacteria 4566
177 Ga0207647_10040050 3300025904 Bacteria 2953
178 Ga0207645_10072409 3300025907 Bacteria 2206
179 Ga0207705_10000005 3300025909 Bacteria 673478
180 Ga0207705_10000033 3300025909 Bacteria 223997
181 Ga0207705_10000137 3300025909 Bacteria 79174
182 Ga0207705_10000419 3300025909 Bacteria 37164
183 Ga0207705_10009208 3300025909 Bacteria 7191
184 Ga0207705_10015859 3300025909 Bacteria 5410
185 Ga0207705_10024487 3300025909 Bacteria 4307
186 Ga0207705_10045201 3300025909 Bacteria 3165
187 Ga0207705_10048287 3300025909 Bacteria 3061
188 Ga0207705_10103384 3300025909 Bacteria 2098
189 Ga0207707_10051228 3300025912 Bacteria 3595
190 Ga0207695_10021658 3300025913 Bacteria 7327
191 Ga0207695_10035282 3300025913 Bacteria 5427
192 Ga0207695_10173128 3300025913 Bacteria 2083
193 Ga0207660_10001233 3300025917 Bacteria 17134
194 Ga0207660_10002059 3300025917 Bacteria 13360
195 Ga0207660_10036329 3300025917 Bacteria 3424
196 Ga0207660_10108667 3300025917 Bacteria 2083
197 Ga0207657_10000159 3300025919 Bacteria 69260
198 Ga0207657_10000398 3300025919 Bacteria 46000
199 Ga0207657_10007717 3300025919 Bacteria 10990
200 Ga0207657_10009035 3300025919 Bacteria 10062
201 Ga0207657_10018894 3300025919 Bacteria 6562
202 Ga0207657_10020384 3300025919 Bacteria 6266
203 Ga0207657_10029505 3300025919 Bacteria 4991
204 Ga0207657_10031351 3300025919 Bacteria 4816
205 Ga0207657_10045081 3300025919 Bacteria 3872
206 Ga0207657_10050091 3300025919 Bacteria 3636
207 Ga0207657_10050435 3300025919 Bacteria 3622
208 Ga0207657_10073472 3300025919 Bacteria 2889
209 Ga0207657_10112712 3300025919 Bacteria 2244
210 Ga0207649_10000186 3300025920 Bacteria 50868
211 Ga0207649_10004748 3300025920 Bacteria 7353
212 Ga0207649_10008625 3300025920 Bacteria 5565
213 Ga0207649_10016222 3300025920 Bacteria 4196
214 Ga0207652_10077159 3300025921 Bacteria 2907
215 Ga0207681_10033706 3300025923 Bacteria 3360
216 Ga0207694_10015281 3300025924 Bacteria 5792
217 Ga0207694_10161264 3300025924 Unclassified 1811
218 Ga0207650_10018429 3300025925 Bacteria 4899
219 Ga0207650_10059471 3300025925 Bacteria 2849
220 Ga0207650_10075943 3300025925 Bacteria 2537
221 Ga0207650_10107543 3300025925 Bacteria 2155
222 Ga0207650_10110378 3300025925 Bacteria 2128
223 Ga0207659_10015715 3300025926 Bacteria 4914
224 Ga0207659_10040191 3300025926 Bacteria 3269
225 Ga0207687_10039674 3300025927 Bacteria 3225
226 Ga0207644_10000052 3300025931 Bacteria 91473
227 Ga0207644_10001777 3300025931 Bacteria 13945
228 Ga0207644_10013446 3300025931 Bacteria 5456
229 Ga0207644_10021440 3300025931 Bacteria 4401
230 Ga0207644_10124644 3300025931 Bacteria 1965
231 Ga0207690_10000118 3300025932 Bacteria 65435
232 Ga0207690_10002945 3300025932 Bacteria 10256
233 Ga0207690_10020520 3300025932 Bacteria 4084
234 Ga0207690_10054080 3300025932 Bacteria 2697
235 Ga0207690_10067035 3300025932 Bacteria 2461
236 Ga0207706_10001030 3300025933 Bacteria 28340
237 Ga0207706_10002927 3300025933 Bacteria 16496
238 Ga0207706_10007897 3300025933 Bacteria 9820
239 Ga0207706_10033922 3300025933 Bacteria 4543
240 Ga0207706_10041155 3300025933 Bacteria 4097
241 Ga0207706_10093898 3300025933 Bacteria 2639
242 Ga0207691_10001938 3300025940 Bacteria 20198
243 Ga0207691_10007404 3300025940 Bacteria 10569
244 Ga0207711_10002376 3300025941 Bacteria 16846
245 Ga0207711_10002816 3300025941 Bacteria 15278
246 Ga0207711_10004637 3300025941 Bacteria 11679
247 Ga0207711_10011297 3300025941 Bacteria 7419
248 Ga0207711_10030619 3300025941 Bacteria 4540
249 Ga0207689_10009458 3300025942 Bacteria 8414
250 Ga0207661_10049894 3300025944 Bacteria 3333
251 Ga0207661_10054853 3300025944 Bacteria 3194
252 Ga0207661_10092471 3300025944 Bacteria 2522
253 Ga0207679_10000114 3300025945 Bacteria 64628
254 Ga0207679_10012478 3300025945 Bacteria 5542
255 Ga0207679_10043718 3300025945 Bacteria 3228
256 Ga0207679_10124599 3300025945 Bacteria 2057
257 Ga0207667_10007324 3300025949 Bacteria 13282
258 Ga0207667_10008406 3300025949 Bacteria 12270
259 Ga0207667_10016175 3300025949 Bacteria 8437
260 Ga0207667_10040308 3300025949 Bacteria 4973
261 Ga0207712_10000846 3300025961 Bacteria 22347
262 Ga0207640_10002727 3300025981 Bacteria 9446
263 Ga0207658_10015534 3300025986 Bacteria 5223
264 Ga0207658_10033669 3300025986 Bacteria 3656
265 Ga0207703_10009374 3300026035 Bacteria 7694
266 Ga0207639_10002762 3300026041 Bacteria 11795
267 Ga0207639_10029646 3300026041 Bacteria 4008
268 Ga0207639_10060164 3300026041 Bacteria 2930
269 Ga0207678_10000589 3300026067 Bacteria 33202
270 Ga0207678_10001542 3300026067 Bacteria 21150
271 Ga0207678_10037327 3300026067 Bacteria 4225
272 Ga0207678_10037974 3300026067 Bacteria 4187
273 Ga0207678_10077261 3300026067 Bacteria 2852
274 Ga0207678_10155979 3300026067 Bacteria 1949
275 Ga0207702_10000074 3300026078 Bacteria 113070
276 Ga0207702_10043145 3300026078 Bacteria 3786
277 Ga0207641_10004567 3300026088 Bacteria 11966
278 Ga0207641_10004589 3300026088 Bacteria 11931
279 Ga0207641_10109121 3300026088 Bacteria 2450
280 Ga0207641_10120853 3300026088 Bacteria 2337
281 Ga0207648_10005427 3300026089 Bacteria 12849
282 Ga0207676_10002456 3300026095 Bacteria 13219
283 Ga0207676_10060886 3300026095 Bacteria 2987
284 Ga0207674_10000655 3300026116 Bacteria 45111
285 Ga0207674_10031307 3300026116 Bacteria 5590
286 Ga0207674_10177342 3300026116 Bacteria 2083
287 Ga0207674_10249905 3300026116 Bacteria 1720
288 Ga0207683_10021581 3300026121 Bacteria 5517
289 Ga0207683_10156365 3300026121 Bacteria 2059
290 Ga0207698_10019870 3300026142 Bacteria 4610
291 Ga0207698_10040898 3300026142 Bacteria 3450
292 Ga0207698_10109148 3300026142 Bacteria 2315
293 Ga0268266_10000200 3300028379 Bacteria 104456
294 Ga0268266_10038954 3300028379 Bacteria 4047
295 Ga0268266_10054485 3300028379 Bacteria 3436
296 Ga0268264_10000268 3300028381 Bacteria 91477
297 Ga0268264_10160141 3300028381 Bacteria 2027
298 Ga0307405_10013615 3300031731 Bacteria 4344
299 Ga0307413_10028580 3300031824 Bacteria 3108
300 Ga0307410_10035026 3300031852 Bacteria 3257
301 Ga0307410_10050420 3300031852 Bacteria 2799
302 Ga0307410_10069000 3300031852 Bacteria 2444
303 Ga0307406_10049038 3300031901 Bacteria 2671
304 Ga0307416_100000426 3300032002 Bacteria 21506
305 Ga0395899_0000340 3300037312 Bacteria 58575
306 Ga0395899_0002223 3300037312 Bacteria 15903
307 Ga0395899_0014956 3300037312 Bacteria 5919
308 Ga0395899_0029070 3300037312 Bacteria 4157
309 Ga0395899_0062391 3300037312 Bacteria 2745
310 Ga0395900_0000794 3300037418 Bacteria 41709
311 Ga0395900_0003608 3300037418 Bacteria 16633
312 Ga0395900_0045446 3300037418 Bacteria 4523
313 Ga0395900_0064704 3300037418 Bacteria 3757
314 Ga0395900_0107750 3300037418 Bacteria 2862
315 Ga0395900_0192825 3300037418 Bacteria 2066
316 Ga0395900_0200194 3300037418 Bacteria 2021
317 Ga0395898_0018807 3300037466 Bacteria 7039
318 Ga0395898_0030693 3300037466 Bacteria 5376
319 Ga0395898_0090460 3300037466 Bacteria 2945
320 Ga0395898_0183860 3300037466 Bacteria 1997
321 Ga0395905_0003327 3300037471 Bacteria 17251
322 Ga0395905_0006461 3300037471 Bacteria 11798
323 Ga0395905_0010073 3300037471 Bacteria 9214
324 Ga0395905_0021302 3300037471 Bacteria 6132
325 Ga0395905_0032140 3300037471 Bacteria 4936
326 Ga0395905_0044284 3300037471 Bacteria 4176
327 Ga0395905_0044496 3300037471 Bacteria 4167
328 Ga0395905_0053229 3300037471 Bacteria 3788
329 Ga0395905_0074184 3300037471 Bacteria 3188
330 Ga0395905_0079068 3300037471 Bacteria 3082
331 Ga0395905_0119664 3300037471 Bacteria 2475
332 Ga0395901_0000031 3300038443 Bacteria 241733
333 Ga0395901_0000086 3300038443 Bacteria 125359
334 Ga0395901_0001078 3300038443 Bacteria 29167
335 Ga0395901_0003537 3300038443 Bacteria 15744
336 Ga0395901_0005395 3300038443 Bacteria 12938
337 Ga0395901_0019766 3300038443 Bacteria 6887
338 Ga0395901_0041011 3300038443 Bacteria 4796
339 Ga0395901_0050881 3300038443 Bacteria 4305
340 Ga0395901_0090899 3300038443 Bacteria 3195
341 Ga0395901_0188275 3300038443 Bacteria 2164
342 Ga0395901_0262442 3300038443 Bacteria 1797
343 Ga0466969_0003254 3300044656 Bacteria 8637
344 Ga0466963_0000969 3300044694 Bacteria 14738
345 Ga0466963_0006887 3300044694 Bacteria 6761
346 Ga0466971_0004226 3300044719 Bacteria 6189
347 Ga0466957_0000546 3300044842 Bacteria 18995
348 Ga0466957_0001015 3300044842 Bacteria 14460
349 Ga0466957_0035917 3300044842 Bacteria 2976
350 Ga0466959_0028245 3300045049 Bacteria 4159
351 Ga0466958_0002196 3300045836 Bacteria 9718
352 Ga0466958_0012602 3300045836 Bacteria 4791
353 Ga0466958_0046751 3300045836 Bacteria 2612
354 Ga0466967_0000103 3300045976 Bacteria 30924
355 Ga0466967_0119188 3300045976 Bacteria 2435
356 Ga0466967_0124935 3300045976 Bacteria 2382
357 Ga0466967_0178953 3300045976 Bacteria 1999
358 Ga0495669_0008491 3300046684 Bacteria 4320
359 Ga0496100_0008291 3300048903 Bacteria 5791
360 Ga0496100_0025920 3300048903 Bacteria 3589
361 Ga0496106_0011877 3300048909 Bacteria 6431
362 Ga0496107_0078278 3300048910 Bacteria 2409
363 Ga0496107_0104463 3300048910 Bacteria 2079
364 Ga0496108_0001265 3300048911 Bacteria 19767
365 Ga0496108_0004780 3300048911 Bacteria 10923
366 Ga0496108_0043705 3300048911 Bacteria 3742
367 Ga0496108_0060434 3300048911 Bacteria 3189
368 Ga0496109_0004146 3300048912 Bacteria 12099
369 Ga0496109_0019254 3300048912 Bacteria 6014
370 Ga0496109_0043094 3300048912 Bacteria 4090
371 Ga0496109_0051906 3300048912 Bacteria 3736
372 Ga0496109_0153551 3300048912 Bacteria 2156
373 Ga0496110_0007889 3300048913 Bacteria 8524
374 Ga0496110_0084106 3300048913 Bacteria 2840
375 Ga0496111_0102178 3300048914 Bacteria 2107
376 Ga0496112_0001171 3300048915 Bacteria 19647
377 Ga0496112_0001853 3300048915 Bacteria 16628
378 Ga0496112_0011048 3300048915 Bacteria 8227
379 Ga0496112_0014813 3300048915 Bacteria 7251
380 Ga0496112_0058028 3300048915 Bacteria 3811
381 Ga0496112_0103732 3300048915 Bacteria 2814
382 Ga0496112_0271396 3300048915 Bacteria 1644
383 Ga0496113_0000501 3300048916 Bacteria 19277
384 Ga0496113_0001779 3300048916 Bacteria 12227
385 Ga0496113_0022630 3300048916 Bacteria 4449
386 Ga0496114_0012689 3300048917 Bacteria 6749
387 Ga0496114_0036342 3300048917 Bacteria 4072
388 Ga0496115_0009567 3300048918 Bacteria 7201
389 Ga0501034_0076560 3300049571 Bacteria 3352
390 Ga0501067_0044527 3300049583 Bacteria 2465
391 Ga0501068_0044228 3300049584 Bacteria 2681
392 Ga0501070_0014215 3300049586 Bacteria 6699
393 Ga0501071_0159525 3300049587 Bacteria 1685
394 nmdc:mga08y16_131480_c1 3300050511 Bacteria 2602
395 Ga0500568_0000406 3300053139 Bacteria 32845
396 Ga0500604_0000013 3300053151 Bacteria 92467
397 Ga0500616_0000161 3300053153 Bacteria 111424
398 Ga0500624_000003 3300053157 Bacteria 253364
399 Ga0500637_0002120 3300053178 Bacteria 8706
400 Ga0466962_0004428 3300061719 Bacteria 6728
401 Ga0207657_10000993
402 JGI24741J21665_1004020
403 JGI24740J21852_10008511
404 JGI24739J22299_10002798
405 JGI24739J22299_10014227
406 JGI24737J22298_10000280
407 JGI24737J22298_10000312
408 JGI24737J22298_10011715
409 JGI24735J21928_10009476
410 Ga0070658_10000003
411 Ga0070658_10002573
412 Ga0070658_10005948
413 Ga0070658_10015912
414 Ga0070658_10033606
415 Ga0070658_10039107
416 Ga0070658_10154536
417 Ga0070683_100024820
418 Ga0070683_100025503
419 Ga0070690_100051237
420 Ga0070670_100010204
421 Ga0070670_100033592
422 Ga0070670_100084573
423 Ga0070666_10001711
424 Ga0070666_10002819
425 Ga0070666_10011103
426 Ga0070680_100001660
427 Ga0070680_100009095
428 Ga0070680_100043371
429 Ga0070680_100072601
430 Ga0070682_100016384
431 Ga0068868_100069470
432 Ga0068868_100110087
433 Ga0070660_100000348
434 Ga0070660_100000884
435 Ga0070660_100001472
436 Ga0070660_100001821
437 Ga0070660_100019604
438 Ga0070660_100029299
439 Ga0070660_100083373
440 Ga0070661_100000354
441 Ga0070661_100013921
442 Ga0070661_100014227
443 Ga0070661_100086305
444 Ga0070661_100096894
445 Ga0070661_100125035
446 Ga0070692_10031806
447 Ga0070669_100064276
448 Ga0070671_100001012
449 Ga0070671_100002229
450 Ga0070671_100010664
451 Ga0070671_100018493
452 Ga0070674_100058807
453 Ga0070673_100000158
454 Ga0070659_100001147
455 Ga0070659_100003189
456 Ga0070659_100016594
457 Ga0070659_100056755
458 Ga0070659_100076085
459 Ga0070659_100088433
460 Ga0070667_100022418
461 Ga0070667_100079332
462 Ga0070667_100099744
463 Ga0070709_10004365
464 Ga0070714_100033738
465 Ga0070713_100014122
466 Ga0070694_100000834
467 Ga0070663_100001738
468 Ga0070663_100002671
469 Ga0070663_100010167
470 Ga0070663_100021791
471 Ga0070663_100024086
472 Ga0070663_100025240
473 Ga0070678_100009612
474 Ga0070662_100000017
475 Ga0070662_100002050
476 Ga0070662_100025630
477 Ga0070662_100025960
478 Ga0070662_100035841
479 Ga0068867_100020821
480 Ga0070684_100037826
481 Ga0070684_100098982
482 Ga0070684_100163365
483 Ga0068853_100000938
484 Ga0068853_100092372
485 Ga0068853_100096182
486 Ga0070672_100015112
487 Ga0070672_100019295
488 Ga0070695_100092339
489 Ga0070665_100000590
490 Ga0070665_100002680
491 Ga0068855_100000194
492 Ga0068855_100002571
493 Ga0068855_100156859
494 Ga0068855_100175533
495 Ga0070664_100000128
496 Ga0070664_100012070
497 Ga0070664_100061422
498 Ga0070664_100070811
499 Ga0070664_100182602
500 Ga0068857_100076202
501 Ga0068854_100002336
502 Ga0068854_100026824
503 Ga0068856_100002384
504 Ga0068856_100019567
505 Ga0068856_100026065
506 Ga0068856_100029281
507 Ga0068852_100007475
508 Ga0068852_100019416
509 Ga0068852_100025201
510 Ga0068852_100034689
511 Ga0068852_100104819
512 Ga0068852_100151340
513 Ga0068859_100022657
514 Ga0068859_100025365
515 Ga0068864_100001223
516 Ga0068864_100003096
517 Ga0068864_100010295
518 Ga0068864_100011234
519 Ga0068851_10018850
520 Ga0068863_100015094
521 Ga0068863_100040861
522 Ga0068858_100000537
523 Ga0068858_100030058
524 Ga0068860_100000674
525 Ga0068860_100082941
526 Ga0068860_100186715
527 Ga0081539_10006734
528 Ga0070717_10002447
529 Ga0097621_100001132
530 Ga0097621_100068992
531 Ga0068871_100015863
532 Ga0097620_100022659
533 Ga0097620_100025365
534 Ga0105240_10035654
535 Ga0105245_10175055
536 Ga0105243_10171835
537 Ga0105242_10052105
538 Ga0105248_10000206
539 Ga0105248_10000626
540 Ga0105248_10017710
541 Ga0105249_10001854
542 Ga0105239_10076055
543 Ga0157373_10024555
544 Ga0157371_10000892
545 Ga0157371_10027682
546 Ga0157371_10029323
547 Ga0157371_10029621
548 Ga0157370_10002704
549 Ga0157370_10163915
550 Ga0157370_10198931
551 Ga0157369_10029067
552 Ga0157369_10043167
553 Ga0157369_10120256
554 Ga0157369_10122677
555 Ga0157369_10233605
556 Ga0157374_10001881
557 Ga0157374_10011179
558 Ga0163162_10000299
559 Ga0163162_10010106
560 Ga0163162_10044779
561 Ga0157372_10077035
562 Ga0157372_10100363
563 Ga0157375_10002179
564 Ga0157375_10026542
565 Ga0163163_10000454
566 Ga0163163_10001414
567 Ga0163163_10030575
568 Ga0182008_10063929
569 Ga0157377_10022018
570 Ga0157376_10130225
571 Ga0206356_11157753
572 Ga0207656_10017843
573 Ga0207642_10023995
574 Ga0207680_10017949
575 Ga0207647_10000767
576 Ga0207647_10019458
577 Ga0207647_10040050
578 Ga0207645_10072409
579 Ga0207705_10000005
580 Ga0207705_10000033
581 Ga0207705_10000137
582 Ga0207705_10000419
583 Ga0207705_10009208
584 Ga0207705_10015859
585 Ga0207705_10024487
586 Ga0207705_10045201
587 Ga0207705_10048287
588 Ga0207705_10103384
589 Ga0207707_10051228
590 Ga0207695_10021658
591 Ga0207695_10035282
592 Ga0207695_10173128
593 Ga0207660_10001233
594 Ga0207660_10002059
595 Ga0207660_10036329
596 Ga0207660_10108667
597 Ga0207657_10000159
598 Ga0207657_10000398
599 Ga0207657_10007717
600 Ga0207657_10009035
601 Ga0207657_10018894
602 Ga0207657_10020384
603 Ga0207657_10029505
604 Ga0207657_10031351
605 Ga0207657_10045081
606 Ga0207657_10050091
607 Ga0207657_10050435
608 Ga0207657_10073472
609 Ga0207657_10112712
610 Ga0207649_10000186
611 Ga0207649_10004748
612 Ga0207649_10008625
613 Ga0207649_10016222
614 Ga0207652_10077159
615 Ga0207681_10033706
616 Ga0207694_10015281
617 Ga0207694_10161264
618 Ga0207650_10018429
619 Ga0207650_10059471
620 Ga0207650_10075943
621 Ga0207650_10107543
622 Ga0207650_10110378
623 Ga0207659_10015715
624 Ga0207659_10040191
625 Ga0207687_10039674
626 Ga0207644_10000052
627 Ga0207644_10001777
628 Ga0207644_10013446
629 Ga0207644_10021440
630 Ga0207644_10124644
631 Ga0207690_10000118
632 Ga0207690_10002945
633 Ga0207690_10020520
634 Ga0207690_10054080
635 Ga0207690_10067035
636 Ga0207706_10001030
637 Ga0207706_10002927
638 Ga0207706_10007897
639 Ga0207706_10033922
640 Ga0207706_10041155
641 Ga0207706_10093898
642 Ga0207691_10001938
643 Ga0207691_10007404
644 Ga0207711_10002376
645 Ga0207711_10002816
646 Ga0207711_10004637
647 Ga0207711_10011297
648 Ga0207711_10030619
649 Ga0207689_10009458
650 Ga0207661_10049894
651 Ga0207661_10054853
652 Ga0207661_10092471
653 Ga0207679_10000114
654 Ga0207679_10012478
655 Ga0207679_10043718
656 Ga0207679_10124599
657 Ga0207667_10007324
658 Ga0207667_10008406
659 Ga0207667_10016175
660 Ga0207667_10040308
661 Ga0207712_10000846
662 Ga0207640_10002727
663 Ga0207658_10015534
664 Ga0207658_10033669
665 Ga0207703_10009374
666 Ga0207639_10002762
667 Ga0207639_10029646
668 Ga0207639_10060164
669 Ga0207678_10000589
670 Ga0207678_10001542
671 Ga0207678_10037327
672 Ga0207678_10037974
673 Ga0207678_10077261
674 Ga0207678_10155979
675 Ga0207702_10000074
676 Ga0207702_10043145
677 Ga0207641_10004567
678 Ga0207641_10004589
679 Ga0207641_10109121
680 Ga0207641_10120853
681 Ga0207648_10005427
682 Ga0207676_10002456
683 Ga0207676_10060886
684 Ga0207674_10000655
685 Ga0207674_10031307
686 Ga0207674_10177342
687 Ga0207674_10249905
688 Ga0207683_10021581
689 Ga0207683_10156365
690 Ga0207698_10019870
691 Ga0207698_10040898
692 Ga0207698_10109148
693 Ga0268266_10000200
694 Ga0268266_10038954
695 Ga0268266_10054485
696 Ga0268264_10000268
697 Ga0268264_10160141
698 Ga0307405_10013615
699 Ga0307413_10028580
700 Ga0307410_10035026
701 Ga0307410_10050420
702 Ga0307410_10069000
703 Ga0307406_10049038
704 Ga0307416_100000426
705 Ga0395899_0000340
706 Ga0395899_0002223
707 Ga0395899_0014956
708 Ga0395899_0029070
709 Ga0395899_0062391
710 Ga0395900_0000794
711 Ga0395900_0003608
712 Ga0395900_0045446
713 Ga0395900_0064704
714 Ga0395900_0107750
715 Ga0395900_0192825
716 Ga0395900_0200194
717 Ga0395898_0018807
718 Ga0395898_0030693
719 Ga0395898_0090460
720 Ga0395898_0183860
721 Ga0395905_0003327
722 Ga0395905_0006461
723 Ga0395905_0010073
724 Ga0395905_0021302
725 Ga0395905_0032140
726 Ga0395905_0044284
727 Ga0395905_0044496
728 Ga0395905_0053229
729 Ga0395905_0074184
730 Ga0395905_0079068
731 Ga0395905_0119664
732 Ga0395901_0000031
733 Ga0395901_0000086
734 Ga0395901_0001078
735 Ga0395901_0003537
736 Ga0395901_0005395
737 Ga0395901_0019766
738 Ga0395901_0041011
739 Ga0395901_0050881
740 Ga0395901_0090899
741 Ga0395901_0188275
742 Ga0395901_0262442
743 Ga0466969_0003254
744 Ga0466963_0000969
745 Ga0466963_0006887
746 Ga0466971_0004226
747 Ga0466957_0000546
748 Ga0466957_0001015
749 Ga0466957_0035917
750 Ga0466959_0028245
751 Ga0466958_0002196
752 Ga0466958_0012602
753 Ga0466958_0046751
754 Ga0466967_0000103
755 Ga0466967_0119188
756 Ga0466967_0124935
757 Ga0466967_0178953
758 Ga0495669_0008491
759 Ga0496100_0008291
760 Ga0496100_0025920
761 Ga0496106_0011877
762 Ga0496107_0078278
763 Ga0496107_0104463
764 Ga0496108_0001265
765 Ga0496108_0004780
766 Ga0496108_0043705
767 Ga0496108_0060434
768 Ga0496109_0004146
769 Ga0496109_0019254
770 Ga0496109_0043094
771 Ga0496109_0051906
772 Ga0496109_0153551
773 Ga0496110_0007889
774 Ga0496110_0084106
775 Ga0496111_0102178
776 Ga0496112_0001171
777 Ga0496112_0001853
778 Ga0496112_0011048
779 Ga0496112_0014813
780 Ga0496112_0058028
781 Ga0496112_0103732
782 Ga0496112_0271396
783 Ga0496113_0000501
784 Ga0496113_0001779
785 Ga0496113_0022630
786 Ga0496114_0012689
787 Ga0496114_0036342
788 Ga0496115_0009567
789 Ga0501034_0076560
790 Ga0501067_0044527
791 Ga0501068_0044228
792 Ga0501070_0014215
793 Ga0501071_0159525
794 nmdc:mga08y16_131480_c1
795 Ga0500568_0000406
796 Ga0500604_0000013
797 Ga0500616_0000161
798 Ga0500624_000003
799 Ga0500637_0002120
800 Ga0466962_0004428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7waw-assembly1.cif.gz_A murj inward closed form 0.6855 30 454
7waw-assembly1.cif.gz_A murj inward closed form 0.6061 30 454
5c6n-assembly1.cif.gz_A protein a 0.5545 26 408
6fhz-assembly1.cif.gz_A inward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.5132 30 401
5c6o-assembly1.cif.gz_A protein b 0.5046 25 408
ID Description Score Start End Superfamily
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3997 204 389 1.10.357.20
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3993 205 391 1.10.357.20
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3922 204 389 1.10.357.20
af_Q4DBB5_96_268_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.385 205 391 1.10.357.20
af_Q2FZQ5_283_457_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3499 207 392 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A838VEM1-F1-model_v4 Lipopolysaccharide biosynthesis protein 0.9368 224 467 GO:0016020
AF-A0A6G6XDF1-F1-model_v4 Lipopolysaccharide biosynthesis protein 0.9003 24 467 GO:0005886
AF-A0A838VEM1-F1-model_v4 Lipopolysaccharide biosynthesis protein 0.8279 224 467 GO:0016020
AF-A0A6G6XDF1-F1-model_v4 Lipopolysaccharide biosynthesis protein 0.8184 24 467 GO:0005886
AF-A0A1E5LDJ6-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.8149 20 471 GO:0005886

Map