F434334

General Info

Members Datasets Scaffolds Average Seq Length
399 222 399 97

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0800454|Ga0373925_0800454_337_678
Length 113
Sequence LRKQHCLSGMMGKKRFVMILEHAILSIKPGQSEAFERAMREARPLIAATPGFKKIEVLPCVETRDRYLLLVWWDTLEAHTEGFRKSERYEPWRKLLHHFYEPFPLVEHYGEPI

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
220 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.52
Nodule 0
Rhizoplane 1.25
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10023468 3300005327 Bacteria 4950
2 Ga0070676_10635454 3300005328 Unclassified 773
3 Ga0068869_100494622 3300005334 Bacteria 1020
4 Ga0070682_100804258 3300005337 Unclassified 764
5 Ga0068868_100061804 3300005338 Bacteria 2967
6 Ga0070689_100513953 3300005340 Bacteria 1027
7 Ga0070691_10000657 3300005341 Bacteria 13392
8 Ga0070691_10558720 3300005341 Unclassified 670
9 Ga0070661_100000201 3300005344 Bacteria 49297
10 Ga0070661_100712593 3300005344 Unclassified 818
11 Ga0070674_102179469 3300005356 Bacteria 506
12 Ga0070673_100071408 3300005364 Bacteria 2789
13 Ga0070673_102130967 3300005364 Bacteria 533
14 Ga0070709_10390759 3300005434 Bacteria 1036
15 Ga0070709_10924655 3300005434 Bacteria 691
16 Ga0070714_100175046 3300005435 Bacteria 1950
17 Ga0070713_100000220 3300005436 Bacteria 37998
18 Ga0070713_100288742 3300005436 Bacteria 1507
19 Ga0070713_100306727 3300005436 Unclassified 1463
20 Ga0070713_101485106 3300005436 Unclassified 658
21 Ga0070710_10273164 3300005437 Bacteria 1094
22 Ga0070711_100019791 3300005439 Bacteria 4325
23 Ga0070711_100113328 3300005439 Bacteria 1994
24 Ga0070694_100479895 3300005444 Bacteria 986
25 Ga0070678_100028497 3300005456 Bacteria 3810
26 Ga0070678_100029718 3300005456 Plasmid 3746
27 Ga0070678_100626076 3300005456 Unclassified 963
28 Ga0070678_102159626 3300005456 Bacteria 528
29 Ga0070681_10166422 3300005458 Bacteria 2127
30 Ga0068867_100000054 3300005459 Bacteria 69032
31 Ga0068867_100011947 3300005459 Bacteria 6135
32 Ga0068867_100465594 3300005459 Bacteria 1080
33 Ga0070706_100343981 3300005467 Bacteria 1391
34 Ga0070706_100579523 3300005467 Bacteria 1043
35 Ga0070699_100209892 3300005518 Bacteria 1733
36 Ga0070699_100684851 3300005518 Bacteria 936
37 Ga0070679_100129575 3300005530 Bacteria 2504
38 Ga0070684_100088349 3300005535 Bacteria 2753
39 Ga0068853_100098776 3300005539 Bacteria 2578
40 Ga0068853_100297209 3300005539 Bacteria 1492
41 Ga0070672_100043310 3300005543 Plasmid 3470
42 Ga0070672_100989270 3300005543 Bacteria 745
43 Ga0070693_100489091 3300005547 Unclassified 871
44 Ga0070693_101337728 3300005547 Unclassified 555
45 Ga0070665_100001966 3300005548 Bacteria 23115
46 Ga0070665_100306625 3300005548 Unclassified 1591
47 Ga0070665_100439563 3300005548 Bacteria 1314
48 Ga0068855_100263619 3300005563 Unclassified 1919
49 Ga0068855_100387130 3300005563 Bacteria 1534
50 Ga0068855_100425674 3300005563 Bacteria 1451
51 Ga0070664_100195716 3300005564 Bacteria 1802
52 Ga0070664_100862851 3300005564 Bacteria 848
53 Ga0068857_100000580 3300005577 Bacteria 26732
54 Ga0068857_101187164 3300005577 Bacteria 739
55 Ga0068857_101862106 3300005577 Unclassified 589
56 Ga0068854_100073549 3300005578 Bacteria 2505
57 Ga0068854_100458659 3300005578 Bacteria 1066
58 Ga0068854_100527935 3300005578 Bacteria 998
59 Ga0068856_100001365 3300005614 Bacteria 25675
60 Ga0068856_100004073 3300005614 Bacteria 14620
61 Ga0068856_100222673 3300005614 Bacteria 1902
62 Ga0068856_100227693 3300005614 Unclassified 1880
63 Ga0068856_100286967 3300005614 Bacteria 1663
64 Ga0068856_102086776 3300005614 Bacteria 577
65 Ga0070702_100486541 3300005615 Bacteria 903
66 Ga0068852_100003918 3300005616 Bacteria 10456
67 Ga0068852_100013624 3300005616 Bacteria 6227
68 Ga0068852_100827468 3300005616 Unclassified 941
69 Ga0068866_10173293 3300005718 Unclassified 1268
70 Ga0068858_100430712 3300005842 Bacteria 1269
71 Ga0068860_102549482 3300005843 Unclassified 531
72 Ga0068862_100039399 3300005844 Bacteria 4013
73 Ga0070717_10539679 3300006028 Bacteria 1056
74 Ga0075365_10009015 3300006038 Bacteria 5705
75 Ga0075365_10315088 3300006038 Bacteria 1101
76 Ga0075363_100044922 3300006048 Bacteria 2342
77 Ga0075364_10623839 3300006051 Bacteria 737
78 Ga0075364_10973655 3300006051 Bacteria 577
79 Ga0070715_10508048 3300006163 Unclassified 691
80 Ga0070716_100069429 3300006173 Bacteria 2065
81 Ga0070712_100000225 3300006175 Bacteria 31850
82 Ga0070712_100001273 3300006175 Bacteria 15215
83 Ga0070712_100125240 3300006175 Bacteria 1940
84 Ga0070712_101159887 3300006175 Unclassified 671
85 Ga0075362_10033375 3300006177 Bacteria 2238
86 Ga0075367_10046205 3300006178 Bacteria 2558
87 Ga0075367_10248380 3300006178 Bacteria 1116
88 Ga0075367_10647575 3300006178 Bacteria 672
89 Ga0075366_10451885 3300006195 Bacteria 793
90 Ga0097621_100106083 3300006237 Unclassified 2370
91 Ga0097621_100427215 3300006237 Unclassified 1190
92 Ga0097621_100595510 3300006237 Bacteria 1010
93 Ga0097621_102263512 3300006237 Bacteria 520
94 Ga0075370_10944744 3300006353 Bacteria 528
95 Ga0068871_100014233 3300006358 Bacteria 5924
96 Ga0068871_100260056 3300006358 Bacteria 1514
97 Ga0068871_100274566 3300006358 Unclassified 1473
98 Ga0068871_101031835 3300006358 Unclassified 767
99 Ga0068871_102423427 3300006358 Unclassified 500
100 Ga0075428_101239165 3300006844 Bacteria 786
101 Ga0068865_100014053 3300006881 Bacteria 5080
102 Ga0075436_100000742 3300006914 Bacteria 21647
103 Ga0075436_100050160 3300006914 Bacteria 2879
104 Ga0075435_100034467 3300007076 Bacteria 4012
105 Ga0075435_100245611 3300007076 Bacteria 1523
106 Ga0105240_10020620 3300009093 Bacteria 8787
107 Ga0105240_10044561 3300009093 Bacteria 5636
108 Ga0105240_10547080 3300009093 Bacteria 1281
109 Ga0105240_11578877 3300009093 Unclassified 687
110 Ga0111539_13334254 3300009094 Bacteria 517
111 Ga0105245_10533576 3300009098 Bacteria 1194
112 Ga0105243_10003877 3300009148 Bacteria 11952
113 Ga0105243_10103992 3300009148 Bacteria 2363
114 Ga0105243_10351649 3300009148 Unclassified 1353
115 Ga0105241_10043223 3300009174 Bacteria 3412
116 Ga0105241_10457443 3300009174 Bacteria 1130
117 Ga0105241_11391331 3300009174 Bacteria 671
118 Ga0105241_12344982 3300009174 Unclassified 532
119 Ga0105242_10582736 3300009176 Bacteria 1078
120 Ga0105242_10789723 3300009176 Unclassified 939
121 Ga0105248_10567800 3300009177 Unclassified 1280
122 Ga0105248_12818465 3300009177 Unclassified 554
123 Ga0105237_10081197 3300009545 Bacteria 3233
124 Ga0105237_10118156 3300009545 Bacteria 2645
125 Ga0105237_10553036 3300009545 Bacteria 1157
126 Ga0105237_10831099 3300009545 Bacteria 930
127 Ga0105237_11588747 3300009545 Unclassified 661
128 Ga0105238_10021077 3300009551 Bacteria 6641
129 Ga0105238_10064693 3300009551 Bacteria 3657
130 Ga0105238_10115407 3300009551 Bacteria 2665
131 Ga0105238_10889708 3300009551 Unclassified 908
132 Ga0105238_11102042 3300009551 Unclassified 817
133 Ga0105249_10032594 3300009553 Bacteria 4714
134 Ga0105239_10238088 3300010375 Bacteria 2043
135 Ga0105239_10948887 3300010375 Unclassified 988
136 Ga0105239_12944543 3300010375 Unclassified 555
137 Ga0105246_10130179 3300011119 Bacteria 1878
138 Ga0105246_10531955 3300011119 Bacteria 1004
139 Ga0157373_10007111 3300013100 Bacteria 8342
140 Ga0157373_10968849 3300013100 Unclassified 634
141 Ga0157370_10009324 3300013104 Bacteria 10507
142 Ga0157370_10072751 3300013104 Bacteria 3243
143 Ga0157370_10122943 3300013104 Unclassified 2423
144 Ga0157369_10011732 3300013105 Bacteria 9949
145 Ga0157369_10121219 3300013105 Bacteria 2775
146 Ga0157369_12137735 3300013105 Unclassified 568
147 Ga0157374_10032313 3300013296 Plasmid 4763
148 Ga0157374_10529064 3300013296 Bacteria 1185
149 Ga0157374_12425506 3300013296 Bacteria 552
150 Ga0157378_10177400 3300013297 Bacteria 2002
151 Ga0157378_10820692 3300013297 Bacteria 957
152 Ga0157378_12174149 3300013297 Unclassified 606
153 Ga0163162_10032454 3300013306 Bacteria 5188
154 Ga0163162_10171582 3300013306 Bacteria 2294
155 Ga0163162_10415791 3300013306 Bacteria 1477
156 Ga0157372_10573710 3300013307 Bacteria 1315
157 Ga0157372_11729214 3300013307 Bacteria 719
158 Ga0157375_10003486 3300013308 Bacteria 13639
159 Ga0163163_10000006 3300014325 Bacteria 320401
160 Ga0163163_10375026 3300014325 Unclassified 1480
161 Ga0163163_11378510 3300014325 Bacteria 767
162 Ga0182008_10614577 3300014497 Unclassified 612
163 Ga0157377_10000006 3300014745 Bacteria 419853
164 Ga0157379_10006614 3300014968 Bacteria 9999
165 Ga0157379_10017674 3300014968 Bacteria 6282
166 Ga0157379_10049957 3300014968 Unclassified 3734
167 Ga0157379_10058409 3300014968 Bacteria 3449
168 Ga0157379_10105635 3300014968 Bacteria 2527
169 Ga0157379_10293579 3300014968 Bacteria 1481
170 Ga0157376_10123464 3300014969 Unclassified 2299
171 Ga0163161_10010732 3300017792 Bacteria 6346
172 Ga0207642_10370208 3300025899 Unclassified 850
173 Ga0207680_11110057 3300025903 Unclassified 565
174 Ga0207699_10000486 3300025906 Bacteria 20131
175 Ga0207699_10075990 3300025906 Bacteria 2068
176 Ga0207699_11006427 3300025906 Bacteria 616
177 Ga0207645_10195473 3300025907 Bacteria 1330
178 Ga0207705_10016781 3300025909 Bacteria 5244
179 Ga0207684_10465269 3300025910 Bacteria 1085
180 Ga0207654_10034128 3300025911 Bacteria 2825
181 Ga0207654_10209736 3300025911 Unclassified 1287
182 Ga0207695_10008252 3300025913 Bacteria 13071
183 Ga0207695_10055163 3300025913 Bacteria 4143
184 Ga0207695_10395846 3300025913 Bacteria 1266
185 Ga0207671_10246398 3300025914 Bacteria 1404
186 Ga0207693_10000669 3300025915 Bacteria 30788
187 Ga0207693_10003391 3300025915 Bacteria 13612
188 Ga0207693_10095110 3300025915 Bacteria 2335
189 Ga0207663_10008543 3300025916 Bacteria 5363
190 Ga0207660_10588286 3300025917 Bacteria 906
191 Ga0207657_10160622 3300025919 Bacteria 1825
192 Ga0207649_10000507 3300025920 Bacteria 27452
193 Ga0207649_10728715 3300025920 Unclassified 770
194 Ga0207652_10234934 3300025921 Bacteria 1652
195 Ga0207694_10066200 3300025924 Bacteria 2818
196 Ga0207694_10097642 3300025924 Bacteria 2324
197 Ga0207694_10371697 3300025924 Bacteria 1186
198 Ga0207694_10624950 3300025924 Unclassified 907
199 Ga0207694_10885924 3300025924 Unclassified 755
200 Ga0207650_10236882 3300025925 Bacteria 1474
201 Ga0207687_10175302 3300025927 Bacteria 1657
202 Ga0207700_10000191 3300025928 Bacteria 36677
203 Ga0207700_10236038 3300025928 Unclassified 1557
204 Ga0207700_10564743 3300025928 Bacteria 1011
205 Ga0207700_10880438 3300025928 Unclassified 801
206 Ga0207664_10018156 3300025929 Bacteria 5170
207 Ga0207664_10409403 3300025929 Bacteria 1207
208 Ga0207690_10552875 3300025932 Bacteria 936
209 Ga0207686_10296270 3300025934 Bacteria 1200
210 Ga0207686_11246574 3300025934 Unclassified 609
211 Ga0207709_10002987 3300025935 Bacteria 10295
212 Ga0207704_10016058 3300025938 Plasmid 3837
213 Ga0207711_10553021 3300025941 Bacteria 1073
214 Ga0207689_10094322 3300025942 Bacteria 2458
215 Ga0207661_10420261 3300025944 Bacteria 1214
216 Ga0207679_10257763 3300025945 Bacteria 1486
217 Ga0207679_11078674 3300025945 Bacteria 737
218 Ga0207667_10010974 3300025949 Bacteria 10559
219 Ga0207667_10357140 3300025949 Unclassified 1490
220 Ga0207667_10371589 3300025949 Unclassified 1457
221 Ga0207667_10535784 3300025949 Bacteria 1185
222 Ga0207651_10031761 3300025960 Bacteria 3381
223 Ga0207712_11110932 3300025961 Unclassified 704
224 Ga0207640_10033570 3300025981 Bacteria 3195
225 Ga0207640_10639479 3300025981 Bacteria 905
226 Ga0207703_10065893 3300026035 Bacteria 2978
227 Ga0207639_10009240 3300026041 Bacteria 6795
228 Ga0207639_10798419 3300026041 Unclassified 879
229 Ga0207702_10000977 3300026078 Bacteria 29283
230 Ga0207702_10020355 3300026078 Bacteria 5496
231 Ga0207702_10261375 3300026078 Bacteria 1630
232 Ga0207641_10179077 3300026088 Unclassified 1940
233 Ga0207648_10000713 3300026089 Bacteria 37240
234 Ga0207648_10020882 3300026089 Bacteria 5896
235 Ga0207676_10533349 3300026095 Bacteria 1119
236 Ga0207674_10000904 3300026116 Bacteria 38685
237 Ga0207674_11702887 3300026116 Unclassified 599
238 Ga0207683_10008941 3300026121 Bacteria 8532
239 Ga0207683_10038305 3300026121 Bacteria 4178
240 Ga0207683_10109158 3300026121 Bacteria 2476
241 Ga0207698_10002827 3300026142 Bacteria 10389
242 Ga0207698_11665505 3300026142 Bacteria 653
243 Ga0268266_10000531 3300028379 Bacteria 53279
244 Ga0268266_10011001 3300028379 Bacteria 7874
245 Ga0268266_10232980 3300028379 Bacteria 1697
246 Ga0268266_10727647 3300028379 Bacteria 957
247 Ga0268265_10096993 3300028380 Bacteria 2371
248 Ga0268264_12586904 3300028381 Unclassified 512
249 Ga0265338_10029309 3300028800 Bacteria 5457
250 Ga0265338_11168613 3300028800 Unclassified 517
251 Ga0265330_10321670 3300031235 Bacteria 653
252 Ga0265332_10136586 3300031238 Bacteria 1028
253 Ga0265320_10000482 3300031240 Bacteria 31136
254 Ga0265325_10000330 3300031241 Bacteria 33410
255 Ga0265325_10058691 3300031241 Bacteria 1959
256 Ga0265325_10250601 3300031241 Bacteria 802
257 Ga0265325_10398003 3300031241 Bacteria 603
258 Ga0265340_10145246 3300031247 Bacteria 1083
259 Ga0265339_10152347 3300031249 Bacteria 1168
260 Ga0265331_10000106 3300031250 Bacteria 113406
261 Ga0265331_10002286 3300031250 Bacteria 13075
262 Ga0265327_10000176 3300031251 Bacteria 137002
263 Ga0265316_10136634 3300031344 Bacteria 1844
264 Ga0307408_100067592 3300031548 Bacteria 2629
265 Ga0265313_10005675 3300031595 Bacteria 9109
266 Ga0265313_10140615 3300031595 Bacteria 1038
267 Ga0265313_10215155 3300031595 Bacteria 794
268 Ga0265314_10010451 3300031711 Bacteria 7743
269 Ga0265314_10546625 3300031711 Bacteria 603
270 Ga0265314_10578932 3300031711 Unclassified 581
271 Ga0307516_10000394 3300031730 Bacteria 57048
272 Ga0307405_10012189 3300031731 Bacteria 4539
273 Ga0307412_10267161 3300031911 Bacteria 1337
274 Ga0373949_0303161 3300035090 Bacteria 507
275 Ga0373932_0048522 3300035112 Unclassified 1252
276 Ga0373936_0035546 3300035113 Bacteria 1984
277 Ga0373954_0174328 3300035118 Bacteria 1054
278 Ga0373956_0183066 3300035119 Bacteria 991
279 Ga0373955_0045699 3300035172 Bacteria 2364
280 Ga0373955_0281464 3300035172 Bacteria 1001
281 Ga0373935_1338874 3300035692 Unclassified 535
282 Ga0373927_0079774 3300035695 Bacteria 2121
283 Ga0373927_1175094 3300035695 Unclassified 506
284 Ga0373933_0006151 3300035724 Bacteria 6534
285 Ga0373933_0799417 3300035724 Unclassified 621
286 Ga0373947_0287978 3300035725 Bacteria 1093
287 Ga0373937_0005406 3300036401 Bacteria 10926
288 Ga0373937_1091113 3300036401 Bacteria 747
289 Ga0373925_0144940 3300037068 Bacteria 1861
290 Ga0373925_0800454 3300037068 Bacteria 777
291 Ga0395899_0473161 3300037312 Unclassified 817
292 Ga0395898_0022862 3300037466 Bacteria 6324
293 Ga0395905_0002033 3300037471 Bacteria 23120
294 Ga0436365_1233798 3300039437 Bacteria 1030
295 Ga0436363_0169097 3300039450 Bacteria 2820
296 Ga0436363_0409508 3300039450 Bacteria 617
297 Ga0436363_1395958 3300039450 Unclassified 785
298 Ga0436363_1592976 3300039450 Bacteria 1808
299 Ga0439466_0087555 3300041411 Bacteria 978
300 Ga0451802_0182438 3300041460 Bacteria 581
301 Ga0451577_0010473 3300042876 Bacteria 8857
302 Ga0466963_0431006 3300044694 Bacteria 930
303 Ga0466963_1238751 3300044694 Bacteria 524
304 Ga0466964_0292119 3300044706 Bacteria 819
305 Ga0453684_0003387 3300044712 Bacteria 36051
306 Ga0453684_0032302 3300044712 Bacteria 7331
307 Ga0466957_0216593 3300044842 Bacteria 1263
308 Ga0466957_0870738 3300044842 Unclassified 643
309 Ga0451576_0763885 3300045051 Bacteria 1015
310 Ga0466967_0963442 3300045976 Unclassified 849
311 Ga0466967_1802628 3300045976 Bacteria 609
312 Ga0495580_0279033 3300046472 Unclassified 1140
313 Ga0495606_0219000 3300046507 Bacteria 1074
314 Ga0495608_0537904 3300046511 Unclassified 705
315 Ga0495618_0234880 3300046514 Bacteria 1154
316 Ga0495620_0407430 3300046515 Bacteria 515
317 Ga0495645_0411437 3300046543 Bacteria 860
318 Ga0495667_0303818 3300046559 Bacteria 1011
319 Ga0495588_0494530 3300046674 Unclassified 641
320 Ga0495599_0530129 3300046678 Bacteria 691
321 Ga0495602_0757298 3300048088 Unclassified 655
322 Ga0496102_1068738 3300048905 Unclassified 727
323 Ga0496104_0386299 3300048907 Bacteria 1312
324 Ga0496111_0500872 3300048914 Bacteria 894
325 Ga0496112_1623606 3300048915 Unclassified 560
326 Ga0501031_0247790 3300049568 Unclassified 1158
327 Ga0501032_0355444 3300049569 Bacteria 944
328 Ga0501033_0064293 3300049570 Bacteria 2700
329 Ga0501033_0064588 3300049570 Plasmid 2693
330 Ga0501033_0117112 3300049570 Bacteria 1935
331 Ga0501033_0961718 3300049570 Bacteria 572
332 Ga0501034_0091828 3300049571 Unclassified 3033
333 Ga0501036_0259284 3300049572 Unclassified 1456
334 Ga0501036_0292627 3300049572 Bacteria 1362
335 Ga0501038_0053276 3300049574 Bacteria 3484
336 Ga0501039_0212055 3300049575 Unclassified 1523
337 Ga0501039_0381175 3300049575 Bacteria 1108
338 Ga0501042_0566314 3300049578 Unclassified 826
339 Ga0501043_0027248 3300049579 Bacteria 4487
340 Ga0501043_0319778 3300049579 Bacteria 1183
341 Ga0501043_0440184 3300049579 Bacteria 981
342 Ga0501043_0501777 3300049579 Bacteria 906
343 Ga0501046_0057496 3300049580 Bacteria 3051
344 Ga0501046_0431931 3300049580 Bacteria 948
345 Ga0501047_0003538 3300049581 Bacteria 14748
346 Ga0501047_0004928 3300049581 Bacteria 12538
347 Ga0501047_0105436 3300049581 Bacteria 2699
348 Ga0501047_0155417 3300049581 Bacteria 2161
349 Ga0501048_0384446 3300049582 Bacteria 1002
350 Ga0501067_0391396 3300049583 Unclassified 775
351 Ga0501067_0871899 3300049583 Unclassified 508
352 Ga0501068_0088846 3300049584 Bacteria 1904
353 Ga0501070_0157261 3300049586 Bacteria 1874
354 Ga0501070_1139426 3300049586 Bacteria 600
355 Ga0501073_0195980 3300049589 Bacteria 1397
356 Ga0501074_0392703 3300049590 Unclassified 984
357 Ga0501076_0231550 3300049592 Bacteria 1510
358 Ga0501079_0602074 3300049741 Bacteria 865
359 Ga0501080_0068612 3300049742 Bacteria 3298
360 Ga0501080_0204397 3300049742 Bacteria 1812
361 Ga0501083_0123618 3300049744 Bacteria 1697
362 Ga0501083_0883661 3300049744 Unclassified 581
363 Ga0501083_0900077 3300049744 Unclassified 576
364 Ga0501035_0074932 3300049822 Bacteria 2993
365 Ga0501035_0118147 3300049822 Bacteria 2320
366 Ga0501035_0137927 3300049822 Bacteria 2122
367 Ga0501035_0146766 3300049822 Bacteria 2048
368 Ga0501035_0704370 3300049822 Unclassified 814
369 Ga0501035_1244907 3300049822 Unclassified 576
370 Ga0501044_0012537 3300049823 Bacteria 9182
371 Ga0501044_0019932 3300049823 Bacteria 7164
372 Ga0501044_0072934 3300049823 Bacteria 3490
373 Ga0501044_0135187 3300049823 Bacteria 2457
374 Ga0501044_0189506 3300049823 Bacteria 2020
375 Ga0501044_0265875 3300049823 Bacteria 1652
376 Ga0501044_0349481 3300049823 Bacteria 1398
377 nmdc:mga03n38_250876_c1 3300050490 Bacteria 935
378 nmdc:mga00v17_315423_c1 3300050491 Bacteria 1016
379 nmdc:mga00v17_706215_c1 3300050491 Bacteria 646
380 nmdc:mga0yw44_686239_c1 3300050492 Bacteria 696
381 nmdc:mga0k408_479807_c1 3300050493 Bacteria 737
382 nmdc:mga06z11_164314_c1 3300050494 Bacteria 1271
383 nmdc:mga06z11_629986_c1 3300050494 Bacteria 653
384 nmdc:mga0n895_827362_c1 3300050512 Unclassified 915
385 nmdc:mga0rr50_200614_c1 3300050513 Bacteria 1639
386 nmdc:mga0rr50_8972_c1 3300050513 Bacteria 6254
387 nmdc:mga08x19_324_c1 3300050514 Bacteria 34497
388 nmdc:mga08x19_40524_c1 3300050514 Bacteria 2964
389 Ga0500643_000003 3300053087 Bacteria 876659
390 Ga0500643_203585 3300053087 Unclassified 531
391 Ga0500641_0061584 3300053096 Bacteria 1564
392 Ga0500594_0086038 3300053118 Bacteria 947
393 Ga0500595_000492 3300053119 Bacteria 24068
394 Ga0500559_0381654 3300053136 Unclassified 657
395 Ga0500573_0304019 3300053140 Bacteria 796
396 Ga0500611_028361 3300053727 Bacteria 1136
397 Ga0590075_020217 3300059424 Bacteria 1657
398 Ga0590077_018917 3300059426 Bacteria 1456
399 Ga0501082_0310757 3300060353 Bacteria 1373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031238 Ga0265332_10136586 Ga0265332_101365862 84
2 3300053087 Ga0500643_000003 Ga0500643_000003_64015_64305 88
3 3300053727 Ga0500611_028361 Ga0500611_028361_305_595 88
4 3300031247 Ga0265340_10145246 Ga0265340_101452462 95
5 3300005327 Ga0070658_10023468 Ga0070658_100234685 96
6 3300005328 Ga0070676_10635454 Ga0070676_106354542 96
7 3300005334 Ga0068869_100494622 Ga0068869_1004946222 96
8 3300005337 Ga0070682_100804258 Ga0070682_1008042581 96
9 3300005338 Ga0068868_100061804 Ga0068868_1000618044 96
10 3300005340 Ga0070689_100513953 Ga0070689_1005139532 96
11 3300005341 Ga0070691_10000657 Ga0070691_100006575 96
12 3300005341 Ga0070691_10558720 Ga0070691_105587202 96
13 3300005344 Ga0070661_100000201 Ga0070661_10000020129 96
14 3300005344 Ga0070661_100712593 Ga0070661_1007125932 96
15 3300005356 Ga0070674_102179469 Ga0070674_1021794691 96
16 3300005364 Ga0070673_100071408 Ga0070673_1000714082 96
17 3300005364 Ga0070673_102130967 Ga0070673_1021309671 96
18 3300005434 Ga0070709_10390759 Ga0070709_103907592 96
19 3300005434 Ga0070709_10924655 Ga0070709_109246552 96
20 3300005435 Ga0070714_100175046 Ga0070714_1001750463 96
21 3300005436 Ga0070713_100000220 Ga0070713_10000022019 96
22 3300005436 Ga0070713_100288742 Ga0070713_1002887422 96
23 3300005436 Ga0070713_100306727 Ga0070713_1003067272 96
24 3300005436 Ga0070713_101485106 Ga0070713_1014851061 96
25 3300005437 Ga0070710_10273164 Ga0070710_102731641 96
26 3300005439 Ga0070711_100019791 Ga0070711_1000197915 96
27 3300005439 Ga0070711_100113328 Ga0070711_1001133285 96
28 3300005444 Ga0070694_100479895 Ga0070694_1004798953 96
29 3300005456 Ga0070678_100028497 Ga0070678_1000284974 96
30 3300005456 Ga0070678_100029718 Ga0070678_1000297185 96
31 3300005456 Ga0070678_100626076 Ga0070678_1006260762 96
32 3300005456 Ga0070678_102159626 Ga0070678_1021596261 96
33 3300005458 Ga0070681_10166422 Ga0070681_101664222 96
34 3300005459 Ga0068867_100000054 Ga0068867_1000000547 96
35 3300005459 Ga0068867_100011947 Ga0068867_1000119473 96
36 3300005459 Ga0068867_100465594 Ga0068867_1004655943 96
37 3300005467 Ga0070706_100343981 Ga0070706_1003439812 96
38 3300005467 Ga0070706_100579523 Ga0070706_1005795231 96
39 3300005518 Ga0070699_100209892 Ga0070699_1002098921 96
40 3300005518 Ga0070699_100684851 Ga0070699_1006848511 96
41 3300005530 Ga0070679_100129575 Ga0070679_1001295752 96
42 3300005535 Ga0070684_100088349 Ga0070684_1000883492 96
43 3300005539 Ga0068853_100098776 Ga0068853_1000987762 96
44 3300005539 Ga0068853_100297209 Ga0068853_1002972092 96
45 3300005543 Ga0070672_100043310 Ga0070672_1000433105 96
46 3300005543 Ga0070672_100989270 Ga0070672_1009892702 96
47 3300005547 Ga0070693_100489091 Ga0070693_1004890912 96
48 3300005547 Ga0070693_101337728 Ga0070693_1013377281 96
49 3300005548 Ga0070665_100001966 Ga0070665_1000019665 96
50 3300005548 Ga0070665_100306625 Ga0070665_1003066253 96
51 3300005548 Ga0070665_100439563 Ga0070665_1004395632 96
52 3300005563 Ga0068855_100263619 Ga0068855_1002636193 96
53 3300005563 Ga0068855_100387130 Ga0068855_1003871302 96
54 3300005563 Ga0068855_100425674 Ga0068855_1004256742 96
55 3300005564 Ga0070664_100195716 Ga0070664_1001957162 96
56 3300005564 Ga0070664_100862851 Ga0070664_1008628512 96
57 3300005577 Ga0068857_100000580 Ga0068857_10000058012 96
58 3300005577 Ga0068857_101187164 Ga0068857_1011871642 96
59 3300005577 Ga0068857_101862106 Ga0068857_1018621062 96
60 3300005578 Ga0068854_100073549 Ga0068854_1000735493 96
61 3300005578 Ga0068854_100458659 Ga0068854_1004586592 96
62 3300005578 Ga0068854_100527935 Ga0068854_1005279353 96
63 3300005614 Ga0068856_100001365 Ga0068856_10000136521 96
64 3300005614 Ga0068856_100004073 Ga0068856_1000040738 96
65 3300005614 Ga0068856_100222673 Ga0068856_1002226733 96
66 3300005614 Ga0068856_100227693 Ga0068856_1002276932 96
67 3300005614 Ga0068856_100286967 Ga0068856_1002869672 96
68 3300005614 Ga0068856_102086776 Ga0068856_1020867762 96
69 3300005615 Ga0070702_100486541 Ga0070702_1004865412 96
70 3300005616 Ga0068852_100003918 Ga0068852_10000391812 96
71 3300005616 Ga0068852_100013624 Ga0068852_1000136245 96
72 3300005616 Ga0068852_100827468 Ga0068852_1008274682 96
73 3300005718 Ga0068866_10173293 Ga0068866_101732931 96
74 3300005842 Ga0068858_100430712 Ga0068858_1004307121 96
75 3300005843 Ga0068860_102549482 Ga0068860_1025494822 96
76 3300005844 Ga0068862_100039399 Ga0068862_1000393995 96
77 3300006028 Ga0070717_10539679 Ga0070717_105396792 96
78 3300006038 Ga0075365_10009015 Ga0075365_100090152 96
79 3300006038 Ga0075365_10315088 Ga0075365_103150884 96
80 3300006048 Ga0075363_100044922 Ga0075363_1000449222 96
81 3300006051 Ga0075364_10623839 Ga0075364_106238391 96
82 3300006051 Ga0075364_10973655 Ga0075364_109736552 96
83 3300006163 Ga0070715_10508048 Ga0070715_105080481 96
84 3300006173 Ga0070716_100069429 Ga0070716_1000694294 96
85 3300006175 Ga0070712_100000225 Ga0070712_10000022524 96
86 3300006175 Ga0070712_100001273 Ga0070712_10000127312 96
87 3300006175 Ga0070712_100125240 Ga0070712_1001252402 96
88 3300006175 Ga0070712_101159887 Ga0070712_1011598872 96
89 3300006177 Ga0075362_10033375 Ga0075362_100333752 96
90 3300006178 Ga0075367_10046205 Ga0075367_100462053 96
91 3300006178 Ga0075367_10248380 Ga0075367_102483802 96
92 3300006178 Ga0075367_10647575 Ga0075367_106475752 96
93 3300006195 Ga0075366_10451885 Ga0075366_104518851 96
94 3300006237 Ga0097621_100106083 Ga0097621_1001060832 96
95 3300006237 Ga0097621_100427215 Ga0097621_1004272152 96
96 3300006237 Ga0097621_100595510 Ga0097621_1005955102 96
97 3300006237 Ga0097621_102263512 Ga0097621_1022635121 96
98 3300006353 Ga0075370_10944744 Ga0075370_109447442 96
99 3300006358 Ga0068871_100014233 Ga0068871_1000142335 96
100 3300006358 Ga0068871_100260056 Ga0068871_1002600562 96
101 3300006358 Ga0068871_100274566 Ga0068871_1002745663 96
102 3300006358 Ga0068871_101031835 Ga0068871_1010318351 96
103 3300006358 Ga0068871_102423427 Ga0068871_1024234272 96
104 3300006844 Ga0075428_101239165 Ga0075428_1012391651 96
105 3300006881 Ga0068865_100014053 Ga0068865_1000140535 96
106 3300006914 Ga0075436_100000742 Ga0075436_1000007426 96
107 3300006914 Ga0075436_100050160 Ga0075436_1000501605 96
108 3300007076 Ga0075435_100034467 Ga0075435_1000344676 96
109 3300007076 Ga0075435_100245611 Ga0075435_1002456113 96
110 3300009093 Ga0105240_10020620 Ga0105240_1002062010 96
111 3300009093 Ga0105240_10044561 Ga0105240_100445614 96
112 3300009093 Ga0105240_10547080 Ga0105240_105470803 96
113 3300009093 Ga0105240_11578877 Ga0105240_115788771 96
114 3300009094 Ga0111539_13334254 Ga0111539_133342541 96
115 3300009098 Ga0105245_10533576 Ga0105245_105335762 96
116 3300009148 Ga0105243_10003877 Ga0105243_100038775 96
117 3300009148 Ga0105243_10103992 Ga0105243_101039923 96
118 3300009148 Ga0105243_10351649 Ga0105243_103516491 96
119 3300009174 Ga0105241_10043223 Ga0105241_100432235 96
120 3300009174 Ga0105241_10457443 Ga0105241_104574432 96
121 3300009174 Ga0105241_11391331 Ga0105241_113913312 96
122 3300009174 Ga0105241_12344982 Ga0105241_123449821 96
123 3300009176 Ga0105242_10582736 Ga0105242_105827362 96
124 3300009176 Ga0105242_10789723 Ga0105242_107897232 96
125 3300009177 Ga0105248_10567800 Ga0105248_105678002 96
126 3300009177 Ga0105248_12818465 Ga0105248_128184652 96
127 3300009545 Ga0105237_10081197 Ga0105237_100811973 96
128 3300009545 Ga0105237_10118156 Ga0105237_101181562 96
129 3300009545 Ga0105237_10553036 Ga0105237_105530362 96
130 3300009545 Ga0105237_10831099 Ga0105237_108310991 96
131 3300009545 Ga0105237_11588747 Ga0105237_115887472 96
132 3300009551 Ga0105238_10021077 Ga0105238_100210774 96
133 3300009551 Ga0105238_10064693 Ga0105238_100646936 96
134 3300009551 Ga0105238_10115407 Ga0105238_101154072 96
135 3300009551 Ga0105238_10889708 Ga0105238_108897082 96
136 3300009551 Ga0105238_11102042 Ga0105238_111020422 96
137 3300009553 Ga0105249_10032594 Ga0105249_100325945 96
138 3300010375 Ga0105239_10238088 Ga0105239_102380884 96
139 3300010375 Ga0105239_10948887 Ga0105239_109488872 96
140 3300010375 Ga0105239_12944543 Ga0105239_129445431 96
141 3300011119 Ga0105246_10130179 Ga0105246_101301793 96
142 3300011119 Ga0105246_10531955 Ga0105246_105319552 96
143 3300013100 Ga0157373_10007111 Ga0157373_100071115 96
144 3300013100 Ga0157373_10968849 Ga0157373_109688491 96
145 3300013104 Ga0157370_10009324 Ga0157370_1000932411 96
146 3300013104 Ga0157370_10072751 Ga0157370_100727513 96
147 3300013104 Ga0157370_10122943 Ga0157370_101229434 96
148 3300013105 Ga0157369_10011732 Ga0157369_100117322 96
149 3300013105 Ga0157369_10121219 Ga0157369_101212193 96
150 3300013105 Ga0157369_12137735 Ga0157369_121377352 96
151 3300013296 Ga0157374_10032313 Ga0157374_100323133 96
152 3300013296 Ga0157374_10529064 Ga0157374_105290642 96
153 3300013296 Ga0157374_12425506 Ga0157374_124255061 96
154 3300013297 Ga0157378_10177400 Ga0157378_101774002 96
155 3300013297 Ga0157378_10820692 Ga0157378_108206922 96
156 3300013297 Ga0157378_12174149 Ga0157378_121741491 96
157 3300013306 Ga0163162_10032454 Ga0163162_100324542 96
158 3300013306 Ga0163162_10171582 Ga0163162_101715824 96
159 3300013306 Ga0163162_10415791 Ga0163162_104157912 96
160 3300013307 Ga0157372_10573710 Ga0157372_105737103 96
161 3300013307 Ga0157372_11729214 Ga0157372_117292142 96
162 3300013308 Ga0157375_10003486 Ga0157375_1000348616 96
163 3300014325 Ga0163163_10000006 Ga0163163_1000000619 96
164 3300014325 Ga0163163_10375026 Ga0163163_103750262 96
165 3300014325 Ga0163163_11378510 Ga0163163_113785102 96
166 3300014497 Ga0182008_10614577 Ga0182008_106145771 96
167 3300014745 Ga0157377_10000006 Ga0157377_10000006339 96
168 3300014968 Ga0157379_10006614 Ga0157379_100066147 96
169 3300014968 Ga0157379_10017674 Ga0157379_100176742 96
170 3300014968 Ga0157379_10049957 Ga0157379_100499575 96
171 3300014968 Ga0157379_10058409 Ga0157379_100584093 96
172 3300014968 Ga0157379_10105635 Ga0157379_101056353 96
173 3300014968 Ga0157379_10293579 Ga0157379_102935794 96
174 3300014969 Ga0157376_10123464 Ga0157376_101234641 96
175 3300017792 Ga0163161_10010732 Ga0163161_100107326 96
176 3300025899 Ga0207642_10370208 Ga0207642_103702081 96
177 3300025903 Ga0207680_11110057 Ga0207680_111100572 96
178 3300025906 Ga0207699_10000486 Ga0207699_100004862 96
179 3300025906 Ga0207699_10075990 Ga0207699_100759902 96
180 3300025906 Ga0207699_11006427 Ga0207699_110064271 96
181 3300025907 Ga0207645_10195473 Ga0207645_101954731 96
182 3300025909 Ga0207705_10016781 Ga0207705_100167815 96
183 3300025910 Ga0207684_10465269 Ga0207684_104652692 96
184 3300025911 Ga0207654_10034128 Ga0207654_100341283 96
185 3300025911 Ga0207654_10209736 Ga0207654_102097362 96
186 3300025913 Ga0207695_10008252 Ga0207695_100082522 96
187 3300025913 Ga0207695_10055163 Ga0207695_100551632 96
188 3300025913 Ga0207695_10395846 Ga0207695_103958462 96
189 3300025914 Ga0207671_10246398 Ga0207671_102463982 96
190 3300025915 Ga0207693_10000669 Ga0207693_1000066919 96
191 3300025915 Ga0207693_10003391 Ga0207693_100033916 96
192 3300025915 Ga0207693_10095110 Ga0207693_100951103 96
193 3300025916 Ga0207663_10008543 Ga0207663_100085435 96
194 3300025917 Ga0207660_10588286 Ga0207660_105882862 96
195 3300025919 Ga0207657_10160622 Ga0207657_101606223 96
196 3300025920 Ga0207649_10000507 Ga0207649_1000050729 96
197 3300025920 Ga0207649_10728715 Ga0207649_107287151 96
198 3300025921 Ga0207652_10234934 Ga0207652_102349342 96
199 3300025924 Ga0207694_10066200 Ga0207694_100662003 96
200 3300025924 Ga0207694_10097642 Ga0207694_100976422 96
201 3300025924 Ga0207694_10371697 Ga0207694_103716971 96
202 3300025924 Ga0207694_10624950 Ga0207694_106249502 96
203 3300025924 Ga0207694_10885924 Ga0207694_108859242 96
204 3300025925 Ga0207650_10236882 Ga0207650_102368823 96
205 3300025927 Ga0207687_10175302 Ga0207687_101753022 96
206 3300025928 Ga0207700_10000191 Ga0207700_1000019120 96
207 3300025928 Ga0207700_10236038 Ga0207700_102360382 96
208 3300025928 Ga0207700_10564743 Ga0207700_105647433 96
209 3300025928 Ga0207700_10880438 Ga0207700_108804382 96
210 3300025929 Ga0207664_10018156 Ga0207664_100181564 96
211 3300025929 Ga0207664_10409403 Ga0207664_104094033 96
212 3300025932 Ga0207690_10552875 Ga0207690_105528752 96
213 3300025934 Ga0207686_10296270 Ga0207686_102962703 96
214 3300025934 Ga0207686_11246574 Ga0207686_112465741 96
215 3300025935 Ga0207709_10002987 Ga0207709_100029875 96
216 3300025938 Ga0207704_10016058 Ga0207704_100160585 96
217 3300025941 Ga0207711_10553021 Ga0207711_105530212 96
218 3300025942 Ga0207689_10094322 Ga0207689_100943223 96
219 3300025944 Ga0207661_10420261 Ga0207661_104202614 96
220 3300025945 Ga0207679_10257763 Ga0207679_102577633 96
221 3300025945 Ga0207679_11078674 Ga0207679_110786742 96
222 3300025949 Ga0207667_10010974 Ga0207667_100109742 96
223 3300025949 Ga0207667_10357140 Ga0207667_103571402 96
224 3300025949 Ga0207667_10371589 Ga0207667_103715891 96
225 3300025949 Ga0207667_10535784 Ga0207667_105357842 96
226 3300025960 Ga0207651_10031761 Ga0207651_100317614 96
227 3300025961 Ga0207712_11110932 Ga0207712_111109321 96
228 3300025981 Ga0207640_10033570 Ga0207640_100335704 96
229 3300025981 Ga0207640_10639479 Ga0207640_106394792 96
230 3300026035 Ga0207703_10065893 Ga0207703_100658934 96
231 3300026041 Ga0207639_10009240 Ga0207639_100092406 96
232 3300026041 Ga0207639_10798419 Ga0207639_107984191 96
233 3300026078 Ga0207702_10000977 Ga0207702_1000097724 96
234 3300026078 Ga0207702_10020355 Ga0207702_100203551 96
235 3300026078 Ga0207702_10261375 Ga0207702_102613753 96
236 3300026088 Ga0207641_10179077 Ga0207641_101790774 96
237 3300026089 Ga0207648_10000713 Ga0207648_1000071315 96
238 3300026089 Ga0207648_10020882 Ga0207648_100208823 96
239 3300026095 Ga0207676_10533349 Ga0207676_105333492 96
240 3300026116 Ga0207674_10000904 Ga0207674_1000090421 96
241 3300026116 Ga0207674_11702887 Ga0207674_117028872 96
242 3300026121 Ga0207683_10008941 Ga0207683_100089414 96
243 3300026121 Ga0207683_10038305 Ga0207683_100383052 96
244 3300026121 Ga0207683_10109158 Ga0207683_101091582 96
245 3300026142 Ga0207698_10002827 Ga0207698_100028275 96
246 3300026142 Ga0207698_11665505 Ga0207698_116655052 96
247 3300028379 Ga0268266_10000531 Ga0268266_1000053131 96
248 3300028379 Ga0268266_10011001 Ga0268266_1001100110 96
249 3300028379 Ga0268266_10232980 Ga0268266_102329802 96
250 3300028379 Ga0268266_10727647 Ga0268266_107276472 96
251 3300028380 Ga0268265_10096993 Ga0268265_100969933 96
252 3300028381 Ga0268264_12586904 Ga0268264_125869042 96
253 3300028800 Ga0265338_10029309 Ga0265338_100293093 96
254 3300028800 Ga0265338_11168613 Ga0265338_111686132 96
255 3300031235 Ga0265330_10321670 Ga0265330_103216702 96
256 3300031240 Ga0265320_10000482 Ga0265320_1000048222 96
257 3300031241 Ga0265325_10000330 Ga0265325_1000033034 96
258 3300031241 Ga0265325_10058691 Ga0265325_100586914 96
259 3300031241 Ga0265325_10250601 Ga0265325_102506011 96
260 3300031241 Ga0265325_10398003 Ga0265325_103980031 96
261 3300031249 Ga0265339_10152347 Ga0265339_101523472 96
262 3300031250 Ga0265331_10000106 Ga0265331_1000010613 96
263 3300031250 Ga0265331_10002286 Ga0265331_100022866 96
264 3300031251 Ga0265327_10000176 Ga0265327_10000176144 96
265 3300031344 Ga0265316_10136634 Ga0265316_101366344 96
266 3300031548 Ga0307408_100067592 Ga0307408_1000675923 96
267 3300031595 Ga0265313_10005675 Ga0265313_100056756 96
268 3300031595 Ga0265313_10140615 Ga0265313_101406153 96
269 3300031595 Ga0265313_10215155 Ga0265313_102151551 96
270 3300031711 Ga0265314_10010451 Ga0265314_100104512 96
271 3300031711 Ga0265314_10546625 Ga0265314_105466252 96
272 3300031711 Ga0265314_10578932 Ga0265314_105789321 96
273 3300031730 Ga0307516_10000394 Ga0307516_1000039446 96
274 3300031731 Ga0307405_10012189 Ga0307405_100121895 96
275 3300031911 Ga0307412_10267161 Ga0307412_102671612 96
276 3300035090 Ga0373949_0303161 Ga0373949_0303161_64_354 96
277 3300035112 Ga0373932_0048522 Ga0373932_0048522_648_938 96
278 3300035113 Ga0373936_0035546 Ga0373936_0035546_1568_1882 96
279 3300035118 Ga0373954_0174328 Ga0373954_0174328_406_696 96
280 3300035119 Ga0373956_0183066 Ga0373956_0183066_167_457 96
281 3300035172 Ga0373955_0045699 Ga0373955_0045699_830_1120 96
282 3300035172 Ga0373955_0281464 Ga0373955_0281464_23_313 96
283 3300035692 Ga0373935_1338874 Ga0373935_1338874_107_397 96
284 3300035695 Ga0373927_0079774 Ga0373927_0079774_337_627 96
285 3300035695 Ga0373927_1175094 Ga0373927_1175094_23_313 96
286 3300035724 Ga0373933_0006151 Ga0373933_0006151_1231_1521 96
287 3300035724 Ga0373933_0799417 Ga0373933_0799417_114_404 96
288 3300035725 Ga0373947_0287978 Ga0373947_0287978_164_454 96
289 3300036401 Ga0373937_0005406 Ga0373937_0005406_7017_7307 96
290 3300036401 Ga0373937_1091113 Ga0373937_1091113_182_472 96
291 3300037068 Ga0373925_0144940 Ga0373925_0144940_705_995 96
292 3300037068 Ga0373925_0800454 Ga0373925_0800454_337_678 96
293 3300037312 Ga0395899_0473161 Ga0395899_0473161_99_389 96
294 3300037466 Ga0395898_0022862 Ga0395898_0022862_2430_2720 96
295 3300037471 Ga0395905_0002033 Ga0395905_0002033_4608_4979 96
296 3300039437 Ga0436365_1233798 Ga0436365_1233798_345_635 96
297 3300039450 Ga0436363_0169097 Ga0436363_0169097_498_788 96
298 3300039450 Ga0436363_0409508 Ga0436363_0409508_40_342 96
299 3300039450 Ga0436363_1395958 Ga0436363_1395958_361_651 96
300 3300039450 Ga0436363_1592976 Ga0436363_1592976_554_856 96
301 3300041411 Ga0439466_0087555 Ga0439466_0087555_25_315 96
302 3300041460 Ga0451802_0182438 Ga0451802_0182438_41_343 96
303 3300042876 Ga0451577_0010473 Ga0451577_0010473_185_487 96
304 3300044694 Ga0466963_0431006 Ga0466963_0431006_351_641 96
305 3300044694 Ga0466963_1238751 Ga0466963_1238751_159_449 96
306 3300044706 Ga0466964_0292119 Ga0466964_0292119_391_681 96
307 3300044712 Ga0453684_0003387 Ga0453684_0003387_14678_14983 96
308 3300044712 Ga0453684_0032302 Ga0453684_0032302_4894_5196 96
309 3300044842 Ga0466957_0216593 Ga0466957_0216593_608_898 96
310 3300044842 Ga0466957_0870738 Ga0466957_0870738_236_526 96
311 3300045051 Ga0451576_0763885 Ga0451576_0763885_488_790 96
312 3300045976 Ga0466967_0963442 Ga0466967_0963442_23_313 96
313 3300045976 Ga0466967_1802628 Ga0466967_1802628_234_524 96
314 3300046472 Ga0495580_0279033 Ga0495580_0279033_786_1076 96
315 3300046507 Ga0495606_0219000 Ga0495606_0219000_467_757 96
316 3300046511 Ga0495608_0537904 Ga0495608_0537904_98_388 96
317 3300046514 Ga0495618_0234880 Ga0495618_0234880_432_722 96
318 3300046515 Ga0495620_0407430 Ga0495620_0407430_117_407 96
319 3300046543 Ga0495645_0411437 Ga0495645_0411437_45_335 96
320 3300046559 Ga0495667_0303818 Ga0495667_0303818_592_882 96
321 3300046674 Ga0495588_0494530 Ga0495588_0494530_62_352 96
322 3300046678 Ga0495599_0530129 Ga0495599_0530129_42_332 96
323 3300048088 Ga0495602_0757298 Ga0495602_0757298_352_642 96
324 3300048905 Ga0496102_1068738 Ga0496102_1068738_101_391 96
325 3300048907 Ga0496104_0386299 Ga0496104_0386299_88_378 96
326 3300048914 Ga0496111_0500872 Ga0496111_0500872_385_675 96
327 3300048915 Ga0496112_1623606 Ga0496112_1623606_254_544 96
328 3300049568 Ga0501031_0247790 Ga0501031_0247790_381_671 96
329 3300049569 Ga0501032_0355444 Ga0501032_0355444_149_439 96
330 3300049570 Ga0501033_0064293 Ga0501033_0064293_1616_1918 96
331 3300049570 Ga0501033_0064588 Ga0501033_0064588_1835_2125 96
332 3300049570 Ga0501033_0117112 Ga0501033_0117112_278_568 96
333 3300049570 Ga0501033_0961718 Ga0501033_0961718_179_502 96
334 3300049571 Ga0501034_0091828 Ga0501034_0091828_514_804 96
335 3300049572 Ga0501036_0259284 Ga0501036_0259284_487_777 96
336 3300049572 Ga0501036_0292627 Ga0501036_0292627_992_1282 96
337 3300049574 Ga0501038_0053276 Ga0501038_0053276_2279_2569 96
338 3300049575 Ga0501039_0212055 Ga0501039_0212055_831_1121 96
339 3300049575 Ga0501039_0381175 Ga0501039_0381175_659_961 96
340 3300049578 Ga0501042_0566314 Ga0501042_0566314_471_761 96
341 3300049579 Ga0501043_0027248 Ga0501043_0027248_3684_3974 96
342 3300049579 Ga0501043_0319778 Ga0501043_0319778_312_614 96
343 3300049579 Ga0501043_0440184 Ga0501043_0440184_250_540 96
344 3300049579 Ga0501043_0501777 Ga0501043_0501777_364_654 96
345 3300049580 Ga0501046_0057496 Ga0501046_0057496_517_807 96
346 3300049580 Ga0501046_0431931 Ga0501046_0431931_101_391 96
347 3300049581 Ga0501047_0003538 Ga0501047_0003538_14020_14310 96
348 3300049581 Ga0501047_0004928 Ga0501047_0004928_12121_12411 96
349 3300049581 Ga0501047_0105436 Ga0501047_0105436_1649_1951 96
350 3300049581 Ga0501047_0155417 Ga0501047_0155417_1140_1430 96
351 3300049582 Ga0501048_0384446 Ga0501048_0384446_201_524 96
352 3300049583 Ga0501067_0391396 Ga0501067_0391396_106_396 96
353 3300049583 Ga0501067_0871899 Ga0501067_0871899_92_382 96
354 3300049584 Ga0501068_0088846 Ga0501068_0088846_763_1053 96
355 3300049586 Ga0501070_0157261 Ga0501070_0157261_827_1117 96
356 3300049586 Ga0501070_1139426 Ga0501070_1139426_105_395 96
357 3300049589 Ga0501073_0195980 Ga0501073_0195980_313_603 96
358 3300049590 Ga0501074_0392703 Ga0501074_0392703_296_586 96
359 3300049592 Ga0501076_0231550 Ga0501076_0231550_1089_1412 96
360 3300049741 Ga0501079_0602074 Ga0501079_0602074_553_843 96
361 3300049742 Ga0501080_0068612 Ga0501080_0068612_470_760 96
362 3300049742 Ga0501080_0204397 Ga0501080_0204397_1500_1790 96
363 3300049744 Ga0501083_0123618 Ga0501083_0123618_1272_1562 96
364 3300049744 Ga0501083_0883661 Ga0501083_0883661_156_446 96
365 3300049744 Ga0501083_0900077 Ga0501083_0900077_93_398 96
366 3300049822 Ga0501035_0074932 Ga0501035_0074932_1372_1674 96
367 3300049822 Ga0501035_0118147 Ga0501035_0118147_312_614 96
368 3300049822 Ga0501035_0137927 Ga0501035_0137927_559_849 96
369 3300049822 Ga0501035_0146766 Ga0501035_0146766_761_1051 96
370 3300049822 Ga0501035_0704370 Ga0501035_0704370_378_680 96
371 3300049822 Ga0501035_1244907 Ga0501035_1244907_113_403 96
372 3300049823 Ga0501044_0012537 Ga0501044_0012537_8204_8506 96
373 3300049823 Ga0501044_0019932 Ga0501044_0019932_6718_7008 96
374 3300049823 Ga0501044_0072934 Ga0501044_0072934_28_318 96
375 3300049823 Ga0501044_0135187 Ga0501044_0135187_1442_1744 96
376 3300049823 Ga0501044_0189506 Ga0501044_0189506_690_992 96
377 3300049823 Ga0501044_0265875 Ga0501044_0265875_599_889 96
378 3300049823 Ga0501044_0349481 Ga0501044_0349481_642_932 96
379 3300050490 nmdc:mga03n38_250876_c1 nmdc:mga03n38_250876_c1_441_779 96
380 3300050491 nmdc:mga00v17_315423_c1 nmdc:mga00v17_315423_c1_398_688 96
381 3300050491 nmdc:mga00v17_706215_c1 nmdc:mga00v17_706215_c1_203_541 96
382 3300050492 nmdc:mga0yw44_686239_c1 nmdc:mga0yw44_686239_c1_221_511 96
383 3300050493 nmdc:mga0k408_479807_c1 nmdc:mga0k408_479807_c1_237_575 96
384 3300050494 nmdc:mga06z11_164314_c1 nmdc:mga06z11_164314_c1_403_741 96
385 3300050494 nmdc:mga06z11_629986_c1 nmdc:mga06z11_629986_c1_144_434 96
386 3300050512 nmdc:mga0n895_827362_c1 nmdc:mga0n895_827362_c1_575_865 96
387 3300050513 nmdc:mga0rr50_200614_c1 nmdc:mga0rr50_200614_c1_410_700 96
388 3300050513 nmdc:mga0rr50_8972_c1 nmdc:mga0rr50_8972_c1_1644_1934 96
389 3300050514 nmdc:mga08x19_324_c1 nmdc:mga08x19_324_c1_19950_20240 96
390 3300050514 nmdc:mga08x19_40524_c1 nmdc:mga08x19_40524_c1_435_725 96
391 3300053087 Ga0500643_203585 Ga0500643_203585_51_341 96
392 3300053096 Ga0500641_0061584 Ga0500641_0061584_323_613 96
393 3300053118 Ga0500594_0086038 Ga0500594_0086038_111_401 96
394 3300053119 Ga0500595_000492 Ga0500595_000492_17628_17918 96
395 3300053136 Ga0500559_0381654 Ga0500559_0381654_89_379 96
396 3300053140 Ga0500573_0304019 Ga0500573_0304019_418_708 96
397 3300059424 Ga0590075_020217 Ga0590075_020217_176_487 96
398 3300059426 Ga0590077_018917 Ga0590077_018917_271_582 96
399 3300060353 Ga0501082_0310757 Ga0501082_0310757_623_913 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

18

95

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.962 2 96
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.9428 2 96
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8885 2 92
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.8675 1 96
3bm7-assembly1.cif.gz_A-2 crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution 0.8669 2 92
ID Description Score Start End Superfamily
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9562 2 96 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9274 2 96 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8752 2 96 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8736 1 92 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8725 1 96 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A177Q9X7-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.005 1 96 GO:0004497
AF-A0A1Q3JMY8-F1-model_v4 deleted 0.9992 1 96
AF-A0A2W6BK86-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9986 1 94 GO:0004497
AF-A0A1A2EAZ6-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.998 1 93 GO:0004497
AF-A0A1Q3JN75-F1-model_v4 deleted 0.9978 1 96

Feature Viewer

pLDDT pTM Quality
97.45 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map